4HFDA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to bromoform
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfdA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfdA01
5IUXA 4LMKA 4UY2A 5J5HA 2BYNA 4XHEA 3C79A 2W8FA 2YMDA 2XNTA 2ZJUA 2BYPA 5AFKA 4ZZCA 4QACA 3UU5A 2Y57A 2XQ8A 2XZ5A 4UM3A 4QH1A 2XQ7A 3TLWA 2WNJA 3U8NA 4AFTA 3T4MA 4HFBA 3TLVA 5FJVA 2VL0A 1OEDE 5BW2A 4ILBA 2Y58A 1OEDC 2WNLA 4XK9A 2LKGA 3WTHA 3U8LA 5KZUA 5BP0A 3TLTA 4HFEA 3RIAA 5HCJA 5L4HA 3PEOA 4B5DA 2KSRA 4TNVA 3RHWA 3U8KA 4D01A 2XQ3A 2XQ9A 3PMZA 3SQ6A 5LG3A 4ZK1A 5L47A 5CO5A 4IREA 4TWHA 4HQPA 2X00D 2XQ6A 3UQ7A 5HEHA 3JAEA 2XYTA 2Y7YA 2X00A 3RQWA 3EAMA 2M6BA 3UQ4A 4ZRUA 2LM2A 5SYOA 4TWDA 2BYRA 4UXUA 3UU6A 2M6IA 3UUBA 4UM3S 2YMEA 4ZK4A 3WTOA 2Y56A 3WIPA 4LMLA 2WN9A 3JAFA 4ZR6A 3WTIA 4HFIA 2XQ5A 3RQUA 5J5FA 5TVCA 3RI5A 1UV6A 1UX2A 4NZBA 3WTKA 5HEUA 2BR8A 4A97A 2QC1B 4Z91A 3ZKRA 5HEGA 3TLUA 5J5GA 3ZDGA 2XZ6A 2BG9A 2YKSA 2WNCA 3UU8A 2XNUA 4COFA 4HFCA 5AINA 3WTNA 3EHZA 4X5TA 2LLYA 4HFHA 4NPPA 4EZ1A 4WV9A 2BG9B 2XQAA 3P4WA 4HFDA 5HCMA 4A98A 3WTMA 4AFGA 4ILCA 4ZJTA 3GUAA 3UU4A 4F8HA 3P50A 2XQ4A 3WTJA 5JMEA 3EI0A 2YOEA 2WZYA 4ALXA 4QH4A 4QABA 5BRXA 2YN6A 3TLSA 4QH5A 4UM1A 3WTLA 5AFNA 4TNWA 2XNVA 2PH9A 4IL4A 4FRRA 4IL9A 4UM3P 2LKHA 2BYSA 4ZJSA 3ZDHA 4DBMA 3SH1A 4BQTA 3U8JA 4QAAA 5KE4A 1OEDA 4AFHA 2BJ0A 2W8GA 3C84A 2UZ6A 2MAWA 4TWFA 1UW6A 5AFMA 2Y54A 3JADA 3UU3A 2BG9E 3U8MA 3IGQA 4Z90A 2C9TA 2XYSA 2BG9C 5AFJA 3RIFA 5HEJA 4ZZBA 2BYQA 5LXBA 4ILAA 5CFBA 5L4EA 4PIRA 4BFQA 1OEDB 5HEOA 5AFMB 3SIOA 5J5IA 2BR7A 4LMJA 5AFHA 3SQ9A 2PGZA 1I9BA 5J0ZA 2ZJVA 5AFLA 3LSVA
chains in the Genus database with same CATH superfamily
2C5JA 5FY1A 4ZZCA 2KWIB 2Y57A 5AQOB 4UM3A 1WYCA 5FY0A 2BKOA 1HX1B 3T4MA 2XPKA 3MACA 4HGAA 2Q9QD 3LG7A 4DR1T 2DHRA 4LF5T 2QGSA 3FXEB 4HQPA 2XHEB 2JIWA 1W09A 3I9YA 5AQRB 3KV4A 3PUXF 4UXUA 2YU1A 3NKZA 2YMEA 4WYVA 1CHUA 5HWXA 2RPAA 2V6XA 1YD8G 4GIWA 3BK9A 3AE7A 3NZPA 1WFDA 1ZP0A 2JPFA 3RYCE 4U2YA 3F57A 3AEDA 4IT4A 3P4WA 3CKDA 2VKJA 3M3ZB 3JC6D 2H7OA 2X0YA 3LK3B 1YQ3A 5HXCA 3T8OA 1W9RA 2VK9A 2KWHA 4IDPA 2J1DG 3KVAA 1IBLT 4DUYT 3EUHA 4AFHA 2G0UA 4QXHB 4ZZBA 5AQVB 4EB6E 3L09A 4TZ4C 5E0OA 4IHJE 2FBWA 3AE8A 4H9NC 4JI0T 3C79A 2C5KT 4IE7A 2E9XD 3RC8A 2OV9A 4K0KT 4UIGA 5FJVA 3AE1A 5IYZE 5L3FB 2UUBT 2CXDA 3C4XA 4B3MT 3K3QC 4ASKA 2Q9QA 2A2FX 4JV5T 4JI7T 3CX7B 2WZHA 5JR9B 3H3AA 4PK4A 4DR7T 2M6BA 3UQ4A 3FBLA 1J5WA 3SFDA 2A9UA 2XASB 2JJ9A 3RIUC 1B7TA 3FHNA 2UUAT 2I6HA 5JDQA 2UUCT 3RH3A 4PNIA 1UX4A 5DABA 3GMIA 4ZI7E 2CMRA 4CXXA 2XZ6A 2BG9A 2X66A 2ZM8A 5JQGE 4AISA 4OYKA 3EHZA 4YFSA 2DNXA 2XQAA 4AIUA 3WTMA 2IAKA 4ILCA 1MMDA 3MJXA 5HXRA 2XNVA 4O4LE 1LVKA 2I59A 2VKHA 1OEDA 5LGNB 3C84A 4OHFA 2Y54A 4XAXB 3I9WA 5JVDE 3PURA 4IDZA 2CLYB 1MIVA 4CXYA 5FL1A 4EV6A 4O2BE 5KMGP 1ZEEA 5IUXA 4PJJA 2B76A 4WW0A 4ZS2A 4HFBA 4ILBA 5IWAT 3U8LA 1BR2A 3RIAA 1IBMT 4ERRA 5ABGA 1X79A 1XWMA 3EDUA 4DIDB 3U8KA 3AVRA 3HA4A 3RF1A 4WNKA 2YU2A 4IREA 3UULA 1QUUA 2X00D 5HXEA 3E0ZA 2V7MA 2V8SV 5EZYE 2V5DA 4ZRUA 3PJAJ 2X9HA 2XAJB 3PUGA 2KMFA 2J62A 4PFPA 4GK5E 3AEFA 2CM0A 5JR9C 4ANJA 5HEUA 3ZKRA 3MK7C 2BBHA 4X1IE 3A5XA 5AQGB 5AINA 2NW9A 2EHOB 2IC6A 2ZM6T 5HCMA 4AFGA 3CQGB 1MIWA 2LM9A 3WTJA 3TKLB 4QXCB 1UUSA 3HKBE 2KNDA 4UM3P 3M65A 3VR9A 4QAAA 1UX5A 4YY3T 3ZT5A 3UT5E 5AFJA 3RIFA 4BAYB 3K8PC 4OK0A 3KV9A 4BFQA 5AFMB 1W0BA 5LB7B 5L3CB 1X9BA 3V5UA 3GA8A 4U7YA 3LSVA 1QSDA 2Y8DA 3U78A 3N2GE 2X9XA 3J7Yq 2N2NA 4KHPT 2VQET 2CLYC 5TAOA 5FNVE 4PAGA 5AQPB 3CPZA 4TNVA 2XQ3A 4O8SA 2V5CA 1GQEA 4LFBT 1E1HB 2X00A 3E08A 2Z6EA 3K3OA 3CIRA 5L2LA 5DJQC 1US7B 1E7PA 4DV7T 4UR9A 2W4XA 3KBUA 3WAJA 4CI3B 5FXXA 1Z8UA 4UXNB 4I0UA 1D0YA 4UV9B 5J1GA 1D0XA 2JMKA 2YDSA 4HFCA 3AAAB 3ZYLA 3WTNA 2MTQA 2X68A 5JRCB 5LXTE 5FVLA 1MNEA 5BRXA 4JEUB 4PFOA 3KV6A 5ABEA 3ANWB 3EDVA 3PUSA 2VKOA 2CHOA 2A72A 2EHOC 4H63H 3IGQA 4EOZB 2XAGB 3AE6A 2BZBA 3AAEB 5CJ5A 3OVUA 3RRCA 5C3JA 4GYRA 3N5LA 2ZLYA 4LF6T 3GN5A 2WZIA 3CVRA 4EXTA 2XQ7A 2CRBA 4P1NA 2DCFA 4M1PA 2W2UA 4XK9A 2KZ7B 5KZUA 5LOVE 2IW5B 4MBQA 4X20E 2BBJA 2XQ9A 2WCAA 2WP9A 5A1LA 3IBPA 2LOSA 4DR2T 2H89A 3UU6A 4UM3S 4JI4T 5JTGA 2D9DA 4LMLA 2WN9A 2X0HA 5CB4E 4H63V 4YSYA 3C98B 1HX8A 4Z91A 1IZNB 4JI3T 2V7IA 2H3RA 4O4IE 2E2AA 4KX6A 2K3WA 3OJAA 1IBKT 3H3MA 3A8YC 4A5XA 5LGUB 4ZEYA 2XQ4A 1ZKEA 4ZI2C 4EZ4A 1D0ZA 5F8PA 4U33A 2PH9A 2K24A 1KEYA 2JRKA 4L5GA 2N1GA 1KF6A 3MZKB 2BG9E 2W00A 2PBIA 3B13A 4DV3T 3ZT7A 1WCRA 2E9XB 3P4QA 4KP3C 4KI0F 4KUMB 4AKRB 3PUQA 1MMGA 2XNTA 1NENA 3VR8A 3TLWA 3AXJA 4MALA 2ACZA 2E5VA 2VKDA 1OEDE 4ZI3C 3PUAA 2VB6A 5L3EB 2XTLA 5AQFB 4BJMA 4AKHA 2KSRA 1V9DA 2DWGA 2NW8A 3RHWA 4NIQA 2H88A 5FYMA 5L47A 2F4VT 4U3CA 4I43B 1N33T 2XYTA 4C91A 2ZM0A 1FJGT 1G73A 1Y64B 4EGWA 5AQJB 2X0LB 4AQFC 3N2KE 3TLUA 5J5GA 3NRXA 4QKNA 4ZOLE 2SPCA 3ZN1B 1SUMB 5FXWA 4V1Av 4KHZF 3B57A 1M62A 3DTOA 1OWAA 5LNKA 3L8RA 2GK9A 1MMNA 2X9WA 3JC6C 5FMNA 4CN6A 3J9X1 2CA5A 4JBWF 3HR0A 3N9NA 4EYYR 5AQSB 3RYIE 5HEJA 4PIRA 3PV0F 3AVSA 2NOXA 4JI8T 4G63A 4QXBB 3AE2A 5AQIB 1NAFA 4P0BA 4XHEA 3LBXA 3Q9DA 3IF8B 2LRKA 2BDEA 3F2EA 4X65T 2YEVC 2B1EA 2FUPA 2WNLA 5FP3A 2E9XC 2OA5A 3RGLA 4AKGA 2W63A 5LMUT 3QB5A 3N9MA 2VQFT 4PW8A 4TWHA 3FZMB 1JNZA 2QVAA 3QK6A 2IC9A 3LK42 4GKJT 4TN7B 2M6IA 2R6GF 1M7KA 3DP7A 4BJNA 2BS3A 4HFIA 2K48A 1O3XA 4JI2T 4B3RT 3KDSE 4FI5A 4NZBA 3X1DA 4ISSA 4UELA 2HPLA 3ETVA 2LLYA 1D1BA 1AJ3A 2XQYA 4AKLA 4QH4A 1HCIA 4UM1A 2OLTA 4DV2T 3NZQA 3AA1B 4NUVA 4DV5T 3AEGA 2WU2A 4JUYA 4TWFA 2PG8A 3ZMTB 5ABFA 3U8MA 4ZXLA 3ZJ1A 4TV8E 2BR7A 3VHLA 4OFZA 5DQWA 1MNDA 2V1DB 3ZPOA 4GK0E 5ABHA 2CBIA 2BYPA 4JI6T 3ZYMA 2LT3A 2CWYA 2CXLA 5BW2A 2YINA 3IHRA 4HWHA 2CXFA 4HKAA 5FXVA 2AE9A 3PUWF 3NRYA 3KBTA 2IHR1 3ZMZB 1U4QA 2QRXA 3D0TA 3PU3A 4NXNT 1XNRT 4CN1A 2C0SA 4B3TT 1LKXA 4UF0A 2LM2A 2W61A 3JAFA 3NVOA 3ONLC 2HN2A 1FMWA 2QC1B 5CA0E 5KX5E 4PJLA 3T1YT 1UURA 1WLXA 5HAXA 4YTNA 3N9LA 1H7CA 2CCQA 2WWVA 1XNQT 1FMVA 3V5SA 1Z0PA 2KXPB 2V6YA 2W62A 5JDHA 1HR0T 5HXHA 2WM9A 4UV8B 2WZYA 5AQNB 3RYFE 1JNRA 3ZMSB 3PTRB 3CQXC 4DR3T 5LYJE 4DBMA 4BQTA 4PJNA 1CUNA 4Z90A 3ZJ2A 5C2TA 5CFBA 3UUMA 4LF7T 4JEHB 2RP4A 5J5IA 2I0MA 3QNUA 1S94A 2WSSV 3I1AA 5HYAA 2K5BB 1I6ZA 3VU7H 4U74A 4O2AE 2P9BA 3R6NA 5AFUL 3RIUA 1YW0A 3ONJA 3QB5K 5J2UE 2X51A 4YJ2E 3IA3A 3LDQB 3RYHE 4ZK1A 4J2CA 4YTPA 4ADZA 2BS4A 4DBQA 4L0RA 1NEKA 2ZM2A 3AE9A 4JI1T 1KNPA 2X67A 5IHYA 3A7MA 2KINB 1MMAA 1DU2A 2ACXA 5KDMC 1T8BA 2BKPA 4IE4A 4I55E 4YLHA 4IDQA 4DR4T 2XZEA 5L3GB 4U2ZA 2LEHA 2CE7A 4K0UA 1UGOA 3MXZA 3C50A 2HN1A 5EK2A 2LRLA 3ZLIA 5DQVA 3P8CD 4PK5A 2YOEA 2LOPA 2Y48B 3HKCE 4I4TE 2BYSA 2FJEA 1OXZA 1G8XA 2ODVA 3LBXB 2UZ6A 1IAPA 4LF4T 4G2AA 5AQLB 3AE3A 2CEAA 3O4XE 4LMJA 1LVFA 2ZMAA 4KBMB 3EABA 2HH7A 5M4YA 2V26A 1YXRA 3HI2A 2ZJUA 4IDOA 5JREA 3ZC1A 4HWCA 3QUJA 3N2OA 4HN9A 5F5WA 2WS3A 3C64A 2Y58A 5ADXL 2LKGA 3AEEA 2BS2A 4UVCB 5JR9A 1XMOT 4L9IA 2QA7A 3ZSTA 3AE5A 1VCSA 5JDNA 2LSGA 3ONXA 5LBMA 4U31A 2Q9QB 3LK2B 3SS1A 2Y7YA 2MYSA 5LJMA 4XBFB 1EZ3A 1FIOA 1WR0A 2UXXB 3QOFA 3SWHA 3ZMVB 4ZK4A 4GYSA 4DNDA 4ZR6A 2NTXA 2EHOD 3RQUA 3NWIA 2XM1A 1UV6A 4A97A 1UK5A 3I0QA 2DI4A 4CZZB 4COFA 4EZ1A 2BG9B 3KFWX 2HPJA 4H9PC 3UU4A 1N36T 4P0AA 1HG5A 3EI0A 1BR1A 2YN6A 4EEBA 2LKHA 3DJBA 2WBLA 4ISTA 2UU9T 1KK7A 1LRZA 3OKQA 1OEDB 3ZC0A 1HS7A 3SIOA 2MOZA 1BR4A 3OPCA 4WBNE 5ETWA 5L3DB 2LE8A 1I9BA 1QLBA 2WAUA 3UU5A 1HFAA 2XQ8A 4QX7B 3UFEA 4AFTA 5C8YE 2JQ9A 3TLVA 1KNZA 2CHNA 2CPTA 4UF0B 3C4WA 1FEWA 3PMZA 3WI3A 5LG3A 3ABVA 2MPKA 1J1JA 3B5MA 2IIUA 2JQKA 4GKKT 4B3ST 4ZI2D 3UUBA 1HNXT 5LHHB 2LJLA 3RC3A 4EIWA 3WIPA 5JDGA 1ZOYA 3MKDA 2E5LT 4U72A 2Q9QC 1UX2A 4DV1T 5F3JA 2EHOA 2L9QA 3ZSSA 4PK6A 2DLRA 4CI1B 1KNRA 4HFHA 1Y01A 4A98A 4ZJTA 4O4JE 3R84B 3RPUA 3Q5XA 4QH5A 4ZI3D 5LP6E 4TNWA 4FRRA 4IL4A 4IL9A 4GOUA 3BQLA 3ZT6A 4FJOA 5AFMA 1MIYA 3FZHB 4IIJE 2A3DA 2XYSA 2BG9C 3N9OA 5LHGB 4ILAA 4DV4T 3RLFF 5AFHA 2KLQA 3AEBA 2ZJVA 4IE6A 2D0UA 4UY2A 3O1IA 5CA1E 3LJCA 5JDMA 2XM2A 2M67A 3UUNA 1NWMX 2VL0A 1OEDC 4QX8B 2XAQB 4YHJA 3PEOA 5EK4A 4KMCA 4TV9E 3NBXX 4H9SE 4N78D 1WR6A 4Z8XA 4QHOA 2VWAA 4U7IA 4YXDA 4NXMT 2NW7A 1T98A 3HKEE 4DMVA 5AQHB 4O4HE 4LFCT 3ZDGA 4JI5T 2YKSA 4DO0A 3SFEA 4HFVA 2KT9A 5JRCA 4CQIA 1E2AA 4DR5T 2VVNA 2NWBA 3O1JA 3SRZA 1N32T 4WZXA 4HWFA 4EZHA 5LG4A 3GUAA 4F8HA 3ANWA 3ZYKA 4AQYT 2WU5A 2VVSA 2W8GA 3ESLA 4X64T 5BR8T 3L3PA 5L4EA 4IE5A 2N9DA 3AA0B 3CX8B 3L39A 2NTYA 1S35A 4HWDA 3CQCB 4YT0A 4QWNB 2YDRA 5FKYA 1SA0E 1YQ4A 3GN5B 1SE7A 3E22E 4HE8A 3RRWA 1T72A 4JYAT 2W66A 3T1HT 4DR6T 3VKHA 3BQIA 3O1HA 1HNWT 3P7IA 4DMWA 4AQFA 1R8IA 3SQ6A 2LSKA 3O9XA 4DUZT 2XQ6A 1YKEB 5H6RB 5HWYA 3ZN0B 2BYRA 2JQQA 4LF8T 2LSJA 2XQ5A 4UVBB 5TVCA 3FZKB 2W67A 4EYUA 3AECA 3RKGA 3AAIA 4ZS3A 2WDRA 4X5TA 2K9AA 3ZEFB 2IUBA 4DV6T 2X9YA 3EVYA 3CMLA 3P50A 2WB5A 3Q2MA 3TLSA 4UVAB 3HL6A 3WTLA 4X1KE 4IDNA 4CN4A 4ZJSA 3SH1A 2VL8A 2WWUA 4XZCA 2BJ0A 2MAWA 1UW6A 1KFYA 2E9XA 3JADA 3K1SA 4H9OC 4EAHA 2W0GA 5HEOA 3Q5DA 2UXCT 4AQGA 2PGZA 2Y6XA 3CX6B 2BVMA 4I50E 1WRDA 4PJMA 2BYNA 3PE0A 4QACA 2XZ5A 2C5IT 2WNJA 5AQQB 1D1AA 2L8KA 4CI2B 3Q5WA 3AXJB 3FB2A 5L4HA 1VCTA 4H9RC 1W0AA 2BVLA 4AKIA 3AE4A 3CWZB 3PUVF 3IEEA 5FVKA 3CK6A 2ODUA 5HEHA 2VURA 3W15B 3EAMA 5H6QB 3AA7B 1VOMA 3H37A 4TWDA 1HG2A 1XDPA 5AQMB 4B6XA 4UEMA 3FZFB 2JQHA 2DL1A 1UCUA 3RI5A 4WBOA 3WTKA 5L3BB 1XZYA 4C90A 2XAFB 2IMLA 2NR4A 2XAHB 1YKHB 4LFAT 3P4PA 4IGUA 4DVDA 4WV9A 3RX6A 3AEAA 3F31A 5LCYA 5BMVE 2FJBA 3MA9A 3BQKA 2RA1A 4X1YE 3UFGA 2PTFA 5J2TE 4ALXA 4QABA 3C4ZA 2WY2A 5KE4A 3I0OA 2FJAA 3UU3A 3N9QA 1N34T 2LSIA 3PU8A 1HNZT 2V7JA 3SQ9A 3P4SA 3PUYF 5J0ZA 1VRBA 2UXNB 5LMNT 4X66T 2YMDA 3ETUA 4MLKA 1IJ6A 4QH1A 3QC9A 3OBVE 1WYBA 2XUEA 4ZHQE 1J5ET 5BP0A 5JH7E 4TX5A 5CGMA 5EK3A 2AXDS 5CO5A 1ZHCA 2YDQA 4IE0A 4MFRA 3VRBA 5JDFA 3P4RA 2D0TA 3UQ7A 3JAEA 3PUZF 4HEAA 2IDOB 4DBRA 2XSAA 1IJ5A 5LJNA 3WTOA 2Y56A 4LF9T 2WDVA 3WTIA 3RKOA 4JLEA 3VRAA 3JCFA 4AI6A 4X62T 5HEGA 2LSYA 2WNCA 3UU8A 2XNUA 4Q25A 4YHHT 3K3NA 3UTKA 4NPPA 4HFDA 2XSBA 1XDOA 4OX9T 3AB3B 4EEDA 3WAKA 3LFMA 5AFNA 3KV5A 2WMNA 2V7LA 4AXPA 3ZDHA 1D1CA 3UUXB 2DWKA 2UXBT 3U8JA 3G06A 3FZLB 4F6RC 2BKNA 2C9TA 2PJQA 3Q5EA 2QYWA 5AQTB 2LHNA 5ABFB 4A56A 4MHCA 2YK0A 5LGTB 5FXZA 3SOLA 4ILUA 4LMKA 5J5HA 4YSZA 5AQUB 2W8FA 5AFKA 4HWIB 2E8IA 1L0VA 4YTMA 3U8NA 2LHRA 2XY8B 3ZCJA 1ZV4X 4YSXA 3OYZA 2J4GA 3WTHA 3TLTA 4HFEA 5HCJA 4HTEA 4CXWA 4DV0T 1XMQT 5HXSA 4B5DA 2L3LA 2D2SA 3GWHA 5LHIB 3HKDE 5KXJA 4D01A 3N9PA 2CWOA 2MBGA 2JMHA 3VKGA 4NUUA 1HF8A 3RQWA 2FJDA 2NP9A 2HHHT 5SYOA 5LBQB 3C51A 3FXDB 5FY7A 4TUYE 4OYJA 5J5FA 1BR0A 1HTJF 2H7VC 2VASA 4H9QC 4YJ3E 4BA9A 2BR8A 1T7SA 2CBJA 3S4UA 3KVBA 2WMOA 1U5PA 4E7SA 5GONE 3PDYA 3ZCIA 3KINB 5JDLA 5LA6E 2XJ7A 5JMEA 3U3IA 3OTOT 2UXDT 2V6YB 3ZMUB 1I94T 2PFVA 3OYXA 3FBZA 4E7ZA 2BYQA 3AA6B 2WDQA 5LXBA 4P09A 2ES0A 2V7KA 5FL0A 1SHZC 2WQYA 3PJAA 2D5UA 5AQKB 5AFLA 2J47A
chains in the Genus database with same CATH topology
5IUXA 4LMKA 4UY2A 5J5HA 2BYNA 4XHEA 3C79A 2W8FA 2YMDA 2XNTA 2ZJUA 2BYPA 5AFKA 4ZZCA 4QACA 3UU5A 2Y57A 2XQ8A 2XZ5A 4UM3A 4QH1A 2XQ7A 3TLWA 2WNJA 3U8NA 4AFTA 3T4MA 4HFBA 3TLVA 5FJVA 2VL0A 1OEDE 5BW2A 4ILBA 2Y58A 1OEDC 2WNLA 4XK9A 2LKGA 3WTHA 3U8LA 5KZUA 5BP0A 3TLTA 4HFEA 3RIAA 5HCJA 5L4HA 3PEOA 4B5DA 2KSRA 4TNVA 3RHWA 3U8KA 4D01A 2XQ3A 2XQ9A 3PMZA 3SQ6A 5LG3A 4ZK1A 5L47A 5CO5A 4IREA 4TWHA 4HQPA 2X00D 2XQ6A 3UQ7A 5HEHA 3JAEA 2XYTA 2Y7YA 2X00A 3RQWA 3EAMA 2M6BA 3UQ4A 4ZRUA 2LM2A 5SYOA 4TWDA 2BYRA 4UXUA 3UU6A 2M6IA 3UUBA 4UM3S 2YMEA 4ZK4A 3WTOA 2Y56A 3WIPA 4LMLA 2WN9A 3JAFA 4ZR6A 3WTIA 4HFIA 2XQ5A 3RQUA 5J5FA 5TVCA 3RI5A 1UV6A 1UX2A 4NZBA 3WTKA 5HEUA 2BR8A 4A97A 2QC1B 4Z91A 3ZKRA 5HEGA 3TLUA 5J5GA 3ZDGA 2XZ6A 2BG9A 2YKSA 2WNCA 3UU8A 2XNUA 4COFA 4HFCA 5AINA 3WTNA 3EHZA 4X5TA 2LLYA 4HFHA 4NPPA 4EZ1A 4WV9A 2BG9B 2XQAA 3P4WA 4HFDA 5HCMA 4A98A 3WTMA 4AFGA 4ILCA 4ZJTA 3GUAA 3UU4A 4F8HA 3P50A 2XQ4A 3WTJA 5JMEA 3EI0A 2YOEA 2WZYA 4ALXA 4QH4A 4QABA 5BRXA 2YN6A 3TLSA 4QH5A 4UM1A 3WTLA 5AFNA 4TNWA 2XNVA 2PH9A 4IL4A 4FRRA 4IL9A 4UM3P 2LKHA 2BYSA 4ZJSA 3ZDHA 4DBMA 3SH1A 4BQTA 3U8JA 4QAAA 5KE4A 1OEDA 4AFHA 2BJ0A 2W8GA 3C84A 2UZ6A 2MAWA 4TWFA 1UW6A 5AFMA 2Y54A 3JADA 3UU3A 2BG9E 3U8MA 3IGQA 4Z90A 2C9TA 2XYSA 2BG9C 5AFJA 3RIFA 5HEJA 4ZZBA 2BYQA 5LXBA 4ILAA 5CFBA 5L4EA 4PIRA 4BFQA 1OEDB 5HEOA 5AFMB 3SIOA 5J5IA 2BR7A 4LMJA 5AFHA 3SQ9A 2PGZA 1I9BA 5J0ZA 2ZJVA 5AFLA 3LSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IUX A;  4LMK A;  4UY2 A;  5J5H A;  2BYN A;  4XHE A;  3C79 A;  2W8F A;  2YMD A;  2XNT A;  2ZJU A;  2BYP A;  5AFK A;  4ZZC A;  4QAC A;  3UU5 A;  2Y57 A;  2XQ8 A;  2XZ5 A;  4UM3 A;  4QH1 A;  2XQ7 A;  3TLW A;  2WNJ A;  3U8N A;  4AFT A;  3T4M A;  4HFB A;  3TLV A;  5FJV A;  2VL0 A;  1OED E;  5BW2 A;  4ILB A;  2Y58 A;  1OED C;  2WNL A;  4XK9 A;  2LKG A;  3WTH A;  3U8L A;  5KZU A;  5BP0 A;  3TLT A;  4HFE A;  3RIA A;  5HCJ A;  5L4H A;  3PEO A;  4B5D A;  2KSR A;  4TNV A;  3RHW A;  3U8K A;  4D01 A;  2XQ3 A;  2XQ9 A;  3PMZ A;  3SQ6 A;  5LG3 A;  4ZK1 A;  5L47 A;  5CO5 A;  4IRE A;  4TWH A;  4HQP A;  2X00 D;  2XQ6 A;  3UQ7 A;  5HEH A;  3JAE A;  2XYT A;  2Y7Y A;  2X00 A;  3RQW A;  3EAM A;  2M6B A;  3UQ4 A;  4ZRU A;  2LM2 A;  5SYO A;  4TWD A;  2BYR A;  4UXU A;  3UU6 A;  2M6I A;  3UUB A;  4UM3 S;  2YME A;  4ZK4 A;  3WTO A;  2Y56 A;  3WIP A;  4LML A;  2WN9 A;  3JAF A;  4ZR6 A;  3WTI A;  4HFI A;  2XQ5 A;  3RQU A;  5J5F A;  5TVC A;  3RI5 A;  1UV6 A;  1UX2 A;  4NZB A;  3WTK A;  5HEU A;  2BR8 A;  4A97 A;  2QC1 B;  4Z91 A;  3ZKR A;  5HEG A;  3TLU A;  5J5G A;  3ZDG A;  2XZ6 A;  2BG9 A;  2YKS A;  2WNC A;  3UU8 A;  2XNU A;  4COF A;  4HFC A;  5AIN A;  3WTN A;  3EHZ A;  4X5T A;  2LLY A;  4HFH A;  4NPP A;  4EZ1 A;  4WV9 A;  2BG9 B;  2XQA A;  3P4W A;  4HFD A;  5HCM A;  4A98 A;  3WTM A;  4AFG A;  4ILC A;  4ZJT A;  3GUA A;  3UU4 A;  4F8H A;  3P50 A;  2XQ4 A;  3WTJ A;  5JME A;  3EI0 A;  2YOE A;  2WZY A;  4ALX A;  4QH4 A;  4QAB A;  5BRX A;  2YN6 A;  3TLS A;  4QH5 A;  4UM1 A;  3WTL A;  5AFN A;  4TNW A;  2XNV A;  2PH9 A;  4IL4 A;  4FRR A;  4IL9 A;  4UM3 P;  2LKH A;  2BYS A;  4ZJS A;  3ZDH A;  4DBM A;  3SH1 A;  4BQT A;  3U8J A;  4QAA A;  5KE4 A;  1OED A;  4AFH A;  2BJ0 A;  2W8G A;  3C84 A;  2UZ6 A;  2MAW A;  4TWF A;  1UW6 A;  5AFM A;  2Y54 A;  3JAD A;  3UU3 A;  2BG9 E;  3U8M A;  3IGQ A;  4Z90 A;  2C9T A;  2XYS A;  2BG9 C;  5AFJ A;  3RIF A;  5HEJ A;  4ZZB A;  2BYQ A;  5LXB A;  4ILA A;  5CFB A;  5L4E A;  4PIR A;  4BFQ A;  1OED B;  5HEO A;  5AFM B;  3SIO A;  5J5I A;  2BR7 A;  4LMJ A;  5AFH A;  3SQ9 A;  2PGZ A;  1I9B A;  5J0Z A;  2ZJV A;  5AFL A;  3LSV A; 
#chains in the Genus database with same CATH topology
 2C5J A;  5FY1 A;  4ZZC A;  2KWI B;  2Y57 A;  5AQO B;  4UM3 A;  1WYC A;  5FY0 A;  2BKO A;  1HX1 B;  3T4M A;  2XPK A;  3MAC A;  4HGA A;  2Q9Q D;  3LG7 A;  4DR1 T;  2DHR A;  4LF5 T;  2QGS A;  3FXE B;  4HQP A;  2XHE B;  2JIW A;  1W09 A;  3I9Y A;  5AQR B;  3KV4 A;  3PUX F;  4UXU A;  2YU1 A;  3NKZ A;  2YME A;  4WYV A;  1CHU A;  5HWX A;  2RPA A;  2V6X A;  1YD8 G;  4GIW A;  3BK9 A;  3AE7 A;  3NZP A;  1WFD A;  1ZP0 A;  2JPF A;  3RYC E;  4U2Y A;  3F57 A;  3AED A;  4IT4 A;  3P4W A;  3CKD A;  2VKJ A;  3M3Z B;  3JC6 D;  2H7O A;  2X0Y A;  3LK3 B;  1YQ3 A;  5HXC A;  3T8O A;  1W9R A;  2VK9 A;  2KWH A;  4IDP A;  2J1D G;  3KVA A;  1IBL T;  4DUY T;  3EUH A;  4AFH A;  2G0U A;  4QXH B;  4ZZB A;  5AQV B;  4EB6 E;  3L09 A;  4TZ4 C;  5E0O A;  4IHJ E;  2FBW A;  3AE8 A;  4H9N C;  4JI0 T;  3C79 A;  2C5K T;  4IE7 A;  2E9X D;  3RC8 A;  2OV9 A;  4K0K T;  4UIG A;  5FJV A;  3AE1 A;  5IYZ E;  5L3F B;  2UUB T;  2CXD A;  3C4X A;  4B3M T;  3K3Q C;  4ASK A;  2Q9Q A;  2A2F X;  4JV5 T;  4JI7 T;  3CX7 B;  2WZH A;  5JR9 B;  3H3A A;  4PK4 A;  4DR7 T;  2M6B A;  3UQ4 A;  3FBL A;  1J5W A;  3SFD A;  2A9U A;  2XAS B;  2JJ9 A;  3RIU C;  1B7T A;  3FHN A;  2UUA T;  2I6H A;  5JDQ A;  2UUC T;  3RH3 A;  4PNI A;  1UX4 A;  5DAB A;  3GMI A;  4ZI7 E;  2CMR A;  4CXX A;  2XZ6 A;  2BG9 A;  2X66 A;  2ZM8 A;  5JQG E;  4AIS A;  4OYK A;  3EHZ A;  4YFS A;  2DNX A;  2XQA A;  4AIU A;  3WTM A;  2IAK A;  4ILC A;  1MMD A;  3MJX A;  5HXR A;  2XNV A;  4O4L E;  1LVK A;  2I59 A;  2VKH A;  1OED A;  5LGN B;  3C84 A;  4OHF A;  2Y54 A;  4XAX B;  3I9W A;  5JVD E;  3PUR A;  4IDZ A;  2CLY B;  1MIV A;  4CXY A;  5FL1 A;  4EV6 A;  4O2B E;  5KMG P;  1ZEE A;  5IUX A;  4PJJ A;  2B76 A;  4WW0 A;  4ZS2 A;  4HFB A;  4ILB A;  5IWA T;  3U8L A;  1BR2 A;  3RIA A;  1IBM T;  4ERR A;  5ABG A;  1X79 A;  1XWM A;  3EDU A;  4DID B;  3U8K A;  3AVR A;  3HA4 A;  3RF1 A;  4WNK A;  2YU2 A;  4IRE A;  3UUL A;  1QUU A;  2X00 D;  5HXE A;  3E0Z A;  2V7M A;  2V8S V;  5EZY E;  2V5D A;  4ZRU A;  3PJA J;  2X9H A;  2XAJ B;  3PUG A;  2KMF A;  2J62 A;  4PFP A;  4GK5 E;  3AEF A;  2CM0 A;  5JR9 C;  4ANJ A;  5HEU A;  3ZKR A;  3MK7 C;  2BBH A;  4X1I E;  3A5X A;  5AQG B;  5AIN A;  2NW9 A;  2EHO B;  2IC6 A;  2ZM6 T;  5HCM A;  4AFG A;  3CQG B;  1MIW A;  2LM9 A;  3WTJ A;  3TKL B;  4QXC B;  1UUS A;  3HKB E;  2KND A;  4UM3 P;  3M65 A;  3VR9 A;  4QAA A;  1UX5 A;  4YY3 T;  3ZT5 A;  3UT5 E;  5AFJ A;  3RIF A;  4BAY B;  3K8P C;  4OK0 A;  3KV9 A;  4BFQ A;  5AFM B;  1W0B A;  5LB7 B;  5L3C B;  1X9B A;  3V5U A;  3GA8 A;  4U7Y A;  3LSV A;  1QSD A;  2Y8D A;  3U78 A;  3N2G E;  2X9X A;  3J7Y q;  2N2N A;  4KHP T;  2VQE T;  2CLY C;  5TAO A;  5FNV E;  4PAG A;  5AQP B;  3CPZ A;  4TNV A;  2XQ3 A;  4O8S A;  2V5C A;  1GQE A;  4LFB T;  1E1H B;  2X00 A;  3E08 A;  2Z6E A;  3K3O A;  3CIR A;  5L2L A;  5DJQ C;  1US7 B;  1E7P A;  4DV7 T;  4UR9 A;  2W4X A;  3KBU A;  3WAJ A;  4CI3 B;  5FXX A;  1Z8U A;  4UXN B;  4I0U A;  1D0Y A;  4UV9 B;  5J1G A;  1D0X A;  2JMK A;  2YDS A;  4HFC A;  3AAA B;  3ZYL A;  3WTN A;  2MTQ A;  2X68 A;  5JRC B;  5LXT E;  5FVL A;  1MNE A;  5BRX A;  4JEU B;  4PFO A;  3KV6 A;  5ABE A;  3ANW B;  3EDV A;  3PUS A;  2VKO A;  2CHO A;  2A72 A;  2EHO C;  4H63 H;  3IGQ A;  4EOZ B;  2XAG B;  3AE6 A;  2BZB A;  3AAE B;  5CJ5 A;  3OVU A;  3RRC A;  5C3J A;  4GYR A;  3N5L A;  2ZLY A;  4LF6 T;  3GN5 A;  2WZI A;  3CVR A;  4EXT A;  2XQ7 A;  2CRB A;  4P1N A;  2DCF A;  4M1P A;  2W2U A;  4XK9 A;  2KZ7 B;  5KZU A;  5LOV E;  2IW5 B;  4MBQ A;  4X20 E;  2BBJ A;  2XQ9 A;  2WCA A;  2WP9 A;  5A1L A;  3IBP A;  2LOS A;  4DR2 T;  2H89 A;  3UU6 A;  4UM3 S;  4JI4 T;  5JTG A;  2D9D A;  4LML A;  2WN9 A;  2X0H A;  5CB4 E;  4H63 V;  4YSY A;  3C98 B;  1HX8 A;  4Z91 A;  1IZN B;  4JI3 T;  2V7I A;  2H3R A;  4O4I E;  2E2A A;  4KX6 A;  2K3W A;  3OJA A;  1IBK T;  3H3M A;  3A8Y C;  4A5X A;  5LGU B;  4ZEY A;  2XQ4 A;  1ZKE A;  4ZI2 C;  4EZ4 A;  1D0Z A;  5F8P A;  4U33 A;  2PH9 A;  2K24 A;  1KEY A;  2JRK A;  4L5G A;  2N1G A;  1KF6 A;  3MZK B;  2BG9 E;  2W00 A;  2PBI A;  3B13 A;  4DV3 T;  3ZT7 A;  1WCR A;  2E9X B;  3P4Q A;  4KP3 C;  4KI0 F;  4KUM B;  4AKR B;  3PUQ A;  1MMG A;  2XNT A;  1NEN A;  3VR8 A;  3TLW A;  3AXJ A;  4MAL A;  2ACZ A;  2E5V A;  2VKD A;  1OED E;  4ZI3 C;  3PUA A;  2VB6 A;  5L3E B;  2XTL A;  5AQF B;  4BJM A;  4AKH A;  2KSR A;  1V9D A;  2DWG A;  2NW8 A;  3RHW A;  4NIQ A;  2H88 A;  5FYM A;  5L47 A;  2F4V T;  4U3C A;  4I43 B;  1N33 T;  2XYT A;  4C91 A;  2ZM0 A;  1FJG T;  1G73 A;  1Y64 B;  4EGW A;  5AQJ B;  2X0L B;  4AQF C;  3N2K E;  3TLU A;  5J5G A;  3NRX A;  4QKN A;  4ZOL E;  2SPC A;  3ZN1 B;  1SUM B;  5FXW A;  4V1A v;  4KHZ F;  3B57 A;  1M62 A;  3DTO A;  1OWA A;  5LNK A;  3L8R A;  2GK9 A;  1MMN A;  2X9W A;  3JC6 C;  5FMN A;  4CN6 A;  3J9X 1;  2CA5 A;  4JBW F;  3HR0 A;  3N9N A;  4EYY R;  5AQS B;  3RYI E;  5HEJ A;  4PIR A;  3PV0 F;  3AVS A;  2NOX A;  4JI8 T;  4G63 A;  4QXB B;  3AE2 A;  5AQI B;  1NAF A;  4P0B A;  4XHE A;  3LBX A;  3Q9D A;  3IF8 B;  2LRK A;  2BDE A;  3F2E A;  4X65 T;  2YEV C;  2B1E A;  2FUP A;  2WNL A;  5FP3 A;  2E9X C;  2OA5 A;  3RGL A;  4AKG A;  2W63 A;  5LMU T;  3QB5 A;  3N9M A;  2VQF T;  4PW8 A;  4TWH A;  3FZM B;  1JNZ A;  2QVA A;  3QK6 A;  2IC9 A;  3LK4 2;  4GKJ T;  4TN7 B;  2M6I A;  2R6G F;  1M7K A;  3DP7 A;  4BJN A;  2BS3 A;  4HFI A;  2K48 A;  1O3X A;  4JI2 T;  4B3R T;  3KDS E;  4FI5 A;  4NZB A;  3X1D A;  4ISS A;  4UEL A;  2HPL A;  3ETV A;  2LLY A;  1D1B A;  1AJ3 A;  2XQY A;  4AKL A;  4QH4 A;  1HCI A;  4UM1 A;  2OLT A;  4DV2 T;  3NZQ A;  3AA1 B;  4NUV A;  4DV5 T;  3AEG A;  2WU2 A;  4JUY A;  4TWF A;  2PG8 A;  3ZMT B;  5ABF A;  3U8M A;  4ZXL A;  3ZJ1 A;  4TV8 E;  2BR7 A;  3VHL A;  4OFZ A;  5DQW A;  1MND A;  2V1D B;  3ZPO A;  4GK0 E;  5ABH A;  2CBI A;  2BYP A;  4JI6 T;  3ZYM A;  2LT3 A;  2CWY A;  2CXL A;  5BW2 A;  2YIN A;  3IHR A;  4HWH A;  2CXF A;  4HKA A;  5FXV A;  2AE9 A;  3PUW F;  3NRY A;  3KBT A;  2IHR 1;  3ZMZ B;  1U4Q A;  2QRX A;  3D0T A;  3PU3 A;  4NXN T;  1XNR T;  4CN1 A;  2C0S A;  4B3T T;  1LKX A;  4UF0 A;  2LM2 A;  2W61 A;  3JAF A;  3NVO A;  3ONL C;  2HN2 A;  1FMW A;  2QC1 B;  5CA0 E;  5KX5 E;  4PJL A;  3T1Y T;  1UUR A;  1WLX A;  5HAX A;  4YTN A;  3N9L A;  1H7C A;  2CCQ A;  2WWV A;  1XNQ T;  1FMV A;  3V5S A;  1Z0P A;  2KXP B;  2V6Y A;  2W62 A;  5JDH A;  1HR0 T;  5HXH A;  2WM9 A;  4UV8 B;  2WZY A;  5AQN B;  3RYF E;  1JNR A;  3ZMS B;  3PTR B;  3CQX C;  4DR3 T;  5LYJ E;  4DBM A;  4BQT A;  4PJN A;  1CUN A;  4Z90 A;  3ZJ2 A;  5C2T A;  5CFB A;  3UUM A;  4LF7 T;  4JEH B;  2RP4 A;  5J5I A;  2I0M A;  3QNU A;  1S94 A;  2WSS V;  3I1A A;  5HYA A;  2K5B B;  1I6Z A;  3VU7 H;  4U74 A;  4O2A E;  2P9B A;  3R6N A;  5AFU L;  3RIU A;  1YW0 A;  3ONJ A;  3QB5 K;  5J2U E;  2X51 A;  4YJ2 E;  3IA3 A;  3LDQ B;  3RYH E;  4ZK1 A;  4J2C A;  4YTP A;  4ADZ A;  2BS4 A;  4DBQ A;  4L0R A;  1NEK A;  2ZM2 A;  3AE9 A;  4JI1 T;  1KNP A;  2X67 A;  5IHY A;  3A7M A;  2KIN B;  1MMA A;  1DU2 A;  2ACX A;  5KDM C;  1T8B A;  2BKP A;  4IE4 A;  4I55 E;  4YLH A;  4IDQ A;  4DR4 T;  2XZE A;  5L3G B;  4U2Z A;  2LEH A;  2CE7 A;  4K0U A;  1UGO A;  3MXZ A;  3C50 A;  2HN1 A;  5EK2 A;  2LRL A;  3ZLI A;  5DQV A;  3P8C D;  4PK5 A;  2YOE A;  2LOP A;  2Y48 B;  3HKC E;  4I4T E;  2BYS A;  2FJE A;  1OXZ A;  1G8X A;  2ODV A;  3LBX B;  2UZ6 A;  1IAP A;  4LF4 T;  4G2A A;  5AQL B;  3AE3 A;  2CEA A;  3O4X E;  4LMJ A;  1LVF A;  2ZMA A;  4KBM B;  3EAB A;  2HH7 A;  5M4Y A;  2V26 A;  1YXR A;  3HI2 A;  2ZJU A;  4IDO A;  5JRE A;  3ZC1 A;  4HWC A;  3QUJ A;  3N2O A;  4HN9 A;  5F5W A;  2WS3 A;  3C64 A;  2Y58 A;  5ADX L;  2LKG A;  3AEE A;  2BS2 A;  4UVC B;  5JR9 A;  1XMO T;  4L9I A;  2QA7 A;  3ZST A;  3AE5 A;  1VCS A;  5JDN A;  2LSG A;  3ONX A;  5LBM A;  4U31 A;  2Q9Q B;  3LK2 B;  3SS1 A;  2Y7Y A;  2MYS A;  5LJM A;  4XBF B;  1EZ3 A;  1FIO A;  1WR0 A;  2UXX B;  3QOF A;  3SWH A;  3ZMV B;  4ZK4 A;  4GYS A;  4DND A;  4ZR6 A;  2NTX A;  2EHO D;  3RQU A;  3NWI A;  2XM1 A;  1UV6 A;  4A97 A;  1UK5 A;  3I0Q A;  2DI4 A;  4CZZ B;  4COF A;  4EZ1 A;  2BG9 B;  3KFW X;  2HPJ A;  4H9P C;  3UU4 A;  1N36 T;  4P0A A;  1HG5 A;  3EI0 A;  1BR1 A;  2YN6 A;  4EEB A;  2LKH A;  3DJB A;  2WBL A;  4IST A;  2UU9 T;  1KK7 A;  1LRZ A;  3OKQ A;  1OED B;  3ZC0 A;  1HS7 A;  3SIO A;  2MOZ A;  1BR4 A;  3OPC A;  4WBN E;  5ETW A;  5L3D B;  2LE8 A;  1I9B A;  1QLB A;  2WAU A;  3UU5 A;  1HFA A;  2XQ8 A;  4QX7 B;  3UFE A;  4AFT A;  5C8Y E;  2JQ9 A;  3TLV A;  1KNZ A;  2CHN A;  2CPT A;  4UF0 B;  3C4W A;  1FEW A;  3PMZ A;  3WI3 A;  5LG3 A;  3ABV A;  2MPK A;  1J1J A;  3B5M A;  2IIU A;  2JQK A;  4GKK T;  4B3S T;  4ZI2 D;  3UUB A;  1HNX T;  5LHH B;  2LJL A;  3RC3 A;  4EIW A;  3WIP A;  5JDG A;  1ZOY A;  3MKD A;  2E5L T;  4U72 A;  2Q9Q C;  1UX2 A;  4DV1 T;  5F3J A;  2EHO A;  2L9Q A;  3ZSS A;  4PK6 A;  2DLR A;  4CI1 B;  1KNR A;  4HFH A;  1Y01 A;  4A98 A;  4ZJT A;  4O4J E;  3R84 B;  3RPU A;  3Q5X A;  4QH5 A;  4ZI3 D;  5LP6 E;  4TNW A;  4FRR A;  4IL4 A;  4IL9 A;  4GOU A;  3BQL A;  3ZT6 A;  4FJO A;  5AFM A;  1MIY A;  3FZH B;  4IIJ E;  2A3D A;  2XYS A;  2BG9 C;  3N9O A;  5LHG B;  4ILA A;  4DV4 T;  3RLF F;  5AFH A;  2KLQ A;  3AEB A;  2ZJV A;  4IE6 A;  2D0U A;  4UY2 A;  3O1I A;  5CA1 E;  3LJC A;  5JDM A;  2XM2 A;  2M67 A;  3UUN A;  1NWM X;  2VL0 A;  1OED C;  4QX8 B;  2XAQ B;  4YHJ A;  3PEO A;  5EK4 A;  4KMC A;  4TV9 E;  3NBX X;  4H9S E;  4N78 D;  1WR6 A;  4Z8X A;  4QHO A;  2VWA A;  4U7I A;  4YXD A;  4NXM T;  2NW7 A;  1T98 A;  3HKE E;  4DMV A;  5AQH B;  4O4H E;  4LFC T;  3ZDG A;  4JI5 T;  2YKS A;  4DO0 A;  3SFE A;  4HFV A;  2KT9 A;  5JRC A;  4CQI A;  1E2A A;  4DR5 T;  2VVN A;  2NWB A;  3O1J A;  3SRZ A;  1N32 T;  4WZX A;  4HWF A;  4EZH A;  5LG4 A;  3GUA A;  4F8H A;  3ANW A;  3ZYK A;  4AQY T;  2WU5 A;  2VVS A;  2W8G A;  3ESL A;  4X64 T;  5BR8 T;  3L3P A;  5L4E A;  4IE5 A;  2N9D A;  3AA0 B;  3CX8 B;  3L39 A;  2NTY A;  1S35 A;  4HWD A;  3CQC B;  4YT0 A;  4QWN B;  2YDR A;  5FKY A;  1SA0 E;  1YQ4 A;  3GN5 B;  1SE7 A;  3E22 E;  4HE8 A;  3RRW A;  1T72 A;  4JYA T;  2W66 A;  3T1H T;  4DR6 T;  3VKH A;  3BQI A;  3O1H A;  1HNW T;  3P7I A;  4DMW A;  4AQF A;  1R8I A;  3SQ6 A;  2LSK A;  3O9X A;  4DUZ T;  2XQ6 A;  1YKE B;  5H6R B;  5HWY A;  3ZN0 B;  2BYR A;  2JQQ A;  4LF8 T;  2LSJ A;  2XQ5 A;  4UVB B;  5TVC A;  3FZK B;  2W67 A;  4EYU A;  3AEC A;  3RKG A;  3AAI A;  4ZS3 A;  2WDR A;  4X5T A;  2K9A A;  3ZEF B;  2IUB A;  4DV6 T;  2X9Y A;  3EVY A;  3CML A;  3P50 A;  2WB5 A;  3Q2M A;  3TLS A;  4UVA B;  3HL6 A;  3WTL A;  4X1K E;  4IDN A;  4CN4 A;  4ZJS A;  3SH1 A;  2VL8 A;  2WWU A;  4XZC A;  2BJ0 A;  2MAW A;  1UW6 A;  1KFY A;  2E9X A;  3JAD A;  3K1S A;  4H9O C;  4EAH A;  2W0G A;  5HEO A;  3Q5D A;  2UXC T;  4AQG A;  2PGZ A;  2Y6X A;  3CX6 B;  2BVM A;  4I50 E;  1WRD A;  4PJM A;  2BYN A;  3PE0 A;  4QAC A;  2XZ5 A;  2C5I T;  2WNJ A;  5AQQ B;  1D1A A;  2L8K A;  4CI2 B;  3Q5W A;  3AXJ B;  3FB2 A;  5L4H A;  1VCT A;  4H9R C;  1W0A A;  2BVL A;  4AKI A;  3AE4 A;  3CWZ B;  3PUV F;  3IEE A;  5FVK A;  3CK6 A;  2ODU A;  5HEH A;  2VUR A;  3W15 B;  3EAM A;  5H6Q B;  3AA7 B;  1VOM A;  3H37 A;  4TWD A;  1HG2 A;  1XDP A;  5AQM B;  4B6X A;  4UEM A;  3FZF B;  2JQH A;  2DL1 A;  1UCU A;  3RI5 A;  4WBO A;  3WTK A;  5L3B B;  1XZY A;  4C90 A;  2XAF B;  2IML A;  2NR4 A;  2XAH B;  1YKH B;  4LFA T;  3P4P A;  4IGU A;  4DVD A;  4WV9 A;  3RX6 A;  3AEA A;  3F31 A;  5LCY A;  5BMV E;  2FJB A;  3MA9 A;  3BQK A;  2RA1 A;  4X1Y E;  3UFG A;  2PTF A;  5J2T E;  4ALX A;  4QAB A;  3C4Z A;  2WY2 A;  5KE4 A;  3I0O A;  2FJA A;  3UU3 A;  3N9Q A;  1N34 T;  2LSI A;  3PU8 A;  1HNZ T;  2V7J A;  3SQ9 A;  3P4S A;  3PUY F;  5J0Z A;  1VRB A;  2UXN B;  5LMN T;  4X66 T;  2YMD A;  3ETU A;  4MLK A;  1IJ6 A;  4QH1 A;  3QC9 A;  3OBV E;  1WYB A;  2XUE A;  4ZHQ E;  1J5E T;  5BP0 A;  5JH7 E;  4TX5 A;  5CGM A;  5EK3 A;  2AXD S;  5CO5 A;  1ZHC A;  2YDQ A;  4IE0 A;  4MFR A;  3VRB A;  5JDF A;  3P4R A;  2D0T A;  3UQ7 A;  3JAE A;  3PUZ F;  4HEA A;  2IDO B;  4DBR A;  2XSA A;  1IJ5 A;  5LJN A;  3WTO A;  2Y56 A;  4LF9 T;  2WDV A;  3WTI A;  3RKO A;  4JLE A;  3VRA A;  3JCF A;  4AI6 A;  4X62 T;  5HEG A;  2LSY A;  2WNC A;  3UU8 A;  2XNU A;  4Q25 A;  4YHH T;  3K3N A;  3UTK A;  4NPP A;  4HFD A;  2XSB A;  1XDO A;  4OX9 T;  3AB3 B;  4EED A;  3WAK A;  3LFM A;  5AFN A;  3KV5 A;  2WMN A;  2V7L A;  4AXP A;  3ZDH A;  1D1C A;  3UUX B;  2DWK A;  2UXB T;  3U8J A;  3G06 A;  3FZL B;  4F6R C;  2BKN A;  2C9T A;  2PJQ A;  3Q5E A;  2QYW A;  5AQT B;  2LHN A;  5ABF B;  4A56 A;  4MHC A;  2YK0 A;  5LGT B;  5FXZ A;  3SOL A;  4ILU A;  4LMK A;  5J5H A;  4YSZ A;  5AQU B;  2W8F A;  5AFK A;  4HWI B;  2E8I A;  1L0V A;  4YTM A;  3U8N A;  2LHR A;  2XY8 B;  3ZCJ A;  1ZV4 X;  4YSX A;  3OYZ A;  2J4G A;  3WTH A;  3TLT A;  4HFE A;  5HCJ A;  4HTE A;  4CXW A;  4DV0 T;  1XMQ T;  5HXS A;  4B5D A;  2L3L A;  2D2S A;  3GWH A;  5LHI B;  3HKD E;  5KXJ A;  4D01 A;  3N9P A;  2CWO A;  2MBG A;  2JMH A;  3VKG A;  4NUU A;  1HF8 A;  3RQW A;  2FJD A;  2NP9 A;  2HHH T;  5SYO A;  5LBQ B;  3C51 A;  3FXD B;  5FY7 A;  4TUY E;  4OYJ A;  5J5F A;  1BR0 A;  1HTJ F;  2H7V C;  2VAS A;  4H9Q C;  4YJ3 E;  4BA9 A;  2BR8 A;  1T7S A;  2CBJ A;  3S4U A;  3KVB A;  2WMO A;  1U5P A;  4E7S A;  5GON E;  3PDY A;  3ZCI A;  3KIN B;  5JDL A;  5LA6 E;  2XJ7 A;  5JME A;  3U3I A;  3OTO T;  2UXD T;  2V6Y B;  3ZMU B;  1I94 T;  2PFV A;  3OYX A;  3FBZ A;  4E7Z A;  2BYQ A;  3AA6 B;  2WDQ A;  5LXB A;  4P09 A;  2ES0 A;  2V7K A;  5FL0 A;  1SHZ C;  2WQY A;  3PJA A;  2D5U A;  5AQK B;  5AFL A;  2J47 A; 
#chains in the Genus database with same CATH homology
 5IUX A;  4LMK A;  4UY2 A;  5J5H A;  2BYN A;  4XHE A;  3C79 A;  2W8F A;  2YMD A;  2XNT A;  2ZJU A;  2BYP A;  5AFK A;  4ZZC A;  4QAC A;  3UU5 A;  2Y57 A;  2XQ8 A;  2XZ5 A;  4UM3 A;  4QH1 A;  2XQ7 A;  3TLW A;  2WNJ A;  3U8N A;  4AFT A;  3T4M A;  4HFB A;  3TLV A;  5FJV A;  2VL0 A;  1OED E;  5BW2 A;  4ILB A;  2Y58 A;  1OED C;  2WNL A;  4XK9 A;  2LKG A;  3WTH A;  3U8L A;  5KZU A;  5BP0 A;  3TLT A;  4HFE A;  3RIA A;  5HCJ A;  5L4H A;  3PEO A;  4B5D A;  2KSR A;  4TNV A;  3RHW A;  3U8K A;  4D01 A;  2XQ3 A;  2XQ9 A;  3PMZ A;  3SQ6 A;  5LG3 A;  4ZK1 A;  5L47 A;  5CO5 A;  4IRE A;  4TWH A;  4HQP A;  2X00 D;  2XQ6 A;  3UQ7 A;  5HEH A;  3JAE A;  2XYT A;  2Y7Y A;  2X00 A;  3RQW A;  3EAM A;  2M6B A;  3UQ4 A;  4ZRU A;  2LM2 A;  5SYO A;  4TWD A;  2BYR A;  4UXU A;  3UU6 A;  2M6I A;  3UUB A;  4UM3 S;  2YME A;  4ZK4 A;  3WTO A;  2Y56 A;  3WIP A;  4LML A;  2WN9 A;  3JAF A;  4ZR6 A;  3WTI A;  4HFI A;  2XQ5 A;  3RQU A;  5J5F A;  5TVC A;  3RI5 A;  1UV6 A;  1UX2 A;  4NZB A;  3WTK A;  5HEU A;  2BR8 A;  4A97 A;  2QC1 B;  4Z91 A;  3ZKR A;  5HEG A;  3TLU A;  5J5G A;  3ZDG A;  2XZ6 A;  2BG9 A;  2YKS A;  2WNC A;  3UU8 A;  2XNU A;  4COF A;  4HFC A;  5AIN A;  3WTN A;  3EHZ A;  4X5T A;  2LLY A;  4HFH A;  4NPP A;  4EZ1 A;  4WV9 A;  2BG9 B;  2XQA A;  3P4W A;  4HFD A;  5HCM A;  4A98 A;  3WTM A;  4AFG A;  4ILC A;  4ZJT A;  3GUA A;  3UU4 A;  4F8H A;  3P50 A;  2XQ4 A;  3WTJ A;  5JME A;  3EI0 A;  2YOE A;  2WZY A;  4ALX A;  4QH4 A;  4QAB A;  5BRX A;  2YN6 A;  3TLS A;  4QH5 A;  4UM1 A;  3WTL A;  5AFN A;  4TNW A;  2XNV A;  2PH9 A;  4IL4 A;  4FRR A;  4IL9 A;  4UM3 P;  2LKH A;  2BYS A;  4ZJS A;  3ZDH A;  4DBM A;  3SH1 A;  4BQT A;  3U8J A;  4QAA A;  5KE4 A;  1OED A;  4AFH A;  2BJ0 A;  2W8G A;  3C84 A;  2UZ6 A;  2MAW A;  4TWF A;  1UW6 A;  5AFM A;  2Y54 A;  3JAD A;  3UU3 A;  2BG9 E;  3U8M A;  3IGQ A;  4Z90 A;  2C9T A;  2XYS A;  2BG9 C;  5AFJ A;  3RIF A;  5HEJ A;  4ZZB A;  2BYQ A;  5LXB A;  4ILA A;  5CFB A;  5L4E A;  4PIR A;  4BFQ A;  1OED B;  5HEO A;  5AFM B;  3SIO A;  5J5I A;  2BR7 A;  4LMJ A;  5AFH A;  3SQ9 A;  2PGZ A;  1I9B A;  5J0Z A;  2ZJV A;  5AFL A;  3LSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...