4HFDA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to bromoform
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfdA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfdA01
5J0ZA 3ZKRA 2LLYA 3UQ4A 4LMKA 4ZRUA 2YMEA 4QH1A 4Z90A 2YN6A 5BP0A 5HCMA 4ZK4A 4ILBA 4LMLA 2BYSA 3SIOA 2ZJVA 2XQ7A 3SQ6A 3U8LA 2MAWA 5HEHA 5HEJA 2QC1B 2YMDA 4UM1A 2BG9E 3UU8A 5L47A 3WTIA 2BYQA 2LKHA 2Y56A 4NZBA 3C79A 4D01A 4X5TA 5AFHA 2UZ6A 1OEDA 4B5DA 2PGZA 2YKSA 5KZUA 2M6BA 4ZZCA 4QACA 4BFQA 4QH5A 5L4EA 2BYPA 3UU5A 4HFDA 2XQ6A 4FRRA 3UU6A 2XQ3A 1I9BA 2PH9A 3TLVA 3WTJA 3WIPA 4AFHA 3RI5A 4AFTA 2WN9A 4ZK1A 2W8GA 4ZJSA 4DBMA 4PIRA 3UU3A 2Y58A 2Y54A 3GUAA 4A98A 3LSVA 2XQ8A 5LG3A 1OEDB 2BG9A 3EHZA 2XQ5A 4F8HA 3WTHA 5HCJA 2YOEA 2BR8A 1UW6A 5AFMB 3EAMA 4HFHA 3RQUA 4ZR6A 2WZYA 2KSRA 5BRXA 4COFA 2WNLA 2XQAA 3ZDHA 4UM3A 4TNWA 2Y57A 3IGQA 2XZ5A 3UQ7A 3SQ9A 5AFLA 3TLTA 4NPPA 1OEDC 3UUBA 2M6IA 4HFIA 2BJ0A 2C9TA 2X00D 3U8JA 4QABA 4UM3S 5AFMA 5J5HA 3WTKA 4WV9A 3UU4A 2XQ9A 4QH4A 4BQTA 4ILCA 3EI0A 5J5GA 3TLSA 2BG9B 2XQ4A 2Y7YA 3T4MA 4Z91A 1UV6A 2XNTA 3U8NA 4ALXA 3C84A 4HFBA 5SYOA 3WTMA 5HEGA 5TVCA 5L4HA 2XYTA 5IUXA 5LXBA 4TWFA 4HFCA 4XK9A 4ILAA 4UY2A 2BG9C 5BW2A 3RQWA 4IREA 5JMEA 3JADA 5AFNA 4QAAA 4AFGA 3U8MA 3TLUA 5AFKA 2BR7A 5AFJA 5CO5A 2VL0A 3PEOA 5AINA 5J5FA 4HFEA 3JAFA 2XYSA 4TWHA 2W8FA 2BYNA 2XZ6A 5CFBA 4TNVA 3WTLA 4EZ1A 4IL4A 4ZZBA 5HEUA 4LMJA 4XHEA 3PMZA 4TWDA 5J5IA 3RHWA 3TLWA 3RIFA 2XNUA 3WTOA 3P4WA 3WTNA 4ZJTA 4HQPA 4IL9A 5KE4A 3P50A 3U8KA 3JAEA 4A97A 4UXUA 4UM3P 2XNVA 2BYRA 2WNCA 2ZJUA 5HEOA 3SH1A 2LKGA 1UX2A 1OEDE 2LM2A 2X00A 3RIAA 3ZDGA 2WNJA 5FJVA
chains in the Genus database with same CATH superfamily
4ZI3D 2C5IT 3SWHA 2PJQA 2V6XA 4OX9T 3C79A 4AKRB 1QLBA 5AQMB 1YKEB 1UURA 2ACZA 5ETWA 3N2KE 3WIPA 2LT3A 5L3FB 3RRCA 2ACXA 2LHRA 1OEDB 2CLYC 4F8HA 2I6HA 4IIJE 5AQSB 4HFHA 4COFA 3ZT5A 3ZDHA 4IE6A 3L39A 3PUSA 2Y7YA 4O2AE 4U7IA 2IMLA 3C84A 1W9RA 4PNIA 2K48A 4UF0A 4AQFA 2LRKA 4QAAA 1MIWA 2VWAA 4IHJE 2VL0A 2E9XB 3Q5DA 3P7IA 3FZHB 4TWHA 1YW0A 3FZLB 2DLRA 3N9LA 2LSIA 4UEMA 2YDSA 3Q5XA 1HX1B 3KV6A 5M4YA 3SOLA 3FZKB 2E8IA 3WTOA 5CGMA 5ADXL 5LGTB 1UGOA 4UV9B 3J7Yq 1HTJF 2V5DA 4KUMB 4OK0A 3SH1A 3AEEA 3AB3B 4AQFC 4DR2T 3AA6B 2EHOA 2X66A 3C4ZA 4ZRUA 3AEAA 4O4LE 2A9UA 3AA7B 4IE7A 2JQKA 3UFEA 3PUWF 3GN5B 3VHLA 2MTQA 5AQGB 3PURA 3OKQA 4I43B 5KMGP 4QACA 5JREA 5TAOA 5L4EA 3AEDA 3O1JA 2EHOC 4HTEA 3PUQA 2WN9A 2W8GA 2X0YA 3CKDA 2UUCT 2X9XA 2E9XD 1NENA 2G0UA 5FNVE 2ZLYA 1UW6A 4JI3T 2CWOA 5AFMB 4DV2T 1MMNA 2WNLA 2WMOA 2XQAA 2XM2A 4LF9T 3QK6A 3DP7A 3ZJ1A 5AFLA 4NPPA 3UUBA 2BJ0A 2PG8A 1W0AA 4QH4A 2BG9B 4AIUA 3BQIA 5IYZE 1R8IA 3PUXF 5TVCA 4LF4T 2VQFT 4EGWA 3ZC1A 3I9YA 3GWHA 4DVDA 1E1HB 5ABGA 4HWDA 3F2EA 4UVCB 1U4QA 3ZYKA 3TLWA 3WTNA 2XAGB 1WFDA 3KFWX 4IL9A 4YHJA 3U8KA 3AXJB 2SPCA 4X20E 3T8OA 4P09A 4TZ4C 3LFMA 2WM9A 3CQXC 2WU2A 4WBOA 4YT0A 2V6YA 4ILBA 3SQ6A 2XQ7A 3ZYLA 2QA7A 1X79A 3HR0A 4U33A 4CN6A 3NRXA 2FUPA 2XAHB 3P8CD 4TX5A 3UU5A 4HKAA 1HNXT 2IAKA 2YOEA 3FHNA 3E08A 4PK6A 4KI0F 3QNUA 3VR8A 2WZYA 5ABFB 5HXEA 3O1IA 3AVRA 4Z8XA 4ZEYA 3C98B 4U74A 2YU1A 3M65A 1XDOA 2XY8B 1UV6A 2YINA 4ALXA 4ZI2D 3KV4A 4ILAA 3OTOT 1MIYA 1WLXA 2IDOB 3A5XA 3CMLA 2RA1A 3ONJA 3ONXA 2JMKA 3ZCJA 1HG5A 2OA5A 3WTLA 1D0YA 3FXDB 3PUZF 4IE0A 3S4UA 2B1EA 3RIFA 4DNDA 1ZP0A 3IBPA 1QUUA 4O4HE 5LHHB 4JI5T 3N2GE 2X9HA 2L8KA 3OPCA 3ZSTA 4GKKT 2KLQA 5J0ZA 3AAIA 2D5UA 4ZK4A 4JI7T 4NXMT 4DUZT 4ERRA 1UX5A 2M67A 2LKHA 1HX8A 1W09A 4P1NA 3SFEA 5FY0A 5FL0A 1HS7A 2IUBA 5CB4E 2PH9A 2MOZA 3TLVA 1HR0T 4ZS2A 3AECA 4AFTA 4ZK1A 5BMVE 2D0UA 2I59A 2W2UA 5IWAT 2K3WA 2VVSA 1KK7A 5LMNT 5AQLB 5EK2A 2X9WA 5LG4A 1W0BA 1JNRA 3C50A 5J5HA 4ISSA 3WTKA 4DR6T 2BS4A 4MFRA 3V5UA 3FBLA 1IBMT 4H9PC 3T4MA 3N9OA 2XAFB 1D0XA 1G73A 3L8RA 5JMEA 1T8BA 3JC6C 3PE0A 3AE8A 5AFUL 5L3DB 2BVMA 3A7MA 5J1GA 2DNXA 2IC9A 3PMZA 3P4WA 5FMNA 1FIOA 1IBLT 4A97A 4H63H 4EV6A 2XNVA 3AEFA 3AE6A 3HKBE 4KX6A 3LK42 3RIAA 2NR4A 2WDVA 2V7JA 1I94T 3E22E 3B13A 4L0RA 2F4VT 4EOZB 2BYSA 2BZBA 4I50E 2PTFA 2WBLA 3N9QA 2QC1B 2YMDA 1Z0PA 3FZFB 5AFHA 2M6BA 3CVRA 5JDGA 2CEAA 4K0UA 4JI4T 5JDQA 3T1HT 5AQNB 4NUUA 5EZYE 1WCRA 3GUAA 4ZXLA 2MYSA 2Q9QB 1L0VA 4DMVA 5H6RB 5HCJA 3K3QC 2Y48B 5ABEA 3AAEB 3I0OA 4OYKA 2V5CA 3SQ9A 3LJCA 4DUYT 4AKIA 1LVFA 5AQFB 4EB6E 2KWHA 1S35A 2V7LA 1Y01A 4UF0B 2ODVA 2QRXA 3H37A 2CRBA 5FXXA 3FBZA 3SS1A 2NW7A 5F3JA 5JDMA 2KWIB 1LVKA 1WR6A 2AXDS 2XNUA 4ZJTA 3P50A 2DCFA 1M62A 2YU2A 5BR8T 3ZC0A 4ZI7E 2WS3A 5C2TA 2LM2A 2VKDA 2Q9QD 5DQWA 2X51A 4EXTA 4I55E 2CXDA 2OV9A 5FVLA 4LFAT 2HH7A 3A8YC 4ZS3A 2WAUA 3RRWA 5L47A 4CN4A 2KZ7B 3RYIE 5CA0E 4DR5T 2FJAA 4FRRA 5H6QB 4YSYA 1D1BA 3PUAA 1V9DA 3AEBA 4B3TT 1XWMA 1N32T 5LXTE 4QXBB 2P9BA 3CX8B 4TNWA 2DHRA 3U8JA 2M6IA 4UM3S 5FY7A 5LOVE 5AQHB 3LBXB 5L3CB 4M1PA 1XMQT 2XNTA 3ZMUB 3GMIA 4BJNA 2W63A 5LA6E 3FZMB 4XK9A 2JPFA 2XZEA 3ZJ2A 1WR0A 3VRBA 2LOPA 4YLHA 3PEOA 1OXZA 2A2FX 2XZ6A 4ZZBA 4HQPA 3QC9A 2YEVC 5DJQC 5LB7B 3NZPA 4DV4T 4DV0T 3ZLIA 2W61A 4IDZA 3ZYMA 2XJ7A 3UULA 4LF8T 2WDQA 2L3LA 4PW8A 2D9DA 3SIOA 1EZ3A 3WTIA 2CHOA 2CBJA 1T7SA 5JRCA 4QH5A 4X1KE 2LM9A 2BS2A 3PUGA 3Q2MA 3BQLA 4IDPA 3WI3A 3IF8B 2XHEB 2BKOA 2UU9T 2XQ8A 4ZHQE 5FKYA 3B57A 3VKGA 1N34T 2J47A 4ZI3C 3PDYA 4QABA 2XTLA 1ZV4X 4BAYB 4CI3B 3CIRA 4UR9A 2X67A 4V1Av 5KDMC 2J1DG 2Y6XA 4HFBA 1HFAA 3ZMVB 4PK4A 3RYCE 2LE8A 4AFGA 2WWVA 2QVAA 1KEYA 5J5FA 5LHGB 3JAFA 4PJMA 1S94A 3O1HA 3MA9A 5J5IA 2WQYA 3F57A 1D1AA 4UVAB 2GK9A 4UM3P 5LNKA 4A5XA 2BYRA 1T98A 2LRLA 5LMUT 2BVLA 2LLYA 4H9RC 2AE9A 2YMEA 4Z90A 2VKOA 3AE9A 1NEKA 2W66A 3BK9A 4E7ZA 2W62A 5JH7E 2BYQA 2J62A 2Y56A 4D01A 4X5TA 1OEDA 3AE3A 3ANWB 4PFPA 4ZZCA 3K8PC 2ODUA 3UT5E 2BBJA 2HN2A 4DR7T 4U7YA 3PTRB 4JV5T 5HXRA 5LP6E 5JQGE 2MPKA 3QUJA 3ESLA 4DV6T 2VVNA 5DQVA 5LGNB 3VU7H 4UM3A 5BW2A 3TLTA 4U2YA 1OEDC 5J2TE 4HWFA 4JEHB 5AQVB 2VURA 2XQ9A 1WYCA 3DTOA 5J5GA 1N36T 3BQKA 4IDNA 3RF1A 3RKGA 1E2AA 2J4GA 3K3NA 2VL8A 4J2CA 3RX6A 1J1JA 5AINA 4TV9E 5LBQB 4LMJA 4EYUA 3RGLA 3RHWA 5AQJB 2W00A 2V8SV 2C5KT 2E9XC 4YHHT 1J5ET 2WZIA 2IW5B 4OYJA 2NTYA 2ZJUA 3Q5EA 2X0LB 3GN5A 4DR1T 4OFZA 3ZKRA 5AQOB 2XQYA 4GKJT 2NW8A 3F31A 5LCYA 4LMLA 4IGUA 2NP9A 2IHR1 3WAKA 4YY3T 4YSXA 4UV8B 4TN7B 2W0GA 5JR9B 1HNZT 3RI5A 4ZJSA 3G06A 3PUVF 2LHNA 2CXLA 4F6RC 2BG9A 2DI4A 2XQ5A 3WTHA 1O3XA 3ZN1B 5C3JA 1BR2A 3N9PA 3EAMA 4N78D 1SHZC 2V1DB 2IC6A 2ES0A 3OVUA 2NOXA 2N2NA 1OWAA 1IAPA 4B3MT 4JBWF 3MZKB 3HL6A 5F5WA 5LXBA 3FB2A 2XM1A 2BG9C 5AQIB 1Y64B 3JCFA 3U8MA 4QWNB 3TLUA 2VQET 1KNPA 5AFKA 3AA0B 3IHRA 4LF6T 2ZM6T 3AE4A 1UX4A 4XHEA 2UUAT 3P4PA 4L5GA 3JAEA 2VKJA 1FMVA 2WNCA 5ABHA 3R6NA 4AISA 1KFYA 4CXXA 5HXSA 4IE5A 5FXWA 4FI5A 4NIQA 1YD8G 3U8LA 3ZMSB 2CE7A 4QX7B 3UU8A 4ZI2C 4NUVA 4WZXA 5JDFA 4LFBT 2CCQA 2XQ6A 2CLYB 4WNKA 3OYZA 5ABFA 2H3RA 2V7KA 2VB6A 2Y58A 4YFSA 4B3ST 2I0MA 4A98A 2XAQB 5LG3A 2ZM0A 3O9XA 2NTXA 2K5BB 3RQUA 2NW9A 4CQIA 4X1YE 3T1YT 2Y57A 4HN9A 3CK6A 1HCIA 4WV9A 1XMOT 2WZHA 4BQTA 3TLSA 3GA8A 3NVOA 3RYHE 5HYAA 1MNDA 3QB5K 1CUNA 1BR1A 4H9NC 3EDVA 4TWFA 4G63A 4CI2B 5FY1A 4DIDB 1HNWT 1J5WA 3UUMA 3L3PA 1ZOYA 4IDOA 5AFJA 2N1GA 5CO5A 4QXHB 4HFEA 3Q9DA 2BYNA 2YDQA 4O4JE 5CJ5A 4ANJA 3UTKA 5F8PA 1UCUA 2X9YA 4JEUB 4U3CA 2Z6EA 4YJ2E 3QOFA 2LSYA 3KV9A 3OBVE 1FJGT 4EEDA 2BDEA 2DL1A 4FJOA 2LKGA 2FJEA 4GK0E 3N9NA 2X00A 1N33T 2WNJA 5JDNA 4C91A 4X66T 3KVBA 2CPTA 3CWZB 2UXDT 1SE7A 3RKOA 2E5LT 3KBTA 3KBUA 2A72A 2EHOB 3ZPOA 4HE8A 2KXPB 1H7CA 1XZYA 4PFOA 3UU6A 1BR4A 3ZSSA 4IDQA 1CHUA 3AE2A 3ETUA 4LFCT 5HAXA 3V5SA 4GIWA 1YKHB 5EK4A 2K24A 4CXYA 3C51A 3C64A 2ZMAA 3KINB 2WU5A 4ILCA 4DBQA 3E0ZA 2LJLA 3ABVA 5JDHA 4HFCA 2VKHA 2NWBA 4AXPA 3C4XA 1LKXA 4IREA 2VASA 5FYMA 5E0OA 2D2SA 5LJMA 1VCTA 1WYBA 2EHOD 5L3GB 4TNVA 4MBQA 2XUEA 2L9QA 2QYWA 4ASKA 1M7KA 3B5MA 2N9DA 1X9BA 5FL1A 1U5PA 3LDQB 2UUBT 2PFVA 4QXCB 5FVKA 4ISTA 3Q5WA 1VOMA 4DV7T 4KBMB 3J9X1 5FJVA 2PBIA 3C4WA 2W67A 4LMKA 5BP0A 1BR0A 5JTGA 4O2BE 2CMRA 3CQGB 2LSGA 4U2ZA 4X62T 3FXEB 1NAFA 2UXNB 3CPZA 2Q9QA 4B5DA 3N5LA 3RH3A 5JDLA 3OYXA 2V6YB 3ZCIA 4WBNE 3MK7C 4AFHA 2UXCT 4HGAA 4U72A 3ZN0B 2JQ9A 2Y54A 5AQKB 3AE5A 4H9QC 2BKPA 4ZR6A 3P4QA 2DWKA 3SFDA 2WMNA 2Q9QC 4HFIA 4HEAA 1IZNB 2B76A 5FP3A 1UK5A 2XQ4A 4DV1T 4BJMA 3DJBA 1FEWA 1YXRA 3NBXX 4C90A 4YJ3E 3SRZA 4WW0A 4MHCA 2LSKA 1KNZA 2C0SA 2BR7A 2H89A 2WWUA 4EZ1A 3X1DA 4IL4A 1IBKT 4ZOLE 4JI0T 3MJXA 3KVAA 4JI8T 3AA1B 3AVSA 2FJDA 4E7SA 3LK3B 3MKDA 4HFVA 1OEDE 3PU3A 3D0TA 2H7OA 2C5JA 3OJAA 4CN1A 3PUYF 5HCMA 1D0ZA 2RP4A 2JIWA 2CA5A 1ZEEA 2BBHA 5KZUA 1SUMB 3ZT6A 2VK9A 3P4SA 5EK3A 4HWIB 4XZCA 3PJAA 5C8YE 3UU3A 4K0KT 3EVYA 3LSVA 2BR8A 3LBXA 4YTPA 4I4TE 2E5VA 4NXNT 4P0AA 2KSRA 5BRXA 3AE7A 5DABA 4IT4A 2X68A 3VR9A 3IGQA 5L3EB 2JMHA 5KX5E 1MMDA 4WYVA 2H7VC 3UU4A 4I0UA 1I6ZA 3CX7B 4EZ4A 4Z91A 1IJ5A 5SYOA 4MLKA 1LRZA 1US7B 4GYSA 3IA3A 2CM0A 3JADA 5AFNA 1QSDA 2K9AA 4X65T 5AQRB 5FXVA 3CX6B 2E9XA 1UUSA 1KF6A 3HA4A 3HKCE 3N2OA 2V7IA 3PV0F 3UUNA 1VRBA 5GONE 5AQTB 5L2LA 3RIUA 3ZDGA 4U31A 3UQ4A 4QH1A 2LEHA 2E2AA 4EYYR 4DV3T 4DV5T 2ZJVA 2MAWA 1MMGA 5HEJA 3NKZA 2WY2A 5HXCA 2BG9E 2DWGA 2ZM2A 3JC6D 4BFQA 2XSAA 3RIUC 1HF8A 2XSBA 3IEEA 4Q25A 1I9BA 3WTJA 4PJNA 4H9SE 3HKDE 4QKNA 4CZZB 1MMAA 4MALA 2FJBA 3EHZA 4CXWA 4YTNA 5IHYA 4EIWA 2HN1A 2ZM8A 4XBFB 3RC3A 3H3AA 2H88A 3UQ7A 4JUYA 5AFMA 5AQPB 3WAJA 3RYFE 1XDPA 2JJ9A 3U8NA 3VRAA 3QB5A 4UELA 2XYTA 3ZT7A 3RQWA 2V26A 3VKHA 3EUHA 3I9WA 4GYRA 1KNRA 1YQ4A 4G2AA 4H9OC 4GOUA 4L9IA 2W4XA 2W8FA 5CFBA 4YTMA 2Y8DA 3AAAB 1E7PA 4AQGA 3HKEE 5LHIB 5JVDE 2OLTA 4EAHA 4TWDA 2CBIA 2MBGA 4EEBA 3ZMTB 2WDRA 3ZMZB 4UXUA 5HWXA 4JLEA 1Z8UA 5AQQB 4TV8E 4ILUA 3EDUA 3U3IA 5AQUB 3K3OA 3AXJA 2FBWA 3AEGA 4B3RT 4LF5T 3M3ZB 3ANWA 3NZQA 2YN6A 1D1CA 2WP9A 2X0HA 4JI6T 5HEHA 4JI2T 4HWHA 4X1IE 5HXHA 5LGUB 2R6GF 4OHFA 4KHZF 2A3DA 3N9MA 4DMWA 4LF7T 2XASB 1MNEA 2XPKA 2YKSA 3L09A 2BYPA 1XNQT 4HFDA 2KNDA 2XQ3A 3PU8A 3NRYA 3O4XE 4DBMA 2BKNA 2LOSA 3NWIA 3W15B 4AI6A 2JQHA 1AJ3A 1T72A 4XAXB 3RLFF 2WSSV 3ONLC 2LSJA 2X00D 5HWYA 1ZHCA 4CI1B 3H3MA 4PAGA 2HPJA 2UXXB 3PJAJ 1SA0E 1HG2A 4ADZA 4UXNB 3WTMA 3AE1A 5L4HA 4QHOA 5J2UE 4GK5E 4UY2A 4AKGA 2IIUA 2JQQA 3TKLB 3UUXB 5LJNA 4JYAT 2XYSA 3I0QA 4DR4T 4AQYT 2UXBT 5HEUA 4O8SA 3K1SA 4DR3T 3EABA 4A56A 3RPUA 5A1LA 3MXZA 3U78A 3UFGA 1JNZA 1GQEA 2HPLA 4O4IE 3MACA 5HEOA 1UX2A 3R84B 4AKLA 5CA1E 4BA9A 2QGSA 3KV5A 2KMFA 1YQ3A 4IE4A 5LYJE 3LG7A 5JR9A 3ETVA 4UVBB 4B6XA 2RPAA 4UM1A 2KT9A 4KHPT 4NZBA 2UZ6A 2PGZA 1VCSA 4YSZA 4EZHA 1XNRT 1ZKEA 4TUYE 4YXDA 2V7MA 4PIRA 2D0TA 2JRKA 4AKHA 4QX8B 5JR9C 5JRCB 1MIVA 3KDSE 4JI1T 3RC8A 4HWCA 2XZ5A 2C9TA 1IJ6A 4DO0A 1WRDA 2BS3A 1G8XA 2CWYA 4H63V 1B7TA 3CQCB 3EI0A 3P4RA 5L3BB 1FMWA 2WCAA 3ZEFB 1NWMX 4KP3C 5HEGA 5KXJA 5IUXA 4PK5A 4P0BA 4UIGA 3I1AA 4KMCA 2KINB 2WB5A 2CXFA 4X64T 2XAJB 4PJLA 1DU2A 5KE4A 5LBMA 4PJJA 2YK0A 3LK2B 2YDRA 2CHNA 4DBRA 2HHHT 3HI2A 5FXZA
chains in the Genus database with same CATH topology
5J0ZA 3ZKRA 2LLYA 3UQ4A 4LMKA 4ZRUA 2YMEA 4QH1A 4Z90A 2YN6A 5BP0A 5HCMA 4ZK4A 4ILBA 4LMLA 2BYSA 3SIOA 2ZJVA 2XQ7A 3SQ6A 3U8LA 2MAWA 5HEHA 5HEJA 2QC1B 2YMDA 4UM1A 2BG9E 3UU8A 5L47A 3WTIA 2BYQA 2LKHA 2Y56A 4NZBA 3C79A 4D01A 4X5TA 5AFHA 2UZ6A 1OEDA 4B5DA 2PGZA 2YKSA 5KZUA 2M6BA 4ZZCA 4QACA 4BFQA 4QH5A 5L4EA 2BYPA 3UU5A 4HFDA 2XQ6A 4FRRA 3UU6A 2XQ3A 1I9BA 2PH9A 3TLVA 3WTJA 3WIPA 4AFHA 3RI5A 4AFTA 2WN9A 4ZK1A 2W8GA 4ZJSA 4DBMA 4PIRA 3UU3A 2Y58A 2Y54A 3GUAA 4A98A 3LSVA 2XQ8A 5LG3A 1OEDB 2BG9A 3EHZA 2XQ5A 4F8HA 3WTHA 5HCJA 2YOEA 2BR8A 1UW6A 5AFMB 3EAMA 4HFHA 3RQUA 4ZR6A 2WZYA 2KSRA 5BRXA 4COFA 2WNLA 2XQAA 3ZDHA 4UM3A 4TNWA 2Y57A 3IGQA 2XZ5A 3UQ7A 3SQ9A 5AFLA 3TLTA 4NPPA 1OEDC 3UUBA 2M6IA 4HFIA 2BJ0A 2C9TA 2X00D 3U8JA 4QABA 4UM3S 5AFMA 5J5HA 3WTKA 4WV9A 3UU4A 2XQ9A 4QH4A 4BQTA 4ILCA 3EI0A 5J5GA 3TLSA 2BG9B 2XQ4A 2Y7YA 3T4MA 4Z91A 1UV6A 2XNTA 3U8NA 4ALXA 3C84A 4HFBA 5SYOA 3WTMA 5HEGA 5TVCA 5L4HA 2XYTA 5IUXA 5LXBA 4TWFA 4HFCA 4XK9A 4ILAA 4UY2A 2BG9C 5BW2A 3RQWA 4IREA 5JMEA 3JADA 5AFNA 4QAAA 4AFGA 3U8MA 3TLUA 5AFKA 2BR7A 5AFJA 5CO5A 2VL0A 3PEOA 5AINA 5J5FA 4HFEA 3JAFA 2XYSA 4TWHA 2W8FA 2BYNA 2XZ6A 5CFBA 4TNVA 3WTLA 4EZ1A 4IL4A 4ZZBA 5HEUA 4LMJA 4XHEA 3PMZA 4TWDA 5J5IA 3RHWA 3TLWA 3RIFA 2XNUA 3WTOA 3P4WA 3WTNA 4ZJTA 4HQPA 4IL9A 5KE4A 3P50A 3U8KA 3JAEA 4A97A 4UXUA 4UM3P 2XNVA 2BYRA 2WNCA 2ZJUA 5HEOA 3SH1A 2LKGA 1UX2A 1OEDE 2LM2A 2X00A 3RIAA 3ZDGA 2WNJA 5FJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J0Z A;  3ZKR A;  2LLY A;  3UQ4 A;  4LMK A;  4ZRU A;  2YME A;  4QH1 A;  4Z90 A;  2YN6 A;  5BP0 A;  5HCM A;  4ZK4 A;  4ILB A;  4LML A;  2BYS A;  3SIO A;  2ZJV A;  2XQ7 A;  3SQ6 A;  3U8L A;  2MAW A;  5HEH A;  5HEJ A;  2QC1 B;  2YMD A;  4UM1 A;  2BG9 E;  3UU8 A;  5L47 A;  3WTI A;  2BYQ A;  2LKH A;  2Y56 A;  4NZB A;  3C79 A;  4D01 A;  4X5T A;  5AFH A;  2UZ6 A;  1OED A;  4B5D A;  2PGZ A;  2YKS A;  5KZU A;  2M6B A;  4ZZC A;  4QAC A;  4BFQ A;  4QH5 A;  5L4E A;  2BYP A;  3UU5 A;  4HFD A;  2XQ6 A;  4FRR A;  3UU6 A;  2XQ3 A;  1I9B A;  2PH9 A;  3TLV A;  3WTJ A;  3WIP A;  4AFH A;  3RI5 A;  4AFT A;  2WN9 A;  4ZK1 A;  2W8G A;  4ZJS A;  4DBM A;  4PIR A;  3UU3 A;  2Y58 A;  2Y54 A;  3GUA A;  4A98 A;  3LSV A;  2XQ8 A;  5LG3 A;  1OED B;  2BG9 A;  3EHZ A;  2XQ5 A;  4F8H A;  3WTH A;  5HCJ A;  2YOE A;  2BR8 A;  1UW6 A;  5AFM B;  3EAM A;  4HFH A;  3RQU A;  4ZR6 A;  2WZY A;  2KSR A;  5BRX A;  4COF A;  2WNL A;  2XQA A;  3ZDH A;  4UM3 A;  4TNW A;  2Y57 A;  3IGQ A;  2XZ5 A;  3UQ7 A;  3SQ9 A;  5AFL A;  3TLT A;  4NPP A;  1OED C;  3UUB A;  2M6I A;  4HFI A;  2BJ0 A;  2C9T A;  2X00 D;  3U8J A;  4QAB A;  4UM3 S;  5AFM A;  5J5H A;  3WTK A;  4WV9 A;  3UU4 A;  2XQ9 A;  4QH4 A;  4BQT A;  4ILC A;  3EI0 A;  5J5G A;  3TLS A;  2BG9 B;  2XQ4 A;  2Y7Y A;  3T4M A;  4Z91 A;  1UV6 A;  2XNT A;  3U8N A;  4ALX A;  3C84 A;  4HFB A;  5SYO A;  3WTM A;  5HEG A;  5TVC A;  5L4H A;  2XYT A;  5IUX A;  5LXB A;  4TWF A;  4HFC A;  4XK9 A;  4ILA A;  4UY2 A;  2BG9 C;  5BW2 A;  3RQW A;  4IRE A;  5JME A;  3JAD A;  5AFN A;  4QAA A;  4AFG A;  3U8M A;  3TLU A;  5AFK A;  2BR7 A;  5AFJ A;  5CO5 A;  2VL0 A;  3PEO A;  5AIN A;  5J5F A;  4HFE A;  3JAF A;  2XYS A;  4TWH A;  2W8F A;  2BYN A;  2XZ6 A;  5CFB A;  4TNV A;  3WTL A;  4EZ1 A;  4IL4 A;  4ZZB A;  5HEU A;  4LMJ A;  4XHE A;  3PMZ A;  4TWD A;  5J5I A;  3RHW A;  3TLW A;  3RIF A;  2XNU A;  3WTO A;  3P4W A;  3WTN A;  4ZJT A;  4HQP A;  4IL9 A;  5KE4 A;  3P50 A;  3U8K A;  3JAE A;  4A97 A;  4UXU A;  4UM3 P;  2XNV A;  2BYR A;  2WNC A;  2ZJU A;  5HEO A;  3SH1 A;  2LKG A;  1UX2 A;  1OED E;  2LM2 A;  2X00 A;  3RIA A;  3ZDG A;  2WNJ A;  5FJV A; 
#chains in the Genus database with same CATH topology
 4ZI3 D;  2C5I T;  3SWH A;  2PJQ A;  2V6X A;  4OX9 T;  3C79 A;  4AKR B;  1QLB A;  5AQM B;  1YKE B;  1UUR A;  2ACZ A;  5ETW A;  3N2K E;  3WIP A;  2LT3 A;  5L3F B;  3RRC A;  2ACX A;  2LHR A;  1OED B;  2CLY C;  4F8H A;  2I6H A;  4IIJ E;  5AQS B;  4HFH A;  4COF A;  3ZT5 A;  3ZDH A;  4IE6 A;  3L39 A;  3PUS A;  2Y7Y A;  4O2A E;  4U7I A;  2IML A;  3C84 A;  1W9R A;  4PNI A;  2K48 A;  4UF0 A;  4AQF A;  2LRK A;  4QAA A;  1MIW A;  2VWA A;  4IHJ E;  2VL0 A;  2E9X B;  3Q5D A;  3P7I A;  3FZH B;  4TWH A;  1YW0 A;  3FZL B;  2DLR A;  3N9L A;  2LSI A;  4UEM A;  2YDS A;  3Q5X A;  1HX1 B;  3KV6 A;  5M4Y A;  3SOL A;  3FZK B;  2E8I A;  3WTO A;  5CGM A;  5ADX L;  5LGT B;  1UGO A;  4UV9 B;  3J7Y q;  1HTJ F;  2V5D A;  4KUM B;  4OK0 A;  3SH1 A;  3AEE A;  3AB3 B;  4AQF C;  4DR2 T;  3AA6 B;  2EHO A;  2X66 A;  3C4Z A;  4ZRU A;  3AEA A;  4O4L E;  2A9U A;  3AA7 B;  4IE7 A;  2JQK A;  3UFE A;  3PUW F;  3GN5 B;  3VHL A;  2MTQ A;  5AQG B;  3PUR A;  3OKQ A;  4I43 B;  5KMG P;  4QAC A;  5JRE A;  5TAO A;  5L4E A;  3AED A;  3O1J A;  2EHO C;  4HTE A;  3PUQ A;  2WN9 A;  2W8G A;  2X0Y A;  3CKD A;  2UUC T;  2X9X A;  2E9X D;  1NEN A;  2G0U A;  5FNV E;  2ZLY A;  1UW6 A;  4JI3 T;  2CWO A;  5AFM B;  4DV2 T;  1MMN A;  2WNL A;  2WMO A;  2XQA A;  2XM2 A;  4LF9 T;  3QK6 A;  3DP7 A;  3ZJ1 A;  5AFL A;  4NPP A;  3UUB A;  2BJ0 A;  2PG8 A;  1W0A A;  4QH4 A;  2BG9 B;  4AIU A;  3BQI A;  5IYZ E;  1R8I A;  3PUX F;  5TVC A;  4LF4 T;  2VQF T;  4EGW A;  3ZC1 A;  3I9Y A;  3GWH A;  4DVD A;  1E1H B;  5ABG A;  4HWD A;  3F2E A;  4UVC B;  1U4Q A;  3ZYK A;  3TLW A;  3WTN A;  2XAG B;  1WFD A;  3KFW X;  4IL9 A;  4YHJ A;  3U8K A;  3AXJ B;  2SPC A;  4X20 E;  3T8O A;  4P09 A;  4TZ4 C;  3LFM A;  2WM9 A;  3CQX C;  2WU2 A;  4WBO A;  4YT0 A;  2V6Y A;  4ILB A;  3SQ6 A;  2XQ7 A;  3ZYL A;  2QA7 A;  1X79 A;  3HR0 A;  4U33 A;  4CN6 A;  3NRX A;  2FUP A;  2XAH B;  3P8C D;  4TX5 A;  3UU5 A;  4HKA A;  1HNX T;  2IAK A;  2YOE A;  3FHN A;  3E08 A;  4PK6 A;  4KI0 F;  3QNU A;  3VR8 A;  2WZY A;  5ABF B;  5HXE A;  3O1I A;  3AVR A;  4Z8X A;  4ZEY A;  3C98 B;  4U74 A;  2YU1 A;  3M65 A;  1XDO A;  2XY8 B;  1UV6 A;  2YIN A;  4ALX A;  4ZI2 D;  3KV4 A;  4ILA A;  3OTO T;  1MIY A;  1WLX A;  2IDO B;  3A5X A;  3CML A;  2RA1 A;  3ONJ A;  3ONX A;  2JMK A;  3ZCJ A;  1HG5 A;  2OA5 A;  3WTL A;  1D0Y A;  3FXD B;  3PUZ F;  4IE0 A;  3S4U A;  2B1E A;  3RIF A;  4DND A;  1ZP0 A;  3IBP A;  1QUU A;  4O4H E;  5LHH B;  4JI5 T;  3N2G E;  2X9H A;  2L8K A;  3OPC A;  3ZST A;  4GKK T;  2KLQ A;  5J0Z A;  3AAI A;  2D5U A;  4ZK4 A;  4JI7 T;  4NXM T;  4DUZ T;  4ERR A;  1UX5 A;  2M67 A;  2LKH A;  1HX8 A;  1W09 A;  4P1N A;  3SFE A;  5FY0 A;  5FL0 A;  1HS7 A;  2IUB A;  5CB4 E;  2PH9 A;  2MOZ A;  3TLV A;  1HR0 T;  4ZS2 A;  3AEC A;  4AFT A;  4ZK1 A;  5BMV E;  2D0U A;  2I59 A;  2W2U A;  5IWA T;  2K3W A;  2VVS A;  1KK7 A;  5LMN T;  5AQL B;  5EK2 A;  2X9W A;  5LG4 A;  1W0B A;  1JNR A;  3C50 A;  5J5H A;  4ISS A;  3WTK A;  4DR6 T;  2BS4 A;  4MFR A;  3V5U A;  3FBL A;  1IBM T;  4H9P C;  3T4M A;  3N9O A;  2XAF B;  1D0X A;  1G73 A;  3L8R A;  5JME A;  1T8B A;  3JC6 C;  3PE0 A;  3AE8 A;  5AFU L;  5L3D B;  2BVM A;  3A7M A;  5J1G A;  2DNX A;  2IC9 A;  3PMZ A;  3P4W A;  5FMN A;  1FIO A;  1IBL T;  4A97 A;  4H63 H;  4EV6 A;  2XNV A;  3AEF A;  3AE6 A;  3HKB E;  4KX6 A;  3LK4 2;  3RIA A;  2NR4 A;  2WDV A;  2V7J A;  1I94 T;  3E22 E;  3B13 A;  4L0R A;  2F4V T;  4EOZ B;  2BYS A;  2BZB A;  4I50 E;  2PTF A;  2WBL A;  3N9Q A;  2QC1 B;  2YMD A;  1Z0P A;  3FZF B;  5AFH A;  2M6B A;  3CVR A;  5JDG A;  2CEA A;  4K0U A;  4JI4 T;  5JDQ A;  3T1H T;  5AQN B;  4NUU A;  5EZY E;  1WCR A;  3GUA A;  4ZXL A;  2MYS A;  2Q9Q B;  1L0V A;  4DMV A;  5H6R B;  5HCJ A;  3K3Q C;  2Y48 B;  5ABE A;  3AAE B;  3I0O A;  4OYK A;  2V5C A;  3SQ9 A;  3LJC A;  4DUY T;  4AKI A;  1LVF A;  5AQF B;  4EB6 E;  2KWH A;  1S35 A;  2V7L A;  1Y01 A;  4UF0 B;  2ODV A;  2QRX A;  3H37 A;  2CRB A;  5FXX A;  3FBZ A;  3SS1 A;  2NW7 A;  5F3J A;  5JDM A;  2KWI B;  1LVK A;  1WR6 A;  2AXD S;  2XNU A;  4ZJT A;  3P50 A;  2DCF A;  1M62 A;  2YU2 A;  5BR8 T;  3ZC0 A;  4ZI7 E;  2WS3 A;  5C2T A;  2LM2 A;  2VKD A;  2Q9Q D;  5DQW A;  2X51 A;  4EXT A;  4I55 E;  2CXD A;  2OV9 A;  5FVL A;  4LFA T;  2HH7 A;  3A8Y C;  4ZS3 A;  2WAU A;  3RRW A;  5L47 A;  4CN4 A;  2KZ7 B;  3RYI E;  5CA0 E;  4DR5 T;  2FJA A;  4FRR A;  5H6Q B;  4YSY A;  1D1B A;  3PUA A;  1V9D A;  3AEB A;  4B3T T;  1XWM A;  1N32 T;  5LXT E;  4QXB B;  2P9B A;  3CX8 B;  4TNW A;  2DHR A;  3U8J A;  2M6I A;  4UM3 S;  5FY7 A;  5LOV E;  5AQH B;  3LBX B;  5L3C B;  4M1P A;  1XMQ T;  2XNT A;  3ZMU B;  3GMI A;  4BJN A;  2W63 A;  5LA6 E;  3FZM B;  4XK9 A;  2JPF A;  2XZE A;  3ZJ2 A;  1WR0 A;  3VRB A;  2LOP A;  4YLH A;  3PEO A;  1OXZ A;  2A2F X;  2XZ6 A;  4ZZB A;  4HQP A;  3QC9 A;  2YEV C;  5DJQ C;  5LB7 B;  3NZP A;  4DV4 T;  4DV0 T;  3ZLI A;  2W61 A;  4IDZ A;  3ZYM A;  2XJ7 A;  3UUL A;  4LF8 T;  2WDQ A;  2L3L A;  4PW8 A;  2D9D A;  3SIO A;  1EZ3 A;  3WTI A;  2CHO A;  2CBJ A;  1T7S A;  5JRC A;  4QH5 A;  4X1K E;  2LM9 A;  2BS2 A;  3PUG A;  3Q2M A;  3BQL A;  4IDP A;  3WI3 A;  3IF8 B;  2XHE B;  2BKO A;  2UU9 T;  2XQ8 A;  4ZHQ E;  5FKY A;  3B57 A;  3VKG A;  1N34 T;  2J47 A;  4ZI3 C;  3PDY A;  4QAB A;  2XTL A;  1ZV4 X;  4BAY B;  4CI3 B;  3CIR A;  4UR9 A;  2X67 A;  4V1A v;  5KDM C;  2J1D G;  2Y6X A;  4HFB A;  1HFA A;  3ZMV B;  4PK4 A;  3RYC E;  2LE8 A;  4AFG A;  2WWV A;  2QVA A;  1KEY A;  5J5F A;  5LHG B;  3JAF A;  4PJM A;  1S94 A;  3O1H A;  3MA9 A;  5J5I A;  2WQY A;  3F57 A;  1D1A A;  4UVA B;  2GK9 A;  4UM3 P;  5LNK A;  4A5X A;  2BYR A;  1T98 A;  2LRL A;  5LMU T;  2BVL A;  2LLY A;  4H9R C;  2AE9 A;  2YME A;  4Z90 A;  2VKO A;  3AE9 A;  1NEK A;  2W66 A;  3BK9 A;  4E7Z A;  2W62 A;  5JH7 E;  2BYQ A;  2J62 A;  2Y56 A;  4D01 A;  4X5T A;  1OED A;  3AE3 A;  3ANW B;  4PFP A;  4ZZC A;  3K8P C;  2ODU A;  3UT5 E;  2BBJ A;  2HN2 A;  4DR7 T;  4U7Y A;  3PTR B;  4JV5 T;  5HXR A;  5LP6 E;  5JQG E;  2MPK A;  3QUJ A;  3ESL A;  4DV6 T;  2VVN A;  5DQV A;  5LGN B;  3VU7 H;  4UM3 A;  5BW2 A;  3TLT A;  4U2Y A;  1OED C;  5J2T E;  4HWF A;  4JEH B;  5AQV B;  2VUR A;  2XQ9 A;  1WYC A;  3DTO A;  5J5G A;  1N36 T;  3BQK A;  4IDN A;  3RF1 A;  3RKG A;  1E2A A;  2J4G A;  3K3N A;  2VL8 A;  4J2C A;  3RX6 A;  1J1J A;  5AIN A;  4TV9 E;  5LBQ B;  4LMJ A;  4EYU A;  3RGL A;  3RHW A;  5AQJ B;  2W00 A;  2V8S V;  2C5K T;  2E9X C;  4YHH T;  1J5E T;  2WZI A;  2IW5 B;  4OYJ A;  2NTY A;  2ZJU A;  3Q5E A;  2X0L B;  3GN5 A;  4DR1 T;  4OFZ A;  3ZKR A;  5AQO B;  2XQY A;  4GKJ T;  2NW8 A;  3F31 A;  5LCY A;  4LML A;  4IGU A;  2NP9 A;  2IHR 1;  3WAK A;  4YY3 T;  4YSX A;  4UV8 B;  4TN7 B;  2W0G A;  5JR9 B;  1HNZ T;  3RI5 A;  4ZJS A;  3G06 A;  3PUV F;  2LHN A;  2CXL A;  4F6R C;  2BG9 A;  2DI4 A;  2XQ5 A;  3WTH A;  1O3X A;  3ZN1 B;  5C3J A;  1BR2 A;  3N9P A;  3EAM A;  4N78 D;  1SHZ C;  2V1D B;  2IC6 A;  2ES0 A;  3OVU A;  2NOX A;  2N2N A;  1OWA A;  1IAP A;  4B3M T;  4JBW F;  3MZK B;  3HL6 A;  5F5W A;  5LXB A;  3FB2 A;  2XM1 A;  2BG9 C;  5AQI B;  1Y64 B;  3JCF A;  3U8M A;  4QWN B;  3TLU A;  2VQE T;  1KNP A;  5AFK A;  3AA0 B;  3IHR A;  4LF6 T;  2ZM6 T;  3AE4 A;  1UX4 A;  4XHE A;  2UUA T;  3P4P A;  4L5G A;  3JAE A;  2VKJ A;  1FMV A;  2WNC A;  5ABH A;  3R6N A;  4AIS A;  1KFY A;  4CXX A;  5HXS A;  4IE5 A;  5FXW A;  4FI5 A;  4NIQ A;  1YD8 G;  3U8L A;  3ZMS B;  2CE7 A;  4QX7 B;  3UU8 A;  4ZI2 C;  4NUV A;  4WZX A;  5JDF A;  4LFB T;  2CCQ A;  2XQ6 A;  2CLY B;  4WNK A;  3OYZ A;  5ABF A;  2H3R A;  2V7K A;  2VB6 A;  2Y58 A;  4YFS A;  4B3S T;  2I0M A;  4A98 A;  2XAQ B;  5LG3 A;  2ZM0 A;  3O9X A;  2NTX A;  2K5B B;  3RQU A;  2NW9 A;  4CQI A;  4X1Y E;  3T1Y T;  2Y57 A;  4HN9 A;  3CK6 A;  1HCI A;  4WV9 A;  1XMO T;  2WZH A;  4BQT A;  3TLS A;  3GA8 A;  3NVO A;  3RYH E;  5HYA A;  1MND A;  3QB5 K;  1CUN A;  1BR1 A;  4H9N C;  3EDV A;  4TWF A;  4G63 A;  4CI2 B;  5FY1 A;  4DID B;  1HNW T;  1J5W A;  3UUM A;  3L3P A;  1ZOY A;  4IDO A;  5AFJ A;  2N1G A;  5CO5 A;  4QXH B;  4HFE A;  3Q9D A;  2BYN A;  2YDQ A;  4O4J E;  5CJ5 A;  4ANJ A;  3UTK A;  5F8P A;  1UCU A;  2X9Y A;  4JEU B;  4U3C A;  2Z6E A;  4YJ2 E;  3QOF A;  2LSY A;  3KV9 A;  3OBV E;  1FJG T;  4EED A;  2BDE A;  2DL1 A;  4FJO A;  2LKG A;  2FJE A;  4GK0 E;  3N9N A;  2X00 A;  1N33 T;  2WNJ A;  5JDN A;  4C91 A;  4X66 T;  3KVB A;  2CPT A;  3CWZ B;  2UXD T;  1SE7 A;  3RKO A;  2E5L T;  3KBT A;  3KBU A;  2A72 A;  2EHO B;  3ZPO A;  4HE8 A;  2KXP B;  1H7C A;  1XZY A;  4PFO A;  3UU6 A;  1BR4 A;  3ZSS A;  4IDQ A;  1CHU A;  3AE2 A;  3ETU A;  4LFC T;  5HAX A;  3V5S A;  4GIW A;  1YKH B;  5EK4 A;  2K24 A;  4CXY A;  3C51 A;  3C64 A;  2ZMA A;  3KIN B;  2WU5 A;  4ILC A;  4DBQ A;  3E0Z A;  2LJL A;  3ABV A;  5JDH A;  4HFC A;  2VKH A;  2NWB A;  4AXP A;  3C4X A;  1LKX A;  4IRE A;  2VAS A;  5FYM A;  5E0O A;  2D2S A;  5LJM A;  1VCT A;  1WYB A;  2EHO D;  5L3G B;  4TNV A;  4MBQ A;  2XUE A;  2L9Q A;  2QYW A;  4ASK A;  1M7K A;  3B5M A;  2N9D A;  1X9B A;  5FL1 A;  1U5P A;  3LDQ B;  2UUB T;  2PFV A;  4QXC B;  5FVK A;  4IST A;  3Q5W A;  1VOM A;  4DV7 T;  4KBM B;  3J9X 1;  5FJV A;  2PBI A;  3C4W A;  2W67 A;  4LMK A;  5BP0 A;  1BR0 A;  5JTG A;  4O2B E;  2CMR A;  3CQG B;  2LSG A;  4U2Z A;  4X62 T;  3FXE B;  1NAF A;  2UXN B;  3CPZ A;  2Q9Q A;  4B5D A;  3N5L A;  3RH3 A;  5JDL A;  3OYX A;  2V6Y B;  3ZCI A;  4WBN E;  3MK7 C;  4AFH A;  2UXC T;  4HGA A;  4U72 A;  3ZN0 B;  2JQ9 A;  2Y54 A;  5AQK B;  3AE5 A;  4H9Q C;  2BKP A;  4ZR6 A;  3P4Q A;  2DWK A;  3SFD A;  2WMN A;  2Q9Q C;  4HFI A;  4HEA A;  1IZN B;  2B76 A;  5FP3 A;  1UK5 A;  2XQ4 A;  4DV1 T;  4BJM A;  3DJB A;  1FEW A;  1YXR A;  3NBX X;  4C90 A;  4YJ3 E;  3SRZ A;  4WW0 A;  4MHC A;  2LSK A;  1KNZ A;  2C0S A;  2BR7 A;  2H89 A;  2WWU A;  4EZ1 A;  3X1D A;  4IL4 A;  1IBK T;  4ZOL E;  4JI0 T;  3MJX A;  3KVA A;  4JI8 T;  3AA1 B;  3AVS A;  2FJD A;  4E7S A;  3LK3 B;  3MKD A;  4HFV A;  1OED E;  3PU3 A;  3D0T A;  2H7O A;  2C5J A;  3OJA A;  4CN1 A;  3PUY F;  5HCM A;  1D0Z A;  2RP4 A;  2JIW A;  2CA5 A;  1ZEE A;  2BBH A;  5KZU A;  1SUM B;  3ZT6 A;  2VK9 A;  3P4S A;  5EK3 A;  4HWI B;  4XZC A;  3PJA A;  5C8Y E;  3UU3 A;  4K0K T;  3EVY A;  3LSV A;  2BR8 A;  3LBX A;  4YTP A;  4I4T E;  2E5V A;  4NXN T;  4P0A A;  2KSR A;  5BRX A;  3AE7 A;  5DAB A;  4IT4 A;  2X68 A;  3VR9 A;  3IGQ A;  5L3E B;  2JMH A;  5KX5 E;  1MMD A;  4WYV A;  2H7V C;  3UU4 A;  4I0U A;  1I6Z A;  3CX7 B;  4EZ4 A;  4Z91 A;  1IJ5 A;  5SYO A;  4MLK A;  1LRZ A;  1US7 B;  4GYS A;  3IA3 A;  2CM0 A;  3JAD A;  5AFN A;  1QSD A;  2K9A A;  4X65 T;  5AQR B;  5FXV A;  3CX6 B;  2E9X A;  1UUS A;  1KF6 A;  3HA4 A;  3HKC E;  3N2O A;  2V7I A;  3PV0 F;  3UUN A;  1VRB A;  5GON E;  5AQT B;  5L2L A;  3RIU A;  3ZDG A;  4U31 A;  3UQ4 A;  4QH1 A;  2LEH A;  2E2A A;  4EYY R;  4DV3 T;  4DV5 T;  2ZJV A;  2MAW A;  1MMG A;  5HEJ A;  3NKZ A;  2WY2 A;  5HXC A;  2BG9 E;  2DWG A;  2ZM2 A;  3JC6 D;  4BFQ A;  2XSA A;  3RIU C;  1HF8 A;  2XSB A;  3IEE A;  4Q25 A;  1I9B A;  3WTJ A;  4PJN A;  4H9S E;  3HKD E;  4QKN A;  4CZZ B;  1MMA A;  4MAL A;  2FJB A;  3EHZ A;  4CXW A;  4YTN A;  5IHY A;  4EIW A;  2HN1 A;  2ZM8 A;  4XBF B;  3RC3 A;  3H3A A;  2H88 A;  3UQ7 A;  4JUY A;  5AFM A;  5AQP B;  3WAJ A;  3RYF E;  1XDP A;  2JJ9 A;  3U8N A;  3VRA A;  3QB5 A;  4UEL A;  2XYT A;  3ZT7 A;  3RQW A;  2V26 A;  3VKH A;  3EUH A;  3I9W A;  4GYR A;  1KNR A;  1YQ4 A;  4G2A A;  4H9O C;  4GOU A;  4L9I A;  2W4X A;  2W8F A;  5CFB A;  4YTM A;  2Y8D A;  3AAA B;  1E7P A;  4AQG A;  3HKE E;  5LHI B;  5JVD E;  2OLT A;  4EAH A;  4TWD A;  2CBI A;  2MBG A;  4EEB A;  3ZMT B;  2WDR A;  3ZMZ B;  4UXU A;  5HWX A;  4JLE A;  1Z8U A;  5AQQ B;  4TV8 E;  4ILU A;  3EDU A;  3U3I A;  5AQU B;  3K3O A;  3AXJ A;  2FBW A;  3AEG A;  4B3R T;  4LF5 T;  3M3Z B;  3ANW A;  3NZQ A;  2YN6 A;  1D1C A;  2WP9 A;  2X0H A;  4JI6 T;  5HEH A;  4JI2 T;  4HWH A;  4X1I E;  5HXH A;  5LGU B;  2R6G F;  4OHF A;  4KHZ F;  2A3D A;  3N9M A;  4DMW A;  4LF7 T;  2XAS B;  1MNE A;  2XPK A;  2YKS A;  3L09 A;  2BYP A;  1XNQ T;  4HFD A;  2KND A;  2XQ3 A;  3PU8 A;  3NRY A;  3O4X E;  4DBM A;  2BKN A;  2LOS A;  3NWI A;  3W15 B;  4AI6 A;  2JQH A;  1AJ3 A;  1T72 A;  4XAX B;  3RLF F;  2WSS V;  3ONL C;  2LSJ A;  2X00 D;  5HWY A;  1ZHC A;  4CI1 B;  3H3M A;  4PAG A;  2HPJ A;  2UXX B;  3PJA J;  1SA0 E;  1HG2 A;  4ADZ A;  4UXN B;  3WTM A;  3AE1 A;  5L4H A;  4QHO A;  5J2U E;  4GK5 E;  4UY2 A;  4AKG A;  2IIU A;  2JQQ A;  3TKL B;  3UUX B;  5LJN A;  4JYA T;  2XYS A;  3I0Q A;  4DR4 T;  4AQY T;  2UXB T;  5HEU A;  4O8S A;  3K1S A;  4DR3 T;  3EAB A;  4A56 A;  3RPU A;  5A1L A;  3MXZ A;  3U78 A;  3UFG A;  1JNZ A;  1GQE A;  2HPL A;  4O4I E;  3MAC A;  5HEO A;  1UX2 A;  3R84 B;  4AKL A;  5CA1 E;  4BA9 A;  2QGS A;  3KV5 A;  2KMF A;  1YQ3 A;  4IE4 A;  5LYJ E;  3LG7 A;  5JR9 A;  3ETV A;  4UVB B;  4B6X A;  2RPA A;  4UM1 A;  2KT9 A;  4KHP T;  4NZB A;  2UZ6 A;  2PGZ A;  1VCS A;  4YSZ A;  4EZH A;  1XNR T;  1ZKE A;  4TUY E;  4YXD A;  2V7M A;  4PIR A;  2D0T A;  2JRK A;  4AKH A;  4QX8 B;  5JR9 C;  5JRC B;  1MIV A;  3KDS E;  4JI1 T;  3RC8 A;  4HWC A;  2XZ5 A;  2C9T A;  1IJ6 A;  4DO0 A;  1WRD A;  2BS3 A;  1G8X A;  2CWY A;  4H63 V;  1B7T A;  3CQC B;  3EI0 A;  3P4R A;  5L3B B;  1FMW A;  2WCA A;  3ZEF B;  1NWM X;  4KP3 C;  5HEG A;  5KXJ A;  5IUX A;  4PK5 A;  4P0B A;  4UIG A;  3I1A A;  4KMC A;  2KIN B;  2WB5 A;  2CXF A;  4X64 T;  2XAJ B;  4PJL A;  1DU2 A;  5KE4 A;  5LBM A;  4PJJ A;  2YK0 A;  3LK2 B;  2YDR A;  2CHN A;  4DBR A;  2HHH T;  3HI2 A;  5FXZ A; 
#chains in the Genus database with same CATH homology
 5J0Z A;  3ZKR A;  2LLY A;  3UQ4 A;  4LMK A;  4ZRU A;  2YME A;  4QH1 A;  4Z90 A;  2YN6 A;  5BP0 A;  5HCM A;  4ZK4 A;  4ILB A;  4LML A;  2BYS A;  3SIO A;  2ZJV A;  2XQ7 A;  3SQ6 A;  3U8L A;  2MAW A;  5HEH A;  5HEJ A;  2QC1 B;  2YMD A;  4UM1 A;  2BG9 E;  3UU8 A;  5L47 A;  3WTI A;  2BYQ A;  2LKH A;  2Y56 A;  4NZB A;  3C79 A;  4D01 A;  4X5T A;  5AFH A;  2UZ6 A;  1OED A;  4B5D A;  2PGZ A;  2YKS A;  5KZU A;  2M6B A;  4ZZC A;  4QAC A;  4BFQ A;  4QH5 A;  5L4E A;  2BYP A;  3UU5 A;  4HFD A;  2XQ6 A;  4FRR A;  3UU6 A;  2XQ3 A;  1I9B A;  2PH9 A;  3TLV A;  3WTJ A;  3WIP A;  4AFH A;  3RI5 A;  4AFT A;  2WN9 A;  4ZK1 A;  2W8G A;  4ZJS A;  4DBM A;  4PIR A;  3UU3 A;  2Y58 A;  2Y54 A;  3GUA A;  4A98 A;  3LSV A;  2XQ8 A;  5LG3 A;  1OED B;  2BG9 A;  3EHZ A;  2XQ5 A;  4F8H A;  3WTH A;  5HCJ A;  2YOE A;  2BR8 A;  1UW6 A;  5AFM B;  3EAM A;  4HFH A;  3RQU A;  4ZR6 A;  2WZY A;  2KSR A;  5BRX A;  4COF A;  2WNL A;  2XQA A;  3ZDH A;  4UM3 A;  4TNW A;  2Y57 A;  3IGQ A;  2XZ5 A;  3UQ7 A;  3SQ9 A;  5AFL A;  3TLT A;  4NPP A;  1OED C;  3UUB A;  2M6I A;  4HFI A;  2BJ0 A;  2C9T A;  2X00 D;  3U8J A;  4QAB A;  4UM3 S;  5AFM A;  5J5H A;  3WTK A;  4WV9 A;  3UU4 A;  2XQ9 A;  4QH4 A;  4BQT A;  4ILC A;  3EI0 A;  5J5G A;  3TLS A;  2BG9 B;  2XQ4 A;  2Y7Y A;  3T4M A;  4Z91 A;  1UV6 A;  2XNT A;  3U8N A;  4ALX A;  3C84 A;  4HFB A;  5SYO A;  3WTM A;  5HEG A;  5TVC A;  5L4H A;  2XYT A;  5IUX A;  5LXB A;  4TWF A;  4HFC A;  4XK9 A;  4ILA A;  4UY2 A;  2BG9 C;  5BW2 A;  3RQW A;  4IRE A;  5JME A;  3JAD A;  5AFN A;  4QAA A;  4AFG A;  3U8M A;  3TLU A;  5AFK A;  2BR7 A;  5AFJ A;  5CO5 A;  2VL0 A;  3PEO A;  5AIN A;  5J5F A;  4HFE A;  3JAF A;  2XYS A;  4TWH A;  2W8F A;  2BYN A;  2XZ6 A;  5CFB A;  4TNV A;  3WTL A;  4EZ1 A;  4IL4 A;  4ZZB A;  5HEU A;  4LMJ A;  4XHE A;  3PMZ A;  4TWD A;  5J5I A;  3RHW A;  3TLW A;  3RIF A;  2XNU A;  3WTO A;  3P4W A;  3WTN A;  4ZJT A;  4HQP A;  4IL9 A;  5KE4 A;  3P50 A;  3U8K A;  3JAE A;  4A97 A;  4UXU A;  4UM3 P;  2XNV A;  2BYR A;  2WNC A;  2ZJU A;  5HEO A;  3SH1 A;  2LKG A;  1UX2 A;  1OED E;  2LM2 A;  2X00 A;  3RIA A;  3ZDG A;  2WNJ A;  5FJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...