4HFDA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to bromoform
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfdA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfdA01
3SIOA 3SH1A 3JADA 3P4WA 4QH1A 2XQ4A 2C9TA 2BG9E 2WN9A 4HFEA 3IGQA 4FRRA 5AINA 5BW2A 5HEUA 4Z90A 4BQTA 3U8JA 4Z91A 4ZK4A 5AFMB 3EAMA 2XQ9A 2BR8A 3SQ6A 2BG9B 1UX2A 2XYSA 4UM3A 4AFHA 2BYNA 3U8KA 5HCMA 4QH5A 5CO5A 2YMEA 4PIRA 5CFBA 2WNJA 5HEGA 3WTMA 3U8LA 2UZ6A 4IL4A 1OEDE 3EHZA 4IL9A 3EI0A 3C79A 2W8FA 2BYRA 2VL0A 5TVCA 3UQ7A 2BYSA 3TLUA 4HQPA 4QACA 5J5FA 4TWDA 3U8NA 4TWFA 5KZUA 2XQ6A 2PGZA 4IREA 4QAAA 4ZJSA 4AFTA 4ZZBA 5HCJA 2Y54A 2XQ7A 4ALXA 2YOEA 3RIFA 4XK9A 5LXBA 2XQ3A 5J5IA 4HFIA 4B5DA 3ZKRA 3RQUA 4ILAA 4LMLA 3TLWA 4F8HA 2XQAA 4BFQA 4HFCA 2M6BA 4NPPA 5L4EA 2ZJVA 5AFKA 2KSRA 3RHWA 4ZZCA 4AFGA 2YMDA 3WTOA 2W8GA 3ZDGA 2WNLA 2M6IA 1UW6A 2X00A 3PMZA 2XNVA 2LM2A 5SYOA 3RQWA 2BYPA 3JAFA 3UU4A 4ZRUA 3ZDHA 4DBMA 5AFNA 3WTHA 5AFLA 3U8MA 5IUXA 2XYTA 2BYQA 5BRXA 4TWHA 2Y58A 5AFJA 2YN6A 5AFMA 3WTNA 3LSVA 4UM3S 4D01A 3TLTA 4ILCA 2BG9A 1UV6A 2WNCA 2X00D 4XHEA 4HFBA 3UQ4A 5L47A 3WIPA 2QC1B 4TNVA 3SQ9A 3UU5A 4ZJTA 1OEDC 2BG9C 3TLVA 3UUBA 3WTLA 3C84A 4LMJA 2LKGA 5JMEA 4UXUA 4HFDA 1OEDA 3UU3A 4A97A 5L4HA 2XQ8A 3TLSA 2PH9A 3GUAA 3PEOA 2XZ5A 4WV9A 2Y7YA 5BP0A 4QABA 5HEOA 5HEJA 2XZ6A 4HFHA 5FJVA 4EZ1A 2LLYA 4COFA 2WZYA 2XNTA 3T4MA 2BJ0A 4UM3P 5KE4A 2MAWA 2XNUA 5LG3A 2Y56A 2YKSA 5J5GA 2ZJUA 3UU6A 5J0ZA 3UU8A 2BR7A 3WTKA 4A98A 4X5TA 4ZK1A 3WTJA 4ILBA 3WTIA 5HEHA 2LKHA 3RIAA 4ZR6A 4NZBA 2XQ5A 3P50A 4TNWA 5AFHA 3RI5A 4QH4A 4LMKA 2Y57A 4UM1A 1I9BA 3JAEA 4UY2A 1OEDB 5J5HA
chains in the Genus database with same CATH superfamily
4H9QC 4U2YA 5FNVE 2CCQA 2W66A 5AQRB 5CJ5A 5DQVA 3O1HA 1NENA 2V26A 1AJ3A 3VU7H 4MFRA 5HCMA 2HHHT 4QH5A 2WSSV 3IHRA 4JI8T 4YHHT 5AQSB 2XAFB 1H7CA 4ZI3D 1N36T 1OXZA 3MACA 4X62T 3RX6A 4G63A 4H9RC 5A1LA 3AE6A 3RIFA 2WS3A 1ZHCA 5J5IA 5LHIB 4B5DA 3DTOA 4F8HA 2K24A 4O4JE 2KSRA 4U7YA 1VRBA 4MBQA 2WNLA 4OK0A 2BBHA 3O9XA 1R8IA 3E0ZA 4GK5E 3AAIA 3A5XA 1NAFA 5HXHA 3PURA 2DNXA 4YHJA 4YLHA 4IDOA 1I6ZA 4IT4A 3IBPA 2WU5A 1J1JA 3WTLA 3NRXA 3MK7C 4UXUA 1UK5A 2VQET 1HG5A 3RRCA 1T72A 4HWIB 4WV9A 4DV0T 2WZYA 4BJNA 3MZKB 4H63V 3KBTA 1WCRA 4ZK1A 5AQVB 3CWZB 2V7JA 1VOMA 4EV6A 4AKLA 2KNDA 4DR2T 3LK3B 4DV6T 1I9BA 1NEKA 1SA0E 4B6XA 3IEEA 2H3RA 5JH7E 4HN9A 2XQ4A 1HTJF 1WR0A 4HFEA 5AQLB 2L3LA 4Z90A 3U8JA 3UUMA 2KLQA 3EAMA 2VKOA 3BQLA 4U3CA 1JNRA 4WYVA 2A72A 2LHNA 4PIRA 2NTYA 2UU9T 4QKNA 4ZXLA 3RC8A 3PU8A 5L3CB 4I0UA 4MHCA 4K0KT 2XQ6A 3RKGA 3V5SA 3WAKA 4F6RC 2IC9A 2Y54A 4XZCA 4ZHQE 4U31A 5AQUB 3RQUA 4ILAA 4C91A 3K3NA 3UULA 3VRBA 1US7B 5JRCB 3C64A 3QB5K 4EOZB 2XNVA 2NOXA 3NWIA 3JAFA 3UU4A 4DBMA 4FI5A 2RA1A 2W00A 3U8MA 2D2SA 2BKOA 4TWHA 2H88A 3NZQA 3UFGA 5F5WA 2CXLA 4MLKA 1ZKEA 5HWYA 1IZNB 4YSZA 3GWHA 4WBNE 2I59A 1HX1B 4DUYT 4GIWA 2XY8B 5FJVA 3SWHA 3B13A 1S35A 2XZEA 3IF8B 3PV0F 5HXRA 2UXNB 3RIUC 2X9WA 4AKRB 3ZN0B 1E2AA 2JMKA 5FYMA 1M62A 4QH4A 3RI5A 1OEDB 4UV9B 2X67A 3N2GE 4WW0A 1CHUA 1LRZA 4K0UA 1U4QA 4EEDA 5LA6E 3JCFA 4AFHA 3U8KA 2VL8A 4H9SE 2CXFA 2XHEB 2B76A 3EI0A 1XWMA 4QACA 3U8NA 2IHR1 5FP3A 4XK9A 3UUNA 3QOFA 4JI1T 4YFSA 5L4EA 3FB2A 2YMDA 3WTOA 3KBUA 3PMZA 2VKJA 3RQWA 1V9DA 4U33A 3PUGA 5IUXA 3ETUA 2XSBA 2H7VC 1UV6A 4JI5T 2D5UA 1HFAA 4AI6A 2UUBT 3C84A 5AQQB 1VCSA 4A97A 4PK6A 1HS7A 4HFHA 2CLYB 5FY1A 2MAWA 5EK4A 1UUSA 4H9NC 3BQIA 5HEHA 1YQ4A 3RGLA 4PJNA 2I6HA 4H9OC 2JIWA 4TNWA 1W9RA 3ZC1A 1KF6A 5LCYA 4UM1A 3JAEA 2X0YA 3NBXX 2BS4A 5AINA 1OWAA 2EHOA 3IGQA 1BR4A 4MALA 3PUXF 1UX4A 5DJQC 1SUMB 3Q5WA 3WTMA 4AKGA 4IL9A 3OYXA 3UQ7A 5ETWA 3AAEB 3RF1A 4ISTA 2MPKA 2PGZA 2VKHA 3MJXA 4PK4A 3KFWX 2VQFT 4ASKA 2NTXA 2CWYA 1M7KA 4TN7B 3N9NA 1HNXT 4LMLA 1E1HB 3HKCE 2XAJB 1MMNA 2QRXA 2Y6XA 3F31A 1I94T 2JMHA 2CRBA 3PTRB 3L09A 4U7IA 2WP9A 5AQTB 2WU2A 4WZXA 2X00D 2HH7A 5AQOB 2LHRA 3D0TA 2QYWA 4LFAT 2OA5A 4H63H 4UELA 2XQ8A 4AIUA 4QABA 5JQGE 4HTEA 4X64T 3AEDA 2UXBT 1ZOYA 1GQEA 2WDRA 2XNUA 5LG3A 2JQHA 3CKDA 5CA0E 4LF4T 1WRDA 5DQWA 5HYAA 2MOZA 4EXTA 3AA7B 4JI7T 4EZHA 2BR8A 3HI2A 1UX2A 4PJMA 4I4TE 3PE0A 5HEGA 2VWAA 1CUNA 3E22E 1MMDA 2LSKA 1LVKA 2K48A 2WWVA 5IYZE 2J4GA 4AFTA 3LDQB 5AQGB 4L9IA 4DR6T 1FJGT 2W62A 4O8SA 3WTHA 3LK42 3LBXB 5AFLA 3ZT6A 3CX6B 2YU1A 3FZLB 2X9XA 5BRXA 3L3PA 4NUVA 3LSVA 1FMVA 4E7ZA 3UQ4A 3T8OA 3CIRA 2MTQA 5JR9C 2BG9C 2X68A 3AEGA 4O4HE 3UU3A 4AQFC 2LSGA 1JNZA 3P7IA 2DLRA 2CMRA 5FXWA 2IC6A 3QC9A 1KFYA 3AECA 4AQYT 1D1AA 3PUVF 5J0ZA 5CB4E 4A98A 2EHOD 3J7Yq 2LKHA 5EZYE 3VKGA 5JDGA 4X65T 4P1NA 4YJ3E 2Y57A 2FJDA 3JC6D 5FKYA 2E2AA 1KNPA 3P4WA 2V6YA 2HN2A 3PUZF 2BVMA 2BG9B 3AEBA 1IBKT 3MA9A 2FJBA 1HNZT 2FJEA 2SPCA 4Z8XA 3CVRA 4IL4A 2PG8A 1OEDE 4HKAA 2W8FA 2WDQA 2YU2A 3VR9A 4CN4A 4ALXA 2HN1A 2DL1A 2E9XB 4DMVA 3F57A 2XSAA 4NXMT 1QSDA 3PJAJ 3N9QA 4HFCA 2D0UA 3RHWA 2CBIA 4JI4T 3AEEA 4DV5T 5ADXL 3GMIA 2CXDA 3K3QC 3N9LA 5LXTE 4HWHA 3QNUA 3R84B 2Y58A 4XBFB 4LF9T 2XTLA 4YT0A 4U2ZA 3GN5A 2QC1B 4TNVA 3ZJ1A 3RLFF 2Y48B 4JI6T 1KK7A 5H6QB 1X9BA 3RRWA 2KWHA 2Y7YA 4PFOA 5HEOA 2XZ6A 4GKJT 3HKDE 2KXPB 4NIQA 3H37A 4CI3B 4HGAA 4IE7A 2KWIB 3NZPA 2R6GF 5JDHA 2XM1A 5FL1A 4NZBA 4UVAB 4ZI2C 3F2EA 3ZYMA 1KNZA 4YTPA 2H89A 2N1GA 4BJMA 3SIOA 4DR5T 4OX9T 2DWGA 4EB6E 2C9TA 2WN9A 2BG9E 1YKHB 5AFUL 5L3FB 4X66T 3PUQA 2C0SA 4JYAT 2BS2A 4YXDA 4Q25A 2ZLYA 2DWKA 5TVCA 1YKEB 3DP7A 5IHYA 4OYJA 5LXBA 2NR4A 1IJ6A 2M67A 4GK0E 5J2UE 4WNKA 5ABHA 3ZMZB 4BFQA 2W4XA 4EGWA 2XJ7A 5HXEA 3HR0A 2PTFA 2BYQA 4PAGA 2PFVA 5FVKA 2X66A 2JQ9A 3WAJA 4CXYA 3ZYLA 4KBMB 4GYRA 5L47A 4ISSA 3UU5A 4ZJTA 4UEMA 3UUBA 2X9HA 3ZMTB 4LMJA 2LKGA 4HFDA 3X1DA 2XAGB 5L4HA 3PEOA 4B3ST 3FZFB 5KE4A 3SRZA 2ODUA 3ZMUB 2H7OA 2BZBA 2EHOB 2ZMAA 3LG7A 5FVLA 1QLBA 4AXPA 1O3XA 4IDQA 5LJNA 3JADA 5LNKA 4YTNA 3RH3A 3RYHE 3IA3A 1MIYA 2PBIA 4CXWA 1N32T 4DNDA 4DV3T 2BYNA 3ZJ2A 2WM9A 2UZ6A 2WWUA 5FMNA 4B3TT 3AE7A 2BYSA 3TLUA 2ZM6T 2ZM0A 5KDMC 2XAHB 4BA9A 4TUYE 2YOEA 5LGUB 2KZ7B 3UFEA 3UT5E 2E9XD 2M6BA 2BYPA 3ZDHA 4LFCT 2AXDS 1N34T 4KP3C 4TV9E 3FZMB 2XM2A 1L0VA 5AFMA 3WTNA 4D01A 3LFMA 2BG9A 4XHEA 3WIPA 3LJCA 2GK9A 4KUMB 4HWFA 2IMLA 5C2TA 2CHOA 3AAAB 4KX6A 4HEAA 2PH9A 2XZ5A 2LT3A 4DR4T 2LLYA 2BJ0A 5ABGA 2LOSA 4ILBA 4DV4T 2XQ5A 5ABFB 1J5ET 4YSXA 4LFBT 4UY2A 4UXNB 4KHZF 2PJQA 2LRKA 3KVBA 4LF8T 3AE1A 4GKKT 5LBMA 3CQCB 3FZKB 4AQFA 2OV9A 1DU2A 2W63A 3U8LA 3B5MA 4JI2T 4O2BE 5F3JA 3KV6A 1B7TA 3OYZA 5KZUA 5LHHB 3TKLB 1VCTA 3FHNA 3PUYF 3ZKRA 3C50A 1UX5A 2XQAA 2RP4A 4X1YE 4I50E 2W8GA 3ZDGA 4IGUA 2M6IA 5LGTB 1UW6A 2X0LB 5L3BB 3ETVA 5KXJA 5E0OA 3V5UA 4UF0B 4UM3S 3ONXA 4PFPA 4HWDA 2RPAA 5BR8T 2KMFA 2J62A 4G2AA 3ESLA 4QX8B 5AQPB 4QXCB 2ACXA 5DABA 1ZP0A 2BBJA 5LJMA 4LF5T 3AA0B 3P4QA 2W61A 3O1JA 1MMAA 2E9XC 4CN1A 4UV8B 3P4RA 3O4XE 4EZ1A 2OLTA 2ES0A 1XZYA 1YXRA 2V5CA 2W0GA 4O4LE 5J5GA 2WMNA 3ANWA 2D0TA 4DR3T 2CEAA 4IDZA 1HX8A 3RIAA 4B3MT 2LE8A 1LVFA 3RYFE 2WAUA 4B3RT 2V8SV 3AXJA 4ANJA 2LJLA 2HPJA 2JPFA 2FJAA 2VK9A 3ABVA 3C4WA 4ZK4A 1D0YA 4NXNT 4UM3A 1BR2A 3ZYKA 2WNJA 4LF6T 3FXDB 1T8BA 1WLXA 3EDVA 4ZZBA 5HCJA 3ZC0A 2Q9QB 2LEHA 3N5LA 4WBOA 3RIUA 4OFZA 3VHLA 4I43B 4ZRUA 2VASA 2XUEA 1J5WA 3KV9A 2Y8DA 2YN6A 4ILCA 4UVCB 3ZMVB 4EZ4A 3K8PC 3TLVA 2WZHA 2ODVA 2ZM2A 5L2LA 4JUYA 5LHGB 3GN5B 4UR9A 2CA5A 2E5LT 3PUWF 2LOPA 3T4MA 4HE8A 2UXXB 4QX7B 3ZCIA 4A56A 4X5TA 2ACZA 3AEAA 3E08A 4YSYA 3EUHA 2IW5B 3SOLA 3WTJA 2QGSA 2YEVC 3OBVE 4X1IE 3I0QA 5LP6E 3OJAA 4TV8E 2A2FX 4ERRA 2W2UA 5JDLA 4HFVA 4BQTA 4AQGA 2BDEA 4DO0A 2XQ9A 3UTKA 2V7LA 2JJ9A 1S94A 2D9DA 3M3ZB 3AVSA 2YMEA 4EYYR 5BMVE 4OHFA 3SS1A 3FZHB 2X51A 4DR1T 4EYUA 3OVUA 2BYRA 5M4YA 2CPTA 2LRLA 3FBZA 3AE9A 4ZI2D 2V1DB 4ZS2A 2UUAT 3R6NA 3CK6A 4M1PA 2I0MA 1IJ5A 3NRYA 5AFKA 1Y01A 3I9WA 4L0RA 1BR0A 3AE2A 2C5IT 4YY3T 2K3WA 3I9YA 1UGOA 2X00A 4JEUB 5SYOA 5JR9B 3Q9DA 2C5JA 2E5VA 1WR6A 3DJBA 1G73A 3TLTA 3SQ9A 1MIWA 3C4ZA 3KINB 3U78A 1YW0A 2MYSA 3QB5A 3BQKA 3UUXB 3PDYA 1D0XA 5KMGP 5CGMA 5AQIB 2VVNA 2L8KA 4DV2T 4CZZB 4ZR6A 4IDPA 3K3OA 2NWBA 5J5FA 3MKDA 2UXCT 4KHPT 5J5HA 2DI4A 2CE7A 4QH1A 1MNEA 4I55E 1UCUA 4UIGA 2J1DG 2YDRA 3T1HT 5CO5A 1FIOA 2V7IA 2IDOB 3JC6C 4PJJA 5ABFA 4EIWA 4AKHA 2A9UA 3EVYA 3A8YC 5JRCA 3FXEB 2JQQA 5J2TE 2YINA 2J47A 2CLYC 4DBQA 1X79A 1UURA 2P9BA 2ZM8A 4JI3T 2HPLA 5AQJB 5LMUT 4ZZCA 3HL6A 2DHRA 2BKPA 5HAXA 3N9OA 3RPUA 3C51A 5AFNA 2BKNA 3FBLA 3QK6A 3NKZA 5JDFA 2IIUA 3T1YT 3ANWB 5GONE 2WNCA 3N2OA 4PW8A 5JR9A 2K5BB 1NWMX 2WB5A 1Z8UA 2YK0A 5HXSA 2FUPA 3RC3A 3WI3A 3Q5XA 3AB3B 4QWNB 5AQMB 5LGNB 4U74A 2Q9QC 2UXDT 5L3GB 5HEJA 3U3IA 3ZMSB 2NW8A 2CHNA 2NP9A 2Y56A 1EZ3A 2WBLA 2YKSA 1QUUA 4DV1T 1XMOT 4IE0A 4X20E 4GOUA 3Q5DA 1IBLT 4ZS3A 5LMNT 3P4PA 2KT9A 1WFDA 4UF0A 1E7PA 4V1Av 3SQ6A 4EAHA 2VURA 3PUSA 4BAYB 3EHZA 1XMQT 4DR7T 4O2AE 4HQPA 2BS3A 3HKBE 5FXXA 2VB6A 3KDSE 4JBWF 3ZEFB 2LM9A 2V7KA 4UVBB 2XQ3A 4HFIA 5IWAT 3TLWA 2V5DA 4IIJE 4P0AA 4DIDB 4HWCA 5KX5E 2E8IA 5JDMA 3AE8A 2UUCT 3RKOA 2LSIA 5F8PA 2V6XA 3ZN1B 5ABEA 2F4VT 5LG4A 2XQYA 3M65A 1FMWA 4HFBA 5LB7B 4EEBA 2EHOC 2L9QA 5FL0A 1U5PA 1OEDC 2WQYA 1Z0PA 3L8RA 1G8XA 1XNRT 4TZ4C 5BP0A 1T98A 4XAXB 2Z6EA 5H6RB 5J1GA 2E9XA 4QHOA 3UU6A 5HWXA 3WTKA 4QXBB 3WTIA 3PJAA 1YQ3A 5AFHA 1XDOA 4TX5A 2VVSA 2AE9A 2LSJA 5AQNB 4FRRA 5FXZA 4IHJE 5AFMB 5LOVE 3S4UA 2X0HA 3I0OA 3O1IA 3RYIE 4KMCA 4JEHB 1ZEEA 4TWFA 3ONJA 1HF8A 3CQXC 4QAAA 3MXZA 3PUAA 2XQ7A 3N9MA 3KVAA 5C8YE 1WYCA 3KV4A 4YTMA 3H3MA 2JQKA 4NPPA 2ZJVA 2KINB 3HA4A 3SFDA 4FJOA 3OTOT 3Q5EA 3EABA 3H3AA 4GYSA 4JV5T 5FY7A 3K1SA 1MMGA 1W0BA 5AFJA 3ZT7A 1D0ZA 2DCFA 2WCAA 3A7MA 4PNIA 1D1BA 4QXHB 3AE3A 3ZT5A 2JRKA 2V7MA 2YDQA 3TLSA 3P8CD 2QVAA 2WMOA 3ONLC 4AKIA 1ZV4X 2QA7A 3HKEE 2WZIA 4OYKA 3GA8A 2XNTA 3I1AA 3CX7B 1SE7A 3AXJB 5TAOA 4ZI7E 3AE4A 4CN6A 4KI0F 5CA1E 4LMKA 4DBRA 3ZSSA 3N9PA 2VKDA 2XPKA 4N78D 4E7SA 5AQKB 1HG2A 5C3JA 2BVLA 4ILUA 3CQGB 4H9PC 4Z91A 5JDQA 1W0AA 5EK2A 1FEWA 4DV7T 4CI1B 2XYSA 1XNQT 2XASB 4DUZT 5CFBA 2CBJA 3SFEA 3C79A 1D1CA 1HR0T 1KNRA 4IREA 2WDVA 3CX8B 5AQHB 5JDNA 2G0UA 3CMLA 2N2NA 1IBMT 3J9X1 3AE5A 2IUBA 3AEFA 5FXVA 3LK2B 4CXXA 3W15B 2CM0A 2YDSA 4NUUA 3LBXA 5JTGA 5EK3A 4C90A 1YD8G 4X1KE 3C98B 2B1EA 3AA1B 1HNWT 5JMEA 1OEDA 3VKHA 4CI2B 1MNDA 4CQIA 1XDPA 4AISA 1T7SA 3QUJA 4U72A 4COFA 5HXCA 4UM3P 4ZI3C 3ZPOA 4PJLA 2BR7A 1LKXA 4L5GA 3VR8A 2MBGA 4ADZA 2X9YA 3Q2MA 4LF7T 1Y64B 3OPCA 3PU3A 3SH1A 2NW9A 5BW2A 4DVDA 1IAPA 5HEUA 4YJ2E 4P0BA 1HCIA 4ZEYA 3NVOA 2C5KT 4A5XA 5AQFB 2IAKA 3KV5A 2VL0A 2A3DA 3L39A 4TWDA 2W67A 3ZCJA 4ZJSA 4IE4A 2Q9QD 5L3DB 4AFGA 3OKQA 2CWOA 1KEYA 3C4XA 2LSYA 2LM2A 4IE6A 4J2CA 4O4IE 5FY0A 2XYTA 3AA6B 2XAQB 4P09A 2V6YB 4ZOLE 5LYJE 3CPZA 3ZSTA 2WY2A 5JREA 1MIVA 2NW7A 2FBWA 3VRAA 1N33T 4IDNA 3EDUA 3GUAA 3B57A 3RYCE 3N2KE 3AVRA 5L3EB 2ZJUA 1BR1A 4IE5A 3UU8A 3P4SA 1W09A 4JLEA 3BK9A 5LBQB 4JI0T 3ZLIA 2Q9QA 1WYBA 4PK5A 3P50A 2K9AA 4DMWA 5JVDE 2N9DA 1SHZC 3G06A
chains in the Genus database with same CATH topology
3SIOA 3SH1A 3JADA 3P4WA 4QH1A 2XQ4A 2C9TA 2BG9E 2WN9A 4HFEA 3IGQA 4FRRA 5AINA 5BW2A 5HEUA 4Z90A 4BQTA 3U8JA 4Z91A 4ZK4A 5AFMB 3EAMA 2XQ9A 2BR8A 3SQ6A 2BG9B 1UX2A 2XYSA 4UM3A 4AFHA 2BYNA 3U8KA 5HCMA 4QH5A 5CO5A 2YMEA 4PIRA 5CFBA 2WNJA 5HEGA 3WTMA 3U8LA 2UZ6A 4IL4A 1OEDE 3EHZA 4IL9A 3EI0A 3C79A 2W8FA 2BYRA 2VL0A 5TVCA 3UQ7A 2BYSA 3TLUA 4HQPA 4QACA 5J5FA 4TWDA 3U8NA 4TWFA 5KZUA 2XQ6A 2PGZA 4IREA 4QAAA 4ZJSA 4AFTA 4ZZBA 5HCJA 2Y54A 2XQ7A 4ALXA 2YOEA 3RIFA 4XK9A 5LXBA 2XQ3A 5J5IA 4HFIA 4B5DA 3ZKRA 3RQUA 4ILAA 4LMLA 3TLWA 4F8HA 2XQAA 4BFQA 4HFCA 2M6BA 4NPPA 5L4EA 2ZJVA 5AFKA 2KSRA 3RHWA 4ZZCA 4AFGA 2YMDA 3WTOA 2W8GA 3ZDGA 2WNLA 2M6IA 1UW6A 2X00A 3PMZA 2XNVA 2LM2A 5SYOA 3RQWA 2BYPA 3JAFA 3UU4A 4ZRUA 3ZDHA 4DBMA 5AFNA 3WTHA 5AFLA 3U8MA 5IUXA 2XYTA 2BYQA 5BRXA 4TWHA 2Y58A 5AFJA 2YN6A 5AFMA 3WTNA 3LSVA 4UM3S 4D01A 3TLTA 4ILCA 2BG9A 1UV6A 2WNCA 2X00D 4XHEA 4HFBA 3UQ4A 5L47A 3WIPA 2QC1B 4TNVA 3SQ9A 3UU5A 4ZJTA 1OEDC 2BG9C 3TLVA 3UUBA 3WTLA 3C84A 4LMJA 2LKGA 5JMEA 4UXUA 4HFDA 1OEDA 3UU3A 4A97A 5L4HA 2XQ8A 3TLSA 2PH9A 3GUAA 3PEOA 2XZ5A 4WV9A 2Y7YA 5BP0A 4QABA 5HEOA 5HEJA 2XZ6A 4HFHA 5FJVA 4EZ1A 2LLYA 4COFA 2WZYA 2XNTA 3T4MA 2BJ0A 4UM3P 5KE4A 2MAWA 2XNUA 5LG3A 2Y56A 2YKSA 5J5GA 2ZJUA 3UU6A 5J0ZA 3UU8A 2BR7A 3WTKA 4A98A 4X5TA 4ZK1A 3WTJA 4ILBA 3WTIA 5HEHA 2LKHA 3RIAA 4ZR6A 4NZBA 2XQ5A 3P50A 4TNWA 5AFHA 3RI5A 4QH4A 4LMKA 2Y57A 4UM1A 1I9BA 3JAEA 4UY2A 1OEDB 5J5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIO A;  3SH1 A;  3JAD A;  3P4W A;  4QH1 A;  2XQ4 A;  2C9T A;  2BG9 E;  2WN9 A;  4HFE A;  3IGQ A;  4FRR A;  5AIN A;  5BW2 A;  5HEU A;  4Z90 A;  4BQT A;  3U8J A;  4Z91 A;  4ZK4 A;  5AFM B;  3EAM A;  2XQ9 A;  2BR8 A;  3SQ6 A;  2BG9 B;  1UX2 A;  2XYS A;  4UM3 A;  4AFH A;  2BYN A;  3U8K A;  5HCM A;  4QH5 A;  5CO5 A;  2YME A;  4PIR A;  5CFB A;  2WNJ A;  5HEG A;  3WTM A;  3U8L A;  2UZ6 A;  4IL4 A;  1OED E;  3EHZ A;  4IL9 A;  3EI0 A;  3C79 A;  2W8F A;  2BYR A;  2VL0 A;  5TVC A;  3UQ7 A;  2BYS A;  3TLU A;  4HQP A;  4QAC A;  5J5F A;  4TWD A;  3U8N A;  4TWF A;  5KZU A;  2XQ6 A;  2PGZ A;  4IRE A;  4QAA A;  4ZJS A;  4AFT A;  4ZZB A;  5HCJ A;  2Y54 A;  2XQ7 A;  4ALX A;  2YOE A;  3RIF A;  4XK9 A;  5LXB A;  2XQ3 A;  5J5I A;  4HFI A;  4B5D A;  3ZKR A;  3RQU A;  4ILA A;  4LML A;  3TLW A;  4F8H A;  2XQA A;  4BFQ A;  4HFC A;  2M6B A;  4NPP A;  5L4E A;  2ZJV A;  5AFK A;  2KSR A;  3RHW A;  4ZZC A;  4AFG A;  2YMD A;  3WTO A;  2W8G A;  3ZDG A;  2WNL A;  2M6I A;  1UW6 A;  2X00 A;  3PMZ A;  2XNV A;  2LM2 A;  5SYO A;  3RQW A;  2BYP A;  3JAF A;  3UU4 A;  4ZRU A;  3ZDH A;  4DBM A;  5AFN A;  3WTH A;  5AFL A;  3U8M A;  5IUX A;  2XYT A;  2BYQ A;  5BRX A;  4TWH A;  2Y58 A;  5AFJ A;  2YN6 A;  5AFM A;  3WTN A;  3LSV A;  4UM3 S;  4D01 A;  3TLT A;  4ILC A;  2BG9 A;  1UV6 A;  2WNC A;  2X00 D;  4XHE A;  4HFB A;  3UQ4 A;  5L47 A;  3WIP A;  2QC1 B;  4TNV A;  3SQ9 A;  3UU5 A;  4ZJT A;  1OED C;  2BG9 C;  3TLV A;  3UUB A;  3WTL A;  3C84 A;  4LMJ A;  2LKG A;  5JME A;  4UXU A;  4HFD A;  1OED A;  3UU3 A;  4A97 A;  5L4H A;  2XQ8 A;  3TLS A;  2PH9 A;  3GUA A;  3PEO A;  2XZ5 A;  4WV9 A;  2Y7Y A;  5BP0 A;  4QAB A;  5HEO A;  5HEJ A;  2XZ6 A;  4HFH A;  5FJV A;  4EZ1 A;  2LLY A;  4COF A;  2WZY A;  2XNT A;  3T4M A;  2BJ0 A;  4UM3 P;  5KE4 A;  2MAW A;  2XNU A;  5LG3 A;  2Y56 A;  2YKS A;  5J5G A;  2ZJU A;  3UU6 A;  5J0Z A;  3UU8 A;  2BR7 A;  3WTK A;  4A98 A;  4X5T A;  4ZK1 A;  3WTJ A;  4ILB A;  3WTI A;  5HEH A;  2LKH A;  3RIA A;  4ZR6 A;  4NZB A;  2XQ5 A;  3P50 A;  4TNW A;  5AFH A;  3RI5 A;  4QH4 A;  4LMK A;  2Y57 A;  4UM1 A;  1I9B A;  3JAE A;  4UY2 A;  1OED B;  5J5H A; 
#chains in the Genus database with same CATH topology
 4H9Q C;  4U2Y A;  5FNV E;  2CCQ A;  2W66 A;  5AQR B;  5CJ5 A;  5DQV A;  3O1H A;  1NEN A;  2V26 A;  1AJ3 A;  3VU7 H;  4MFR A;  5HCM A;  2HHH T;  4QH5 A;  2WSS V;  3IHR A;  4JI8 T;  4YHH T;  5AQS B;  2XAF B;  1H7C A;  4ZI3 D;  1N36 T;  1OXZ A;  3MAC A;  4X62 T;  3RX6 A;  4G63 A;  4H9R C;  5A1L A;  3AE6 A;  3RIF A;  2WS3 A;  1ZHC A;  5J5I A;  5LHI B;  4B5D A;  3DTO A;  4F8H A;  2K24 A;  4O4J E;  2KSR A;  4U7Y A;  1VRB A;  4MBQ A;  2WNL A;  4OK0 A;  2BBH A;  3O9X A;  1R8I A;  3E0Z A;  4GK5 E;  3AAI A;  3A5X A;  1NAF A;  5HXH A;  3PUR A;  2DNX A;  4YHJ A;  4YLH A;  4IDO A;  1I6Z A;  4IT4 A;  3IBP A;  2WU5 A;  1J1J A;  3WTL A;  3NRX A;  3MK7 C;  4UXU A;  1UK5 A;  2VQE T;  1HG5 A;  3RRC A;  1T72 A;  4HWI B;  4WV9 A;  4DV0 T;  2WZY A;  4BJN A;  3MZK B;  4H63 V;  3KBT A;  1WCR A;  4ZK1 A;  5AQV B;  3CWZ B;  2V7J A;  1VOM A;  4EV6 A;  4AKL A;  2KND A;  4DR2 T;  3LK3 B;  4DV6 T;  1I9B A;  1NEK A;  1SA0 E;  4B6X A;  3IEE A;  2H3R A;  5JH7 E;  4HN9 A;  2XQ4 A;  1HTJ F;  1WR0 A;  4HFE A;  5AQL B;  2L3L A;  4Z90 A;  3U8J A;  3UUM A;  2KLQ A;  3EAM A;  2VKO A;  3BQL A;  4U3C A;  1JNR A;  4WYV A;  2A72 A;  2LHN A;  4PIR A;  2NTY A;  2UU9 T;  4QKN A;  4ZXL A;  3RC8 A;  3PU8 A;  5L3C B;  4I0U A;  4MHC A;  4K0K T;  2XQ6 A;  3RKG A;  3V5S A;  3WAK A;  4F6R C;  2IC9 A;  2Y54 A;  4XZC A;  4ZHQ E;  4U31 A;  5AQU B;  3RQU A;  4ILA A;  4C91 A;  3K3N A;  3UUL A;  3VRB A;  1US7 B;  5JRC B;  3C64 A;  3QB5 K;  4EOZ B;  2XNV A;  2NOX A;  3NWI A;  3JAF A;  3UU4 A;  4DBM A;  4FI5 A;  2RA1 A;  2W00 A;  3U8M A;  2D2S A;  2BKO A;  4TWH A;  2H88 A;  3NZQ A;  3UFG A;  5F5W A;  2CXL A;  4MLK A;  1ZKE A;  5HWY A;  1IZN B;  4YSZ A;  3GWH A;  4WBN E;  2I59 A;  1HX1 B;  4DUY T;  4GIW A;  2XY8 B;  5FJV A;  3SWH A;  3B13 A;  1S35 A;  2XZE A;  3IF8 B;  3PV0 F;  5HXR A;  2UXN B;  3RIU C;  2X9W A;  4AKR B;  3ZN0 B;  1E2A A;  2JMK A;  5FYM A;  1M62 A;  4QH4 A;  3RI5 A;  1OED B;  4UV9 B;  2X67 A;  3N2G E;  4WW0 A;  1CHU A;  1LRZ A;  4K0U A;  1U4Q A;  4EED A;  5LA6 E;  3JCF A;  4AFH A;  3U8K A;  2VL8 A;  4H9S E;  2CXF A;  2XHE B;  2B76 A;  3EI0 A;  1XWM A;  4QAC A;  3U8N A;  2IHR 1;  5FP3 A;  4XK9 A;  3UUN A;  3QOF A;  4JI1 T;  4YFS A;  5L4E A;  3FB2 A;  2YMD A;  3WTO A;  3KBU A;  3PMZ A;  2VKJ A;  3RQW A;  1V9D A;  4U33 A;  3PUG A;  5IUX A;  3ETU A;  2XSB A;  2H7V C;  1UV6 A;  4JI5 T;  2D5U A;  1HFA A;  4AI6 A;  2UUB T;  3C84 A;  5AQQ B;  1VCS A;  4A97 A;  4PK6 A;  1HS7 A;  4HFH A;  2CLY B;  5FY1 A;  2MAW A;  5EK4 A;  1UUS A;  4H9N C;  3BQI A;  5HEH A;  1YQ4 A;  3RGL A;  4PJN A;  2I6H A;  4H9O C;  2JIW A;  4TNW A;  1W9R A;  3ZC1 A;  1KF6 A;  5LCY A;  4UM1 A;  3JAE A;  2X0Y A;  3NBX X;  2BS4 A;  5AIN A;  1OWA A;  2EHO A;  3IGQ A;  1BR4 A;  4MAL A;  3PUX F;  1UX4 A;  5DJQ C;  1SUM B;  3Q5W A;  3WTM A;  4AKG A;  4IL9 A;  3OYX A;  3UQ7 A;  5ETW A;  3AAE B;  3RF1 A;  4IST A;  2MPK A;  2PGZ A;  2VKH A;  3MJX A;  4PK4 A;  3KFW X;  2VQF T;  4ASK A;  2NTX A;  2CWY A;  1M7K A;  4TN7 B;  3N9N A;  1HNX T;  4LML A;  1E1H B;  3HKC E;  2XAJ B;  1MMN A;  2QRX A;  2Y6X A;  3F31 A;  1I94 T;  2JMH A;  2CRB A;  3PTR B;  3L09 A;  4U7I A;  2WP9 A;  5AQT B;  2WU2 A;  4WZX A;  2X00 D;  2HH7 A;  5AQO B;  2LHR A;  3D0T A;  2QYW A;  4LFA T;  2OA5 A;  4H63 H;  4UEL A;  2XQ8 A;  4AIU A;  4QAB A;  5JQG E;  4HTE A;  4X64 T;  3AED A;  2UXB T;  1ZOY A;  1GQE A;  2WDR A;  2XNU A;  5LG3 A;  2JQH A;  3CKD A;  5CA0 E;  4LF4 T;  1WRD A;  5DQW A;  5HYA A;  2MOZ A;  4EXT A;  3AA7 B;  4JI7 T;  4EZH A;  2BR8 A;  3HI2 A;  1UX2 A;  4PJM A;  4I4T E;  3PE0 A;  5HEG A;  2VWA A;  1CUN A;  3E22 E;  1MMD A;  2LSK A;  1LVK A;  2K48 A;  2WWV A;  5IYZ E;  2J4G A;  4AFT A;  3LDQ B;  5AQG B;  4L9I A;  4DR6 T;  1FJG T;  2W62 A;  4O8S A;  3WTH A;  3LK4 2;  3LBX B;  5AFL A;  3ZT6 A;  3CX6 B;  2YU1 A;  3FZL B;  2X9X A;  5BRX A;  3L3P A;  4NUV A;  3LSV A;  1FMV A;  4E7Z A;  3UQ4 A;  3T8O A;  3CIR A;  2MTQ A;  5JR9 C;  2BG9 C;  2X68 A;  3AEG A;  4O4H E;  3UU3 A;  4AQF C;  2LSG A;  1JNZ A;  3P7I A;  2DLR A;  2CMR A;  5FXW A;  2IC6 A;  3QC9 A;  1KFY A;  3AEC A;  4AQY T;  1D1A A;  3PUV F;  5J0Z A;  5CB4 E;  4A98 A;  2EHO D;  3J7Y q;  2LKH A;  5EZY E;  3VKG A;  5JDG A;  4X65 T;  4P1N A;  4YJ3 E;  2Y57 A;  2FJD A;  3JC6 D;  5FKY A;  2E2A A;  1KNP A;  3P4W A;  2V6Y A;  2HN2 A;  3PUZ F;  2BVM A;  2BG9 B;  3AEB A;  1IBK T;  3MA9 A;  2FJB A;  1HNZ T;  2FJE A;  2SPC A;  4Z8X A;  3CVR A;  4IL4 A;  2PG8 A;  1OED E;  4HKA A;  2W8F A;  2WDQ A;  2YU2 A;  3VR9 A;  4CN4 A;  4ALX A;  2HN1 A;  2DL1 A;  2E9X B;  4DMV A;  3F57 A;  2XSA A;  4NXM T;  1QSD A;  3PJA J;  3N9Q A;  4HFC A;  2D0U A;  3RHW A;  2CBI A;  4JI4 T;  3AEE A;  4DV5 T;  5ADX L;  3GMI A;  2CXD A;  3K3Q C;  3N9L A;  5LXT E;  4HWH A;  3QNU A;  3R84 B;  2Y58 A;  4XBF B;  4LF9 T;  2XTL A;  4YT0 A;  4U2Z A;  3GN5 A;  2QC1 B;  4TNV A;  3ZJ1 A;  3RLF F;  2Y48 B;  4JI6 T;  1KK7 A;  5H6Q B;  1X9B A;  3RRW A;  2KWH A;  2Y7Y A;  4PFO A;  5HEO A;  2XZ6 A;  4GKJ T;  3HKD E;  2KXP B;  4NIQ A;  3H37 A;  4CI3 B;  4HGA A;  4IE7 A;  2KWI B;  3NZP A;  2R6G F;  5JDH A;  2XM1 A;  5FL1 A;  4NZB A;  4UVA B;  4ZI2 C;  3F2E A;  3ZYM A;  1KNZ A;  4YTP A;  2H89 A;  2N1G A;  4BJM A;  3SIO A;  4DR5 T;  4OX9 T;  2DWG A;  4EB6 E;  2C9T A;  2WN9 A;  2BG9 E;  1YKH B;  5AFU L;  5L3F B;  4X66 T;  3PUQ A;  2C0S A;  4JYA T;  2BS2 A;  4YXD A;  4Q25 A;  2ZLY A;  2DWK A;  5TVC A;  1YKE B;  3DP7 A;  5IHY A;  4OYJ A;  5LXB A;  2NR4 A;  1IJ6 A;  2M67 A;  4GK0 E;  5J2U E;  4WNK A;  5ABH A;  3ZMZ B;  4BFQ A;  2W4X A;  4EGW A;  2XJ7 A;  5HXE A;  3HR0 A;  2PTF A;  2BYQ A;  4PAG A;  2PFV A;  5FVK A;  2X66 A;  2JQ9 A;  3WAJ A;  4CXY A;  3ZYL A;  4KBM B;  4GYR A;  5L47 A;  4ISS A;  3UU5 A;  4ZJT A;  4UEM A;  3UUB A;  2X9H A;  3ZMT B;  4LMJ A;  2LKG A;  4HFD A;  3X1D A;  2XAG B;  5L4H A;  3PEO A;  4B3S T;  3FZF B;  5KE4 A;  3SRZ A;  2ODU A;  3ZMU B;  2H7O A;  2BZB A;  2EHO B;  2ZMA A;  3LG7 A;  5FVL A;  1QLB A;  4AXP A;  1O3X A;  4IDQ A;  5LJN A;  3JAD A;  5LNK A;  4YTN A;  3RH3 A;  3RYH E;  3IA3 A;  1MIY A;  2PBI A;  4CXW A;  1N32 T;  4DND A;  4DV3 T;  2BYN A;  3ZJ2 A;  2WM9 A;  2UZ6 A;  2WWU A;  5FMN A;  4B3T T;  3AE7 A;  2BYS A;  3TLU A;  2ZM6 T;  2ZM0 A;  5KDM C;  2XAH B;  4BA9 A;  4TUY E;  2YOE A;  5LGU B;  2KZ7 B;  3UFE A;  3UT5 E;  2E9X D;  2M6B A;  2BYP A;  3ZDH A;  4LFC T;  2AXD S;  1N34 T;  4KP3 C;  4TV9 E;  3FZM B;  2XM2 A;  1L0V A;  5AFM A;  3WTN A;  4D01 A;  3LFM A;  2BG9 A;  4XHE A;  3WIP A;  3LJC A;  2GK9 A;  4KUM B;  4HWF A;  2IML A;  5C2T A;  2CHO A;  3AAA B;  4KX6 A;  4HEA A;  2PH9 A;  2XZ5 A;  2LT3 A;  4DR4 T;  2LLY A;  2BJ0 A;  5ABG A;  2LOS A;  4ILB A;  4DV4 T;  2XQ5 A;  5ABF B;  1J5E T;  4YSX A;  4LFB T;  4UY2 A;  4UXN B;  4KHZ F;  2PJQ A;  2LRK A;  3KVB A;  4LF8 T;  3AE1 A;  4GKK T;  5LBM A;  3CQC B;  3FZK B;  4AQF A;  2OV9 A;  1DU2 A;  2W63 A;  3U8L A;  3B5M A;  4JI2 T;  4O2B E;  5F3J A;  3KV6 A;  1B7T A;  3OYZ A;  5KZU A;  5LHH B;  3TKL B;  1VCT A;  3FHN A;  3PUY F;  3ZKR A;  3C50 A;  1UX5 A;  2XQA A;  2RP4 A;  4X1Y E;  4I50 E;  2W8G A;  3ZDG A;  4IGU A;  2M6I A;  5LGT B;  1UW6 A;  2X0L B;  5L3B B;  3ETV A;  5KXJ A;  5E0O A;  3V5U A;  4UF0 B;  4UM3 S;  3ONX A;  4PFP A;  4HWD A;  2RPA A;  5BR8 T;  2KMF A;  2J62 A;  4G2A A;  3ESL A;  4QX8 B;  5AQP B;  4QXC B;  2ACX A;  5DAB A;  1ZP0 A;  2BBJ A;  5LJM A;  4LF5 T;  3AA0 B;  3P4Q A;  2W61 A;  3O1J A;  1MMA A;  2E9X C;  4CN1 A;  4UV8 B;  3P4R A;  3O4X E;  4EZ1 A;  2OLT A;  2ES0 A;  1XZY A;  1YXR A;  2V5C A;  2W0G A;  4O4L E;  5J5G A;  2WMN A;  3ANW A;  2D0T A;  4DR3 T;  2CEA A;  4IDZ A;  1HX8 A;  3RIA A;  4B3M T;  2LE8 A;  1LVF A;  3RYF E;  2WAU A;  4B3R T;  2V8S V;  3AXJ A;  4ANJ A;  2LJL A;  2HPJ A;  2JPF A;  2FJA A;  2VK9 A;  3ABV A;  3C4W A;  4ZK4 A;  1D0Y A;  4NXN T;  4UM3 A;  1BR2 A;  3ZYK A;  2WNJ A;  4LF6 T;  3FXD B;  1T8B A;  1WLX A;  3EDV A;  4ZZB A;  5HCJ A;  3ZC0 A;  2Q9Q B;  2LEH A;  3N5L A;  4WBO A;  3RIU A;  4OFZ A;  3VHL A;  4I43 B;  4ZRU A;  2VAS A;  2XUE A;  1J5W A;  3KV9 A;  2Y8D A;  2YN6 A;  4ILC A;  4UVC B;  3ZMV B;  4EZ4 A;  3K8P C;  3TLV A;  2WZH A;  2ODV A;  2ZM2 A;  5L2L A;  4JUY A;  5LHG B;  3GN5 B;  4UR9 A;  2CA5 A;  2E5L T;  3PUW F;  2LOP A;  3T4M A;  4HE8 A;  2UXX B;  4QX7 B;  3ZCI A;  4A56 A;  4X5T A;  2ACZ A;  3AEA A;  3E08 A;  4YSY A;  3EUH A;  2IW5 B;  3SOL A;  3WTJ A;  2QGS A;  2YEV C;  3OBV E;  4X1I E;  3I0Q A;  5LP6 E;  3OJA A;  4TV8 E;  2A2F X;  4ERR A;  2W2U A;  5JDL A;  4HFV A;  4BQT A;  4AQG A;  2BDE A;  4DO0 A;  2XQ9 A;  3UTK A;  2V7L A;  2JJ9 A;  1S94 A;  2D9D A;  3M3Z B;  3AVS A;  2YME A;  4EYY R;  5BMV E;  4OHF A;  3SS1 A;  3FZH B;  2X51 A;  4DR1 T;  4EYU A;  3OVU A;  2BYR A;  5M4Y A;  2CPT A;  2LRL A;  3FBZ A;  3AE9 A;  4ZI2 D;  2V1D B;  4ZS2 A;  2UUA T;  3R6N A;  3CK6 A;  4M1P A;  2I0M A;  1IJ5 A;  3NRY A;  5AFK A;  1Y01 A;  3I9W A;  4L0R A;  1BR0 A;  3AE2 A;  2C5I T;  4YY3 T;  2K3W A;  3I9Y A;  1UGO A;  2X00 A;  4JEU B;  5SYO A;  5JR9 B;  3Q9D A;  2C5J A;  2E5V A;  1WR6 A;  3DJB A;  1G73 A;  3TLT A;  3SQ9 A;  1MIW A;  3C4Z A;  3KIN B;  3U78 A;  1YW0 A;  2MYS A;  3QB5 A;  3BQK A;  3UUX B;  3PDY A;  1D0X A;  5KMG P;  5CGM A;  5AQI B;  2VVN A;  2L8K A;  4DV2 T;  4CZZ B;  4ZR6 A;  4IDP A;  3K3O A;  2NWB A;  5J5F A;  3MKD A;  2UXC T;  4KHP T;  5J5H A;  2DI4 A;  2CE7 A;  4QH1 A;  1MNE A;  4I55 E;  1UCU A;  4UIG A;  2J1D G;  2YDR A;  3T1H T;  5CO5 A;  1FIO A;  2V7I A;  2IDO B;  3JC6 C;  4PJJ A;  5ABF A;  4EIW A;  4AKH A;  2A9U A;  3EVY A;  3A8Y C;  5JRC A;  3FXE B;  2JQQ A;  5J2T E;  2YIN A;  2J47 A;  2CLY C;  4DBQ A;  1X79 A;  1UUR A;  2P9B A;  2ZM8 A;  4JI3 T;  2HPL A;  5AQJ B;  5LMU T;  4ZZC A;  3HL6 A;  2DHR A;  2BKP A;  5HAX A;  3N9O A;  3RPU A;  3C51 A;  5AFN A;  2BKN A;  3FBL A;  3QK6 A;  3NKZ A;  5JDF A;  2IIU A;  3T1Y T;  3ANW B;  5GON E;  2WNC A;  3N2O A;  4PW8 A;  5JR9 A;  2K5B B;  1NWM X;  2WB5 A;  1Z8U A;  2YK0 A;  5HXS A;  2FUP A;  3RC3 A;  3WI3 A;  3Q5X A;  3AB3 B;  4QWN B;  5AQM B;  5LGN B;  4U74 A;  2Q9Q C;  2UXD T;  5L3G B;  5HEJ A;  3U3I A;  3ZMS B;  2NW8 A;  2CHN A;  2NP9 A;  2Y56 A;  1EZ3 A;  2WBL A;  2YKS A;  1QUU A;  4DV1 T;  1XMO T;  4IE0 A;  4X20 E;  4GOU A;  3Q5D A;  1IBL T;  4ZS3 A;  5LMN T;  3P4P A;  2KT9 A;  1WFD A;  4UF0 A;  1E7P A;  4V1A v;  3SQ6 A;  4EAH A;  2VUR A;  3PUS A;  4BAY B;  3EHZ A;  1XMQ T;  4DR7 T;  4O2A E;  4HQP A;  2BS3 A;  3HKB E;  5FXX A;  2VB6 A;  3KDS E;  4JBW F;  3ZEF B;  2LM9 A;  2V7K A;  4UVB B;  2XQ3 A;  4HFI A;  5IWA T;  3TLW A;  2V5D A;  4IIJ E;  4P0A A;  4DID B;  4HWC A;  5KX5 E;  2E8I A;  5JDM A;  3AE8 A;  2UUC T;  3RKO A;  2LSI A;  5F8P A;  2V6X A;  3ZN1 B;  5ABE A;  2F4V T;  5LG4 A;  2XQY A;  3M65 A;  1FMW A;  4HFB A;  5LB7 B;  4EEB A;  2EHO C;  2L9Q A;  5FL0 A;  1U5P A;  1OED C;  2WQY A;  1Z0P A;  3L8R A;  1G8X A;  1XNR T;  4TZ4 C;  5BP0 A;  1T98 A;  4XAX B;  2Z6E A;  5H6R B;  5J1G A;  2E9X A;  4QHO A;  3UU6 A;  5HWX A;  3WTK A;  4QXB B;  3WTI A;  3PJA A;  1YQ3 A;  5AFH A;  1XDO A;  4TX5 A;  2VVS A;  2AE9 A;  2LSJ A;  5AQN B;  4FRR A;  5FXZ A;  4IHJ E;  5AFM B;  5LOV E;  3S4U A;  2X0H A;  3I0O A;  3O1I A;  3RYI E;  4KMC A;  4JEH B;  1ZEE A;  4TWF A;  3ONJ A;  1HF8 A;  3CQX C;  4QAA A;  3MXZ A;  3PUA A;  2XQ7 A;  3N9M A;  3KVA A;  5C8Y E;  1WYC A;  3KV4 A;  4YTM A;  3H3M A;  2JQK A;  4NPP A;  2ZJV A;  2KIN B;  3HA4 A;  3SFD A;  4FJO A;  3OTO T;  3Q5E A;  3EAB A;  3H3A A;  4GYS A;  4JV5 T;  5FY7 A;  3K1S A;  1MMG A;  1W0B A;  5AFJ A;  3ZT7 A;  1D0Z A;  2DCF A;  2WCA A;  3A7M A;  4PNI A;  1D1B A;  4QXH B;  3AE3 A;  3ZT5 A;  2JRK A;  2V7M A;  2YDQ A;  3TLS A;  3P8C D;  2QVA A;  2WMO A;  3ONL C;  4AKI A;  1ZV4 X;  2QA7 A;  3HKE E;  2WZI A;  4OYK A;  3GA8 A;  2XNT A;  3I1A A;  3CX7 B;  1SE7 A;  3AXJ B;  5TAO A;  4ZI7 E;  3AE4 A;  4CN6 A;  4KI0 F;  5CA1 E;  4LMK A;  4DBR A;  3ZSS A;  3N9P A;  2VKD A;  2XPK A;  4N78 D;  4E7S A;  5AQK B;  1HG2 A;  5C3J A;  2BVL A;  4ILU A;  3CQG B;  4H9P C;  4Z91 A;  5JDQ A;  1W0A A;  5EK2 A;  1FEW A;  4DV7 T;  4CI1 B;  2XYS A;  1XNQ T;  2XAS B;  4DUZ T;  5CFB A;  2CBJ A;  3SFE A;  3C79 A;  1D1C A;  1HR0 T;  1KNR A;  4IRE A;  2WDV A;  3CX8 B;  5AQH B;  5JDN A;  2G0U A;  3CML A;  2N2N A;  1IBM T;  3J9X 1;  3AE5 A;  2IUB A;  3AEF A;  5FXV A;  3LK2 B;  4CXX A;  3W15 B;  2CM0 A;  2YDS A;  4NUU A;  3LBX A;  5JTG A;  5EK3 A;  4C90 A;  1YD8 G;  4X1K E;  3C98 B;  2B1E A;  3AA1 B;  1HNW T;  5JME A;  1OED A;  3VKH A;  4CI2 B;  1MND A;  4CQI A;  1XDP A;  4AIS A;  1T7S A;  3QUJ A;  4U72 A;  4COF A;  5HXC A;  4UM3 P;  4ZI3 C;  3ZPO A;  4PJL A;  2BR7 A;  1LKX A;  4L5G A;  3VR8 A;  2MBG A;  4ADZ A;  2X9Y A;  3Q2M A;  4LF7 T;  1Y64 B;  3OPC A;  3PU3 A;  3SH1 A;  2NW9 A;  5BW2 A;  4DVD A;  1IAP A;  5HEU A;  4YJ2 E;  4P0B A;  1HCI A;  4ZEY A;  3NVO A;  2C5K T;  4A5X A;  5AQF B;  2IAK A;  3KV5 A;  2VL0 A;  2A3D A;  3L39 A;  4TWD A;  2W67 A;  3ZCJ A;  4ZJS A;  4IE4 A;  2Q9Q D;  5L3D B;  4AFG A;  3OKQ A;  2CWO A;  1KEY A;  3C4X A;  2LSY A;  2LM2 A;  4IE6 A;  4J2C A;  4O4I E;  5FY0 A;  2XYT A;  3AA6 B;  2XAQ B;  4P09 A;  2V6Y B;  4ZOL E;  5LYJ E;  3CPZ A;  3ZST A;  2WY2 A;  5JRE A;  1MIV A;  2NW7 A;  2FBW A;  3VRA A;  1N33 T;  4IDN A;  3EDU A;  3GUA A;  3B57 A;  3RYC E;  3N2K E;  3AVR A;  5L3E B;  2ZJU A;  1BR1 A;  4IE5 A;  3UU8 A;  3P4S A;  1W09 A;  4JLE A;  3BK9 A;  5LBQ B;  4JI0 T;  3ZLI A;  2Q9Q A;  1WYB A;  4PK5 A;  3P50 A;  2K9A A;  4DMW A;  5JVD E;  2N9D A;  1SHZ C;  3G06 A; 
#chains in the Genus database with same CATH homology
 3SIO A;  3SH1 A;  3JAD A;  3P4W A;  4QH1 A;  2XQ4 A;  2C9T A;  2BG9 E;  2WN9 A;  4HFE A;  3IGQ A;  4FRR A;  5AIN A;  5BW2 A;  5HEU A;  4Z90 A;  4BQT A;  3U8J A;  4Z91 A;  4ZK4 A;  5AFM B;  3EAM A;  2XQ9 A;  2BR8 A;  3SQ6 A;  2BG9 B;  1UX2 A;  2XYS A;  4UM3 A;  4AFH A;  2BYN A;  3U8K A;  5HCM A;  4QH5 A;  5CO5 A;  2YME A;  4PIR A;  5CFB A;  2WNJ A;  5HEG A;  3WTM A;  3U8L A;  2UZ6 A;  4IL4 A;  1OED E;  3EHZ A;  4IL9 A;  3EI0 A;  3C79 A;  2W8F A;  2BYR A;  2VL0 A;  5TVC A;  3UQ7 A;  2BYS A;  3TLU A;  4HQP A;  4QAC A;  5J5F A;  4TWD A;  3U8N A;  4TWF A;  5KZU A;  2XQ6 A;  2PGZ A;  4IRE A;  4QAA A;  4ZJS A;  4AFT A;  4ZZB A;  5HCJ A;  2Y54 A;  2XQ7 A;  4ALX A;  2YOE A;  3RIF A;  4XK9 A;  5LXB A;  2XQ3 A;  5J5I A;  4HFI A;  4B5D A;  3ZKR A;  3RQU A;  4ILA A;  4LML A;  3TLW A;  4F8H A;  2XQA A;  4BFQ A;  4HFC A;  2M6B A;  4NPP A;  5L4E A;  2ZJV A;  5AFK A;  2KSR A;  3RHW A;  4ZZC A;  4AFG A;  2YMD A;  3WTO A;  2W8G A;  3ZDG A;  2WNL A;  2M6I A;  1UW6 A;  2X00 A;  3PMZ A;  2XNV A;  2LM2 A;  5SYO A;  3RQW A;  2BYP A;  3JAF A;  3UU4 A;  4ZRU A;  3ZDH A;  4DBM A;  5AFN A;  3WTH A;  5AFL A;  3U8M A;  5IUX A;  2XYT A;  2BYQ A;  5BRX A;  4TWH A;  2Y58 A;  5AFJ A;  2YN6 A;  5AFM A;  3WTN A;  3LSV A;  4UM3 S;  4D01 A;  3TLT A;  4ILC A;  2BG9 A;  1UV6 A;  2WNC A;  2X00 D;  4XHE A;  4HFB A;  3UQ4 A;  5L47 A;  3WIP A;  2QC1 B;  4TNV A;  3SQ9 A;  3UU5 A;  4ZJT A;  1OED C;  2BG9 C;  3TLV A;  3UUB A;  3WTL A;  3C84 A;  4LMJ A;  2LKG A;  5JME A;  4UXU A;  4HFD A;  1OED A;  3UU3 A;  4A97 A;  5L4H A;  2XQ8 A;  3TLS A;  2PH9 A;  3GUA A;  3PEO A;  2XZ5 A;  4WV9 A;  2Y7Y A;  5BP0 A;  4QAB A;  5HEO A;  5HEJ A;  2XZ6 A;  4HFH A;  5FJV A;  4EZ1 A;  2LLY A;  4COF A;  2WZY A;  2XNT A;  3T4M A;  2BJ0 A;  4UM3 P;  5KE4 A;  2MAW A;  2XNU A;  5LG3 A;  2Y56 A;  2YKS A;  5J5G A;  2ZJU A;  3UU6 A;  5J0Z A;  3UU8 A;  2BR7 A;  3WTK A;  4A98 A;  4X5T A;  4ZK1 A;  3WTJ A;  4ILB A;  3WTI A;  5HEH A;  2LKH A;  3RIA A;  4ZR6 A;  4NZB A;  2XQ5 A;  3P50 A;  4TNW A;  5AFH A;  3RI5 A;  4QH4 A;  4LMK A;  2Y57 A;  4UM1 A;  1I9B A;  3JAE A;  4UY2 A;  1OED B;  5J5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...