4HFDA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to bromoform
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfdA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfdA01
2KSRA 2BR7A 5IUXA 2XNTA 4EZ1A 3U8LA 3U8MA 2BG9B 4ILBA 4A97A 3U8KA 2XNVA 4XHEA 2XNUA 5J5FA 4ZRUA 2LLYA 4ZZCA 4QAAA 2XQAA 4PIRA 5L4HA 2WNJA 4UM3P 3WTLA 2VL0A 5KE4A 5AFMA 3TLSA 3P50A 2M6IA 5L47A 2X00D 5BP0A 3PMZA 4HFBA 5CFBA 3TLTA 3UUBA 4AFTA 2YMEA 4BFQA 4DBMA 4UM3A 2BJ0A 2YN6A 3P4WA 4ZK4A 4TWDA 5HEHA 4LMJA 4Z90A 5SYOA 5J5IA 2BYRA 3RQUA 4XK9A 3WIPA 4F8HA 2XZ5A 2YOEA 2ZJVA 2PGZA 4ZR6A 4X5TA 4TWHA 5J0ZA 3WTJA 4B5DA 3RQWA 4HQPA 4UY2A 2XYSA 3SQ6A 1UV6A 4ZJTA 2WNLA 4LMKA 4UM1A 1OEDC 3UQ4A 4QABA 5HCJA 5AINA 5BW2A 3RIFA 3WTHA 3WTOA 3ZDGA 4D01A 4WV9A 5LG3A 5AFMB 3WTIA 4QH5A 4AFGA 3SH1A 3ZKRA 3RHWA 2W8FA 1OEDE 4QH4A 2X00A 2BR8A 2XQ7A 3SQ9A 3U8JA 2Y56A 5CO5A 3C84A 2XQ3A 2W8GA 2BYPA 4QACA 3LSVA 3U8NA 2BG9E 3UU6A 4NZBA 4ZK1A 2WN9A 2XQ9A 4NPPA 2MAWA 5HEUA 5HEJA 3GUAA 3ZDHA 2Y7YA 3EAMA 5HCMA 3IGQA 4TWFA 2WNCA 3C79A 1OEDB 1UW6A 2XQ8A 4HFHA 4AFHA 2BG9C 2YMDA 3UU4A 4ILAA 5LXBA 2BYSA 5J5GA 2LKHA 3JAEA 3WTNA 5BRXA 4TNWA 3EHZA 4COFA 2XQ4A 1UX2A 4ZZBA 4UXUA 4LMLA 5HEGA 2XZ6A 3TLVA 2Y57A 2XQ6A 2C9TA 3UU3A 3SIOA 2QC1B 4TNVA 4QH1A 4ZJSA 1OEDA 5L4EA 2PH9A 5KZUA 2ZJUA 2BYQA 3PEOA 2Y58A 4UM3S 4IREA 4HFIA 2BG9A 5AFKA 3RI5A 4IL9A 2UZ6A 3UU5A 5TVCA 4ALXA 2XQ5A 5AFJA 3TLUA 5HEOA 1I9BA 3RIAA 2WZYA 4A98A 4HFEA 5J5HA 3EI0A 4BQTA 4HFCA 4FRRA 2YKSA 2Y54A 4HFDA 5AFLA 4Z91A 5JMEA 3WTKA 2M6BA 3UQ7A 2BYNA 3JADA 2LM2A 5AFNA 3TLWA 3WTMA 5AFHA 2XYTA 2LKGA 4IL4A 3UU8A 3T4MA 5FJVA 3JAFA 4ILCA
chains in the Genus database with same CATH superfamily
4DR5T 3U8LA 3LG7A 3MK7C 4AKLA 4ZRUA 4NUVA 4H9QC 4EZ4A 5HXRA 2Q9QA 4UIGA 3WTLA 4OK0A 5AFMA 2V5CA 5LNKA 1L0VA 4LFAT 3AVRA 3P4WA 3KBUA 4U33A 4MALA 4DUZT 4CXYA 4B5DA 2YINA 3ZJ2A 5L2LA 1IZNB 5AINA 4CXXA 1J1JA 3KVAA 1SUMB 1JNRA 1E7PA 3ZKRA 1MNDA 2JMKA 2W8GA 4QACA 4IT4A 3HKDE 2BVMA 3F57A 4IIJE 2W2UA 2MAWA 2NTYA 3VKHA 2XM1A 4X65T 4AFHA 1UX5A 4ZXLA 3JAEA 2WS3A 4DMWA 2EHOC 2XQ6A 2B76A 2DWKA 2WQYA 4AQFA 3HI2A 3FZHB 4QH1A 5JDMA 5JR9B 4NIQA 4X1IE 3PEOA 4EYYR 2Y58A 2AE9A 4YXDA 4GK5E 5C2TA 4YT0A 4HGAA 4A98A 4HFDA 1I94T 2XAQB 2DHRA 5LA6E 5AFHA 3ZMUB 2D0UA 2C5JA 4KBMB 2YU2A 5JDFA 5LGNB 3ZYMA 4EZ1A 4UVBB 4JUYA 4A97A 2YDSA 2XQAA 2WSSV 4MFRA 4AQYT 3TLTA 3N9OA 2BJ0A 2YN6A 5A1LA 4U7IA 1KNRA 4LMJA 2EHOA 1VCSA 2WU2A 4ISSA 2WZHA 4U2ZA 1AJ3A 2CWOA 3CQGB 4LFBT 4HN9A 4IDZA 5HCJA 4P1NA 3ZCJA 4M1PA 4HWHA 4OYKA 3BQLA 2JRKA 3C84A 2NW7A 2JQKA 3KVBA 4NUUA 3AA0B 2NTXA 4NPPA 2JMHA 5LP6E 1B7TA 1LRZA 2XQ8A 4H9PC 3BQKA 2WCAA 3OKQA 4YFSA 4ZZBA 4ERRA 5FXZA 1MIYA 2X68A 5EK3A 3KV6A 3ETVA 3P4RA 2QVAA 3N2OA 4JBWF 4IE6A 2OV9A 4IL4A 3UU8A 2Q9QB 2BBHA 4P0BA 3P4SA 1IBMT 2HH7A 3ZLIA 4I43B 2HPJA 4AIUA 3CIRA 4QAAA 2VL8A 3OPCA 2E9XB 2X00D 3PMZA 2LEHA 4PK4A 1XDOA 4IE0A 5SYOA 4XK9A 4GOUA 2XYSA 2BKPA 4JI5T 1FMWA 5AQJB 2E9XA 2YDQA 2XQ3A 2RA1A 3VR9A 1WFDA 3UT5E 4ANJA 4EIWA 4TWFA 3GMIA 3Q5WA 1KF6A 1YKHB 4O4HE 3PUSA 3L39A 4UF0B 3RF1A 5JRCA 1X9BA 2QC1B 4L5GA 3I9YA 5C8YE 2J62A 3K8PC 2UXBT 3FZKB 5AFJA 3D0TA 1KK7A 5AQRB 4BA9A 3N9PA 2WWVA 3NWIA 3WTKA 3C98B 1HNWT 4UVAB 2LOSA 1CUNA 5LHGB 2LKGA 2DCFA 3AA1B 2E9XC 4JI3T 4WYVA 5KDMC 1ZOYA 1OXZA 4TV8E 5J5FA 2A3DA 4U72A 1HTJF 4O4JE 4EXTA 4OFZA 4PJNA 1BR0A 3OBVE 2V7LA 5CFBA 1XMQT 3PU3A 5LMNT 3RQUA 4FJOA 2VQET 2LSIA 2BS4A 4X5TA 1IAPA 3SQ6A 5HXEA 1H7CA 2WWUA 4H63V 3CWZB 3WTOA 2CE7A 5LOVE 3Q5EA 3H3AA 2BKOA 3AXJA 4HTEA 1O3XA 1WR0A 4YSYA 2V5DA 2UXCT 1XNQT 4PJJA 2YMDA 4DBRA 3N9QA 4IE7A 5JREA 3WTNA 3AE5A 3AVSA 2PBIA 4H9NC 4YSZA 3RYFE 4B3RT 3PUGA 3SIOA 2L8KA 3UUNA 5LG4A 3SOLA 3RPUA 5JR9A 5AFKA 4ALXA 3ZPOA 1KNPA 3TLUA 4HFEA 4BQTA 3VU7H 5HYAA 4DV4T 4LF8T 2JQHA 2XHEB 3WTMA 3IBPA 5LHIB 2MBGA 4ZS2A 5FVKA 4GYSA 4Q25A 2NR4A 2ODUA 5CA1E 4IE5A 4ILBA 2CXLA 2QRXA 4B3ST 1S35A 4N78D 2UUBT 2KXPB 3LJCA 3AE3A 1MNEA 5DJQC 5LHHB 3TLSA 2YMEA 2LSGA 3AAAB 4Z90A 4MLKA 3O9XA 2SPCA 2W63A 4Z8XA 3UQ4A 2PFVA 3RIFA 5JDLA 3ZDGA 2JQQA 1D0XA 3P4PA 3PTRB 2Y48B 4EYUA 5AFMB 5EZYE 3CPZA 1UGOA 4U31A 1MIWA 2MYSA 2KT9A 2K9AA 3OJAA 2BR8A 4JI8T 3U8JA 4DV0T 4YY3T 3U8NA 2PJQA 2WN9A 2CBIA 2XQ9A 2V7KA 3ZDHA 4TUYE 4JYAT 4FI5A 3AE6A 3UU4A 4L0RA 2X67A 2VVSA 4BJMA 3OYZA 4YHJA 1WLXA 3FXEB 4TNVA 2G0UA 3C64A 2VKDA 2DLRA 2N2NA 3S4UA 1QUUA 2V26A 3B5MA 5F3JA 4ILUA 2W0GA 2HN1A 2QA7A 3KBTA 4HFCA 2YKSA 5J1GA 2W4XA 2W00A 2ZM8A 3JADA 4H9RC 4KX6A 2KWIB 4XBFB 2E8IA 2WMOA 2V6YA 2BR7A 2IC9A 4P0AA 3ZYKA 4L9IA 4WBOA 4YHHT 4U2YA 3FBZA 3KV9A 5HEHA 3PUQA 2H88A 1HF8A 3JC6D 3WTJA 3JCFA 2WNLA 4AQGA 1FEWA 2Z6EA 4QXHB 3MA9A 3N9LA 4AFGA 2VK9A 1D1CA 3F2EA 3UU6A 5AQLB 4LF6T 3NBXX 5HEUA 4JI0T 3GUAA 3AEBA 3NKZA 3HA4A 4QX8B 3G06A 5HXHA 3ZN1B 1U4QA 2Y8DA 5L3GB 4X20E 3R84B 2YU1A 5DQVA 3HKBE 5LBQB 4DR7T 2IUBA 3EUHA 4ZOLE 2BYQA 2V7MA 4AISA 2CPTA 4OYJA 3FZFB 2W66A 3RIAA 4DR1T 2VWAA 3MACA 4EB6E 4YTMA 3SRZA 5JMEA 3AE9A 2H3RA 2LM2A 3B57A 1IBKT 5J2TE 3AEAA 2ACXA 2B1EA 1XDPA 2LRLA 3U8MA 2IIUA 4PIRA 5ABFB 4AI6A 1HS7A 1X79A 2QYWA 4ZK4A 2C5IT 4TWDA 3T1HT 2DNXA 4TWHA 3RIUC 4UY2A 1G8XA 1Z8UA 2L3LA 5FVLA 2V6YB 2CWYA 3Q2MA 5AQTB 4UM1A 4QABA 3QNUA 2AXDS 2OLTA 1NENA 4WBNE 2LSJA 2ZMAA 2ZM0A 3NVOA 2JJ9A 3ZSTA 3Q5XA 3I9WA 5AQOB 3AA6B 3SH1A 2W8FA 2X9XA 3Q5DA 4NZBA 5M4YA 4U74A 4PJLA 2GK9A 1ZEEA 5DABA 3L09A 1W09A 3TKLB 1D1AA 5LXBA 3L8RA 4TNWA 5CB4E 4C91A 5KXJA 1Y01A 5KMGP 3CK6A 2Q9QC 3OYXA 5CGMA 1E1HB 1HFAA 3SFDA 5KX5E 5LCYA 1MMDA 3RIUA 4YSXA 1XMOT 3U3IA 3M3ZB 5L3CB 2N9DA 3T4MA 1UX4A 3RX6A 4DBQA 4YLHA 4HWIB 2XSBA 2UXNB 5LXTE 5L4HA 2VL0A 2X51A 3ZN0B 2JQ9A 2PTFA 4QXCB 4XAXB 2VASA 3ANWB 1T7SA 2XAGB 3J9X1 2BYRA 2ZJVA 2WU5A 1SHZC 2LRKA 2IDOB 4ISTA 2XJ7A 3RRWA 2FJDA 1DU2A 4LMKA 4DVDA 3WAJA 2H7OA 2HN2A 1MMGA 3FB2A 4UF0A 2CHNA 3FXDB 3JC6C 4PK6A 3MJXA 4QKNA 2BG9E 3E08A 5JDGA 5HEJA 2DWGA 3RH3A 5HCMA 3PUWF 3ZMTB 2L9QA 3QUJA 4DV7T 2BG9C 2KLQA 5L3FB 2EHOB 5IHYA 5BRXA 4GIWA 4COFA 4AKIA 1NEKA 1YW0A 3RYHE 2WY2A 2C9TA 2D2SA 1KNZA 1OEDA 2KZ7B 5L4EA 5KZUA 5IWAT 2ZJUA 4ADZA 4IREA 2FBWA 3RI5A 5BR8T 5LBMA 4C90A 3E22E 2FUPA 2XUEA 2Y54A 4JEHB 2LM9A 2M6BA 4ZI2D 2LJLA 4A5XA 3AAEB 2IHR1 3R6NA 4AKGA 4H9OC 5JR9C 4OX9T 1MIVA 5LMUT 3O1JA 3IHRA 2XNUA 4ASKA 4DIDB 1EZ3A 3EDUA 2E2AA 2BZBA 2WNJA 3ZC0A 5JDQA 3P50A 1US7B 3C4WA 3K1SA 2IW5B 4AKHA 3WIPA 4EAHA 2CXFA 2PGZA 4NXNT 5J0ZA 3PUVF 5L3BB 1UV6A 2W67A 5JDHA 4O2AE 1OEDC 2KINB 5BW2A 2DL1A 4ZI3D 1MMNA 1HNXT 5HXSA 2V8SV 1UCUA 5LG3A 3AE7A 3ZT7A 5LJMA 3BQIA 4PNIA 2W61A 2P9BA 2X9YA 2NOXA 4ZEYA 4ZK1A 3H3MA 3RGLA 2WNCA 1I6ZA 1WRDA 4ILAA 5JRCB 3PJAA 2IMLA 2RP4A 2XQ4A 1J5WA 2XAFB 2YEVC 4ZI3C 3PU8A 5AQVB 2YDRA 2CA5A 3CMLA 2KNDA 4UR9A 4ZJSA 5BMVE 4PFOA 3EABA 1XWMA 2WDVA 5AQPB 3AEEA 4UV9B 5AFUL 4FRRA 4JI6T 3OVUA 5AFNA 2M67A 3P8CD 4GKKT 4DV3T 1HG2A 5IUXA 2VKJA 3A8YC 4CI1B 3V5SA 4XHEA 2VURA 4ZZCA 2WBLA 4PK5A 5LB7B 3SFEA 4UM3P 4X1KE 1J5ET 5BP0A 2V7IA 3UUBA 3N9MA 2D0TA 4UM3A 2W62A 4HWFA 4ZR6A 1SA0E 2WM9A 3O4XE 4X1YE 1HCIA 5ETWA 3BK9A 2NWBA 4KHPT 2E5LT 4JV5T 1ZHCA 4QH5A 2WMNA 3I0QA 3MZKB 4QH4A 2FJAA 1QSDA 5AQQB 3KFWX 4JEUB 5IYZE 4XZCA 2VKOA 2VVNA 4IDQA 5CA0E 2YK0A 1VCTA 2NW9A 2LHRA 2WDQA 2BYSA 3ANWA 3AEFA 4K0UA 4LMLA 1IBLT 3RLFF 3FBLA 4AKRB 2Y57A 3P7IA 5LGTB 3NRXA 3DJBA 2A2FX 3O1IA 1VOMA 1VRBA 4IL9A 4F6RC 5AQGB 2UXDT 5TVCA 5TAOA 2CXDA 3A5XA 2N1GA 3T8OA 3E0ZA 3H37A 4DV5T 1FMVA 5FNVE 1Y64B 4CN4A 3AE4A 3QB5K 5AQUB 1WYBA 1IJ5A 4NXMT 4EV6A 3KV4A 3C51A 4QXBB 5KE4A 1JNZA 3LBXB 5L47A 4CZZB 2QGSA 4H63H 2MTQA 4G2AA 4JI4T 2XY8B 1BR4A 1WCRA 2YOEA 4PAGA 4I55E 4GK0E 5L3EB 4EEDA 4GYRA 3CX6B 1YQ3A 4D01A 2A72A 1IJ6A 4A56A 3LDQB 2XQ7A 1XZYA 4X62T 1T72A 3LSVA 3FZLB 2HHHT 4IGUA 5LGUB 2X9HA 3HR0A 4O4LE 4U3CA 2Y7YA 2KMFA 3IGQA 1UW6A 4HFHA 2BVLA 2BS2A 4IHJE 4JLEA 1BR2A 3EHZA 3CQXC 4K0KT 3I1AA 3ZT5A 3ZCIA 2Y6XA 3TLVA 3UU3A 2I0MA 3PJAJ 5JTGA 5L3DB 3HKCE 3A7MA 3AEDA 2PH9A 3UUMA 3ZYLA 5FY0A 5JDNA 4DR4T 2MOZA 2XQ5A 4LF5T 3HL6A 2XASB 2VKHA 3NZPA 2F4VT 5FKYA 1D0ZA 4Z91A 4DMVA 2XQYA 1UK5A 1YQ4A 5FJVA 3QC9A 5ADXL 2KSRA 3ESLA 5J2UE 3N9NA 4E7ZA 3ZJ1A 3GN5A 3UFGA 4I4TE 2K24A 2LT3A 4YTNA 1LVFA 2CLYB 2M6IA 1HX1B 1NWMX 2ACZA 3P4QA 1M7KA 1MMAA 1LVKA 3LK2B 2UU9T 4UXNB 4V1Av 1N32T 1WYCA 3X1DA 4CN1A 4IE4A 1OEDE 4EOZB 2XPKA 3NRYA 4TZ4C 3RYIE 1OWAA 2CMRA 4YTPA 4PW8A 3C79A 1OEDB 1HX8A 5JH7E 4U7YA 4CN6A 3IA3A 1KEYA 3UFEA 3PUAA 3VHLA 4PJMA 1T8BA 2XTLA 2A9UA 4HFIA 2BG9A 2UUAT 3EVYA 4HEAA 2UZ6A 2WZIA 2WZYA 1QLBA 4OHFA 5J5HA 1XNRT 4DO0A 3PDYA 4LF4T 3ZC1A 4KI0F 2VQFT 3RKOA 5AQMB 4O8SA 2LLYA 2K5BB 4I50E 4HE8A 3ZSSA 4JI1T 2ES0A 4AFTA 4BFQA 3F31A 3UUXB 1ZV4X 3WI3A 3WAKA 4DBMA 3M65A 4B6XA 4MBQA 5J5IA 1KFYA 3PUXF 2LE8A 3RQWA 2CM0A 1V9DA 5HXCA 3CVRA 3WTHA 4J2CA 4WV9A 1SE7A 4DR6T 3GA8A 3RKGA 5AQSB 2CRBA 3RHWA 3GWHA 5FXVA 5CO5A 3NZQA 2JIWA 4I0UA 2CCQA 4DR3T 2BKNA 3SWHA 5J5GA 4QHOA 4DV1T 2C5KT 4B3TT 5HEGA 2KWHA 3PE0A 3LFMA 4UEMA 3FHNA 5FYMA 5AQFB 3DP7A 5HWYA 3IEEA 4G63A 4ZI7E 2VB6A 1HG5A 4QX7B 2V1DB 1LKXA 2ZLYA 3EI0A 2ODVA 5HAXA 1E2AA 3MXZA 3VRBA 5H6QB 3CX8B 5LJNA 2D5UA 3TLWA 2XYTA 1W0AA 4CI3B 2C0SA 3JAFA 2K48A 1W0BA 4KMCA 5AQIB 2E5VA 2BG9B 2XNVA 1G73A 3CX7B 5JQGE 2HPLA 2BDEA 2E9XD 1UUSA 3KV5A 3AE8A 4LF7T 3N5LA 1D0YA 3ONLC 4P09A 5EK4A 4LF9T 3T1YT 3Q9DA 3FZMB 4F8HA 4YJ3E 1U5PA 2WB5A 2XSAA 3ONXA 3O1HA 2UXXB 2V7JA 3ETUA 2LHNA 3RC3A 3AAIA 3UTKA 5H6RB 5C3JA 4UELA 2K3WA 3LK3B 1S94A 3ZT6A 2OA5A 2J1DG 4TX5A 3ABVA 3RRCA 4BJNA 4HWCA 4EEBA 2CLYC 2X66A 3CKDA 2ZM6T 2XAJB 4CXWA 3I0OA 3MKDA 4AQFC 3K3OA 4BAYB 4HWDA 4UV8B 2WDRA 2XZEA 2H89A 5F5WA 3AA7B 3U78A 2BS3A 1N36T 1W9RA 3VRAA 4DNDA 4UM3S 3L3PA 4ZI2C 5ABHA 1FJGT 2X9WA 2IAKA 3K3NA 5HEOA 4ZHQE 3AB3B 3EDVA 1CHUA 1N34T 4GKJT 4UVCB 2X0LB 3N2GE 2IC6A 2XM2A 3C4ZA 3N2KE 4KUMB 2CBJA 2XNTA 5ABGA 2LSYA 2H7VC 5FL0A 2NW8A 3K3QC 5DQWA 2PG8A 5FP3A 1YXRA 2XZ5A 2DI4A 4HQPA 4DV2T 4WW0A 3IF8B 2I59A 5CJ5A 3VR8A 3V5UA 1M62A 1HR0T 1BR1A 5ABFA 4EGWA 3QB5A 4WZXA 5FY1A 2Y56A 2Q9QD 5EK2A 3AE1A 2CEAA 4KP3C 2BYPA 2EHOD 3EAMA 4B3MT 3KINB 2JPFA 3AXJB 1YD8G 5AQNB 4DUYT 2LKHA 4UXUA 2MPKA 1Z0PA 2XZ6A 2J4GA 5FXWA 3RYCE 4O4IE 3RC8A 2FJBA 2NP9A 3W15B 3UULA 3HKEE 4JI2T 1I9BA 3ZMVB 4DV6T 2X0YA 3VKGA 5AFLA 2WP9A 4WNKA 1UURA 3ZEFB 3UQ7A 2BYNA 4CQIA 3GN5B 4ILCA 4KHZF 5FL1A 4AXPA 3PURA 3B13A 3J7Yq 1N33T 5FY7A 3U8KA 2LSKA 1YKEB 3C4XA 1R8IA 3PV0F 4HFBA 5FXXA 3LK42 4LFCT 3AECA 4X66T 5LYJE 4IDPA 4QWNB 5HWXA 3QK6A 2RPAA 4MHCA 4DR2T 1T98A 4IDOA 4TV9E 5GONE 2FJEA 4HKAA 3SS1A 4ZJTA 4CI2B 5AQKB 4TN7B 2LOPA 3WTIA 3ONJA 2X00A 3SQ9A 4YJ2E 4H9SE 3QOFA 5E0OA 1GQEA 1ZP0A 3AEGA 1HNZT 2X0HA 3AE2A 5FMNA 2UUCT 4ZS3A 3C50A 4O2BE 4EZHA 3KDSE 2J47A 3CQCB 1UX2A 2D9DA 4JI7T 3PUYF 5F8PA 1FIOA 2CHOA 2I6HA 3DTOA 2BBJA 1D1BA 3UU5A 4X64T 4IDNA 3ZMSB 5AQHB 2V6XA 2WAUA 2R6GF 2XAHB 1ZKEA 4PFPA 1WR6A 3LBXA 3ZMZB 2ZM2A 3PUZF 5ABEA 3OTOT 4HFVA 1NAFA 4E7SA 5JVDE
chains in the Genus database with same CATH topology
2KSRA 2BR7A 5IUXA 2XNTA 4EZ1A 3U8LA 3U8MA 2BG9B 4ILBA 4A97A 3U8KA 2XNVA 4XHEA 2XNUA 5J5FA 4ZRUA 2LLYA 4ZZCA 4QAAA 2XQAA 4PIRA 5L4HA 2WNJA 4UM3P 3WTLA 2VL0A 5KE4A 5AFMA 3TLSA 3P50A 2M6IA 5L47A 2X00D 5BP0A 3PMZA 4HFBA 5CFBA 3TLTA 3UUBA 4AFTA 2YMEA 4BFQA 4DBMA 4UM3A 2BJ0A 2YN6A 3P4WA 4ZK4A 4TWDA 5HEHA 4LMJA 4Z90A 5SYOA 5J5IA 2BYRA 3RQUA 4XK9A 3WIPA 4F8HA 2XZ5A 2YOEA 2ZJVA 2PGZA 4ZR6A 4X5TA 4TWHA 5J0ZA 3WTJA 4B5DA 3RQWA 4HQPA 4UY2A 2XYSA 3SQ6A 1UV6A 4ZJTA 2WNLA 4LMKA 4UM1A 1OEDC 3UQ4A 4QABA 5HCJA 5AINA 5BW2A 3RIFA 3WTHA 3WTOA 3ZDGA 4D01A 4WV9A 5LG3A 5AFMB 3WTIA 4QH5A 4AFGA 3SH1A 3ZKRA 3RHWA 2W8FA 1OEDE 4QH4A 2X00A 2BR8A 2XQ7A 3SQ9A 3U8JA 2Y56A 5CO5A 3C84A 2XQ3A 2W8GA 2BYPA 4QACA 3LSVA 3U8NA 2BG9E 3UU6A 4NZBA 4ZK1A 2WN9A 2XQ9A 4NPPA 2MAWA 5HEUA 5HEJA 3GUAA 3ZDHA 2Y7YA 3EAMA 5HCMA 3IGQA 4TWFA 2WNCA 3C79A 1OEDB 1UW6A 2XQ8A 4HFHA 4AFHA 2BG9C 2YMDA 3UU4A 4ILAA 5LXBA 2BYSA 5J5GA 2LKHA 3JAEA 3WTNA 5BRXA 4TNWA 3EHZA 4COFA 2XQ4A 1UX2A 4ZZBA 4UXUA 4LMLA 5HEGA 2XZ6A 3TLVA 2Y57A 2XQ6A 2C9TA 3UU3A 3SIOA 2QC1B 4TNVA 4QH1A 4ZJSA 1OEDA 5L4EA 2PH9A 5KZUA 2ZJUA 2BYQA 3PEOA 2Y58A 4UM3S 4IREA 4HFIA 2BG9A 5AFKA 3RI5A 4IL9A 2UZ6A 3UU5A 5TVCA 4ALXA 2XQ5A 5AFJA 3TLUA 5HEOA 1I9BA 3RIAA 2WZYA 4A98A 4HFEA 5J5HA 3EI0A 4BQTA 4HFCA 4FRRA 2YKSA 2Y54A 4HFDA 5AFLA 4Z91A 5JMEA 3WTKA 2M6BA 3UQ7A 2BYNA 3JADA 2LM2A 5AFNA 3TLWA 3WTMA 5AFHA 2XYTA 2LKGA 4IL4A 3UU8A 3T4MA 5FJVA 3JAFA 4ILCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSR A;  2BR7 A;  5IUX A;  2XNT A;  4EZ1 A;  3U8L A;  3U8M A;  2BG9 B;  4ILB A;  4A97 A;  3U8K A;  2XNV A;  4XHE A;  2XNU A;  5J5F A;  4ZRU A;  2LLY A;  4ZZC A;  4QAA A;  2XQA A;  4PIR A;  5L4H A;  2WNJ A;  4UM3 P;  3WTL A;  2VL0 A;  5KE4 A;  5AFM A;  3TLS A;  3P50 A;  2M6I A;  5L47 A;  2X00 D;  5BP0 A;  3PMZ A;  4HFB A;  5CFB A;  3TLT A;  3UUB A;  4AFT A;  2YME A;  4BFQ A;  4DBM A;  4UM3 A;  2BJ0 A;  2YN6 A;  3P4W A;  4ZK4 A;  4TWD A;  5HEH A;  4LMJ A;  4Z90 A;  5SYO A;  5J5I A;  2BYR A;  3RQU A;  4XK9 A;  3WIP A;  4F8H A;  2XZ5 A;  2YOE A;  2ZJV A;  2PGZ A;  4ZR6 A;  4X5T A;  4TWH A;  5J0Z A;  3WTJ A;  4B5D A;  3RQW A;  4HQP A;  4UY2 A;  2XYS A;  3SQ6 A;  1UV6 A;  4ZJT A;  2WNL A;  4LMK A;  4UM1 A;  1OED C;  3UQ4 A;  4QAB A;  5HCJ A;  5AIN A;  5BW2 A;  3RIF A;  3WTH A;  3WTO A;  3ZDG A;  4D01 A;  4WV9 A;  5LG3 A;  5AFM B;  3WTI A;  4QH5 A;  4AFG A;  3SH1 A;  3ZKR A;  3RHW A;  2W8F A;  1OED E;  4QH4 A;  2X00 A;  2BR8 A;  2XQ7 A;  3SQ9 A;  3U8J A;  2Y56 A;  5CO5 A;  3C84 A;  2XQ3 A;  2W8G A;  2BYP A;  4QAC A;  3LSV A;  3U8N A;  2BG9 E;  3UU6 A;  4NZB A;  4ZK1 A;  2WN9 A;  2XQ9 A;  4NPP A;  2MAW A;  5HEU A;  5HEJ A;  3GUA A;  3ZDH A;  2Y7Y A;  3EAM A;  5HCM A;  3IGQ A;  4TWF A;  2WNC A;  3C79 A;  1OED B;  1UW6 A;  2XQ8 A;  4HFH A;  4AFH A;  2BG9 C;  2YMD A;  3UU4 A;  4ILA A;  5LXB A;  2BYS A;  5J5G A;  2LKH A;  3JAE A;  3WTN A;  5BRX A;  4TNW A;  3EHZ A;  4COF A;  2XQ4 A;  1UX2 A;  4ZZB A;  4UXU A;  4LML A;  5HEG A;  2XZ6 A;  3TLV A;  2Y57 A;  2XQ6 A;  2C9T A;  3UU3 A;  3SIO A;  2QC1 B;  4TNV A;  4QH1 A;  4ZJS A;  1OED A;  5L4E A;  2PH9 A;  5KZU A;  2ZJU A;  2BYQ A;  3PEO A;  2Y58 A;  4UM3 S;  4IRE A;  4HFI A;  2BG9 A;  5AFK A;  3RI5 A;  4IL9 A;  2UZ6 A;  3UU5 A;  5TVC A;  4ALX A;  2XQ5 A;  5AFJ A;  3TLU A;  5HEO A;  1I9B A;  3RIA A;  2WZY A;  4A98 A;  4HFE A;  5J5H A;  3EI0 A;  4BQT A;  4HFC A;  4FRR A;  2YKS A;  2Y54 A;  4HFD A;  5AFL A;  4Z91 A;  5JME A;  3WTK A;  2M6B A;  3UQ7 A;  2BYN A;  3JAD A;  2LM2 A;  5AFN A;  3TLW A;  3WTM A;  5AFH A;  2XYT A;  2LKG A;  4IL4 A;  3UU8 A;  3T4M A;  5FJV A;  3JAF A;  4ILC A; 
#chains in the Genus database with same CATH topology
 4DR5 T;  3U8L A;  3LG7 A;  3MK7 C;  4AKL A;  4ZRU A;  4NUV A;  4H9Q C;  4EZ4 A;  5HXR A;  2Q9Q A;  4UIG A;  3WTL A;  4OK0 A;  5AFM A;  2V5C A;  5LNK A;  1L0V A;  4LFA T;  3AVR A;  3P4W A;  3KBU A;  4U33 A;  4MAL A;  4DUZ T;  4CXY A;  4B5D A;  2YIN A;  3ZJ2 A;  5L2L A;  1IZN B;  5AIN A;  4CXX A;  1J1J A;  3KVA A;  1SUM B;  1JNR A;  1E7P A;  3ZKR A;  1MND A;  2JMK A;  2W8G A;  4QAC A;  4IT4 A;  3HKD E;  2BVM A;  3F57 A;  4IIJ E;  2W2U A;  2MAW A;  2NTY A;  3VKH A;  2XM1 A;  4X65 T;  4AFH A;  1UX5 A;  4ZXL A;  3JAE A;  2WS3 A;  4DMW A;  2EHO C;  2XQ6 A;  2B76 A;  2DWK A;  2WQY A;  4AQF A;  3HI2 A;  3FZH B;  4QH1 A;  5JDM A;  5JR9 B;  4NIQ A;  4X1I E;  3PEO A;  4EYY R;  2Y58 A;  2AE9 A;  4YXD A;  4GK5 E;  5C2T A;  4YT0 A;  4HGA A;  4A98 A;  4HFD A;  1I94 T;  2XAQ B;  2DHR A;  5LA6 E;  5AFH A;  3ZMU B;  2D0U A;  2C5J A;  4KBM B;  2YU2 A;  5JDF A;  5LGN B;  3ZYM A;  4EZ1 A;  4UVB B;  4JUY A;  4A97 A;  2YDS A;  2XQA A;  2WSS V;  4MFR A;  4AQY T;  3TLT A;  3N9O A;  2BJ0 A;  2YN6 A;  5A1L A;  4U7I A;  1KNR A;  4LMJ A;  2EHO A;  1VCS A;  2WU2 A;  4ISS A;  2WZH A;  4U2Z A;  1AJ3 A;  2CWO A;  3CQG B;  4LFB T;  4HN9 A;  4IDZ A;  5HCJ A;  4P1N A;  3ZCJ A;  4M1P A;  4HWH A;  4OYK A;  3BQL A;  2JRK A;  3C84 A;  2NW7 A;  2JQK A;  3KVB A;  4NUU A;  3AA0 B;  2NTX A;  4NPP A;  2JMH A;  5LP6 E;  1B7T A;  1LRZ A;  2XQ8 A;  4H9P C;  3BQK A;  2WCA A;  3OKQ A;  4YFS A;  4ZZB A;  4ERR A;  5FXZ A;  1MIY A;  2X68 A;  5EK3 A;  3KV6 A;  3ETV A;  3P4R A;  2QVA A;  3N2O A;  4JBW F;  4IE6 A;  2OV9 A;  4IL4 A;  3UU8 A;  2Q9Q B;  2BBH A;  4P0B A;  3P4S A;  1IBM T;  2HH7 A;  3ZLI A;  4I43 B;  2HPJ A;  4AIU A;  3CIR A;  4QAA A;  2VL8 A;  3OPC A;  2E9X B;  2X00 D;  3PMZ A;  2LEH A;  4PK4 A;  1XDO A;  4IE0 A;  5SYO A;  4XK9 A;  4GOU A;  2XYS A;  2BKP A;  4JI5 T;  1FMW A;  5AQJ B;  2E9X A;  2YDQ A;  2XQ3 A;  2RA1 A;  3VR9 A;  1WFD A;  3UT5 E;  4ANJ A;  4EIW A;  4TWF A;  3GMI A;  3Q5W A;  1KF6 A;  1YKH B;  4O4H E;  3PUS A;  3L39 A;  4UF0 B;  3RF1 A;  5JRC A;  1X9B A;  2QC1 B;  4L5G A;  3I9Y A;  5C8Y E;  2J62 A;  3K8P C;  2UXB T;  3FZK B;  5AFJ A;  3D0T A;  1KK7 A;  5AQR B;  4BA9 A;  3N9P A;  2WWV A;  3NWI A;  3WTK A;  3C98 B;  1HNW T;  4UVA B;  2LOS A;  1CUN A;  5LHG B;  2LKG A;  2DCF A;  3AA1 B;  2E9X C;  4JI3 T;  4WYV A;  5KDM C;  1ZOY A;  1OXZ A;  4TV8 E;  5J5F A;  2A3D A;  4U72 A;  1HTJ F;  4O4J E;  4EXT A;  4OFZ A;  4PJN A;  1BR0 A;  3OBV E;  2V7L A;  5CFB A;  1XMQ T;  3PU3 A;  5LMN T;  3RQU A;  4FJO A;  2VQE T;  2LSI A;  2BS4 A;  4X5T A;  1IAP A;  3SQ6 A;  5HXE A;  1H7C A;  2WWU A;  4H63 V;  3CWZ B;  3WTO A;  2CE7 A;  5LOV E;  3Q5E A;  3H3A A;  2BKO A;  3AXJ A;  4HTE A;  1O3X A;  1WR0 A;  4YSY A;  2V5D A;  2UXC T;  1XNQ T;  4PJJ A;  2YMD A;  4DBR A;  3N9Q A;  4IE7 A;  5JRE A;  3WTN A;  3AE5 A;  3AVS A;  2PBI A;  4H9N C;  4YSZ A;  3RYF E;  4B3R T;  3PUG A;  3SIO A;  2L8K A;  3UUN A;  5LG4 A;  3SOL A;  3RPU A;  5JR9 A;  5AFK A;  4ALX A;  3ZPO A;  1KNP A;  3TLU A;  4HFE A;  4BQT A;  3VU7 H;  5HYA A;  4DV4 T;  4LF8 T;  2JQH A;  2XHE B;  3WTM A;  3IBP A;  5LHI B;  2MBG A;  4ZS2 A;  5FVK A;  4GYS A;  4Q25 A;  2NR4 A;  2ODU A;  5CA1 E;  4IE5 A;  4ILB A;  2CXL A;  2QRX A;  4B3S T;  1S35 A;  4N78 D;  2UUB T;  2KXP B;  3LJC A;  3AE3 A;  1MNE A;  5DJQ C;  5LHH B;  3TLS A;  2YME A;  2LSG A;  3AAA B;  4Z90 A;  4MLK A;  3O9X A;  2SPC A;  2W63 A;  4Z8X A;  3UQ4 A;  2PFV A;  3RIF A;  5JDL A;  3ZDG A;  2JQQ A;  1D0X A;  3P4P A;  3PTR B;  2Y48 B;  4EYU A;  5AFM B;  5EZY E;  3CPZ A;  1UGO A;  4U31 A;  1MIW A;  2MYS A;  2KT9 A;  2K9A A;  3OJA A;  2BR8 A;  4JI8 T;  3U8J A;  4DV0 T;  4YY3 T;  3U8N A;  2PJQ A;  2WN9 A;  2CBI A;  2XQ9 A;  2V7K A;  3ZDH A;  4TUY E;  4JYA T;  4FI5 A;  3AE6 A;  3UU4 A;  4L0R A;  2X67 A;  2VVS A;  4BJM A;  3OYZ A;  4YHJ A;  1WLX A;  3FXE B;  4TNV A;  2G0U A;  3C64 A;  2VKD A;  2DLR A;  2N2N A;  3S4U A;  1QUU A;  2V26 A;  3B5M A;  5F3J A;  4ILU A;  2W0G A;  2HN1 A;  2QA7 A;  3KBT A;  4HFC A;  2YKS A;  5J1G A;  2W4X A;  2W00 A;  2ZM8 A;  3JAD A;  4H9R C;  4KX6 A;  2KWI B;  4XBF B;  2E8I A;  2WMO A;  2V6Y A;  2BR7 A;  2IC9 A;  4P0A A;  3ZYK A;  4L9I A;  4WBO A;  4YHH T;  4U2Y A;  3FBZ A;  3KV9 A;  5HEH A;  3PUQ A;  2H88 A;  1HF8 A;  3JC6 D;  3WTJ A;  3JCF A;  2WNL A;  4AQG A;  1FEW A;  2Z6E A;  4QXH B;  3MA9 A;  3N9L A;  4AFG A;  2VK9 A;  1D1C A;  3F2E A;  3UU6 A;  5AQL B;  4LF6 T;  3NBX X;  5HEU A;  4JI0 T;  3GUA A;  3AEB A;  3NKZ A;  3HA4 A;  4QX8 B;  3G06 A;  5HXH A;  3ZN1 B;  1U4Q A;  2Y8D A;  5L3G B;  4X20 E;  3R84 B;  2YU1 A;  5DQV A;  3HKB E;  5LBQ B;  4DR7 T;  2IUB A;  3EUH A;  4ZOL E;  2BYQ A;  2V7M A;  4AIS A;  2CPT A;  4OYJ A;  3FZF B;  2W66 A;  3RIA A;  4DR1 T;  2VWA A;  3MAC A;  4EB6 E;  4YTM A;  3SRZ A;  5JME A;  3AE9 A;  2H3R A;  2LM2 A;  3B57 A;  1IBK T;  5J2T E;  3AEA A;  2ACX A;  2B1E A;  1XDP A;  2LRL A;  3U8M A;  2IIU A;  4PIR A;  5ABF B;  4AI6 A;  1HS7 A;  1X79 A;  2QYW A;  4ZK4 A;  2C5I T;  4TWD A;  3T1H T;  2DNX A;  4TWH A;  3RIU C;  4UY2 A;  1G8X A;  1Z8U A;  2L3L A;  5FVL A;  2V6Y B;  2CWY A;  3Q2M A;  5AQT B;  4UM1 A;  4QAB A;  3QNU A;  2AXD S;  2OLT A;  1NEN A;  4WBN E;  2LSJ A;  2ZMA A;  2ZM0 A;  3NVO A;  2JJ9 A;  3ZST A;  3Q5X A;  3I9W A;  5AQO B;  3AA6 B;  3SH1 A;  2W8F A;  2X9X A;  3Q5D A;  4NZB A;  5M4Y A;  4U74 A;  4PJL A;  2GK9 A;  1ZEE A;  5DAB A;  3L09 A;  1W09 A;  3TKL B;  1D1A A;  5LXB A;  3L8R A;  4TNW A;  5CB4 E;  4C91 A;  5KXJ A;  1Y01 A;  5KMG P;  3CK6 A;  2Q9Q C;  3OYX A;  5CGM A;  1E1H B;  1HFA A;  3SFD A;  5KX5 E;  5LCY A;  1MMD A;  3RIU A;  4YSX A;  1XMO T;  3U3I A;  3M3Z B;  5L3C B;  2N9D A;  3T4M A;  1UX4 A;  3RX6 A;  4DBQ A;  4YLH A;  4HWI B;  2XSB A;  2UXN B;  5LXT E;  5L4H A;  2VL0 A;  2X51 A;  3ZN0 B;  2JQ9 A;  2PTF A;  4QXC B;  4XAX B;  2VAS A;  3ANW B;  1T7S A;  2XAG B;  3J9X 1;  2BYR A;  2ZJV A;  2WU5 A;  1SHZ C;  2LRK A;  2IDO B;  4IST A;  2XJ7 A;  3RRW A;  2FJD A;  1DU2 A;  4LMK A;  4DVD A;  3WAJ A;  2H7O A;  2HN2 A;  1MMG A;  3FB2 A;  4UF0 A;  2CHN A;  3FXD B;  3JC6 C;  4PK6 A;  3MJX A;  4QKN A;  2BG9 E;  3E08 A;  5JDG A;  5HEJ A;  2DWG A;  3RH3 A;  5HCM A;  3PUW F;  3ZMT B;  2L9Q A;  3QUJ A;  4DV7 T;  2BG9 C;  2KLQ A;  5L3F B;  2EHO B;  5IHY A;  5BRX A;  4GIW A;  4COF A;  4AKI A;  1NEK A;  1YW0 A;  3RYH E;  2WY2 A;  2C9T A;  2D2S A;  1KNZ A;  1OED A;  2KZ7 B;  5L4E A;  5KZU A;  5IWA T;  2ZJU A;  4ADZ A;  4IRE A;  2FBW A;  3RI5 A;  5BR8 T;  5LBM A;  4C90 A;  3E22 E;  2FUP A;  2XUE A;  2Y54 A;  4JEH B;  2LM9 A;  2M6B A;  4ZI2 D;  2LJL A;  4A5X A;  3AAE B;  2IHR 1;  3R6N A;  4AKG A;  4H9O C;  5JR9 C;  4OX9 T;  1MIV A;  5LMU T;  3O1J A;  3IHR A;  2XNU A;  4ASK A;  4DID B;  1EZ3 A;  3EDU A;  2E2A A;  2BZB A;  2WNJ A;  3ZC0 A;  5JDQ A;  3P50 A;  1US7 B;  3C4W A;  3K1S A;  2IW5 B;  4AKH A;  3WIP A;  4EAH A;  2CXF A;  2PGZ A;  4NXN T;  5J0Z A;  3PUV F;  5L3B B;  1UV6 A;  2W67 A;  5JDH A;  4O2A E;  1OED C;  2KIN B;  5BW2 A;  2DL1 A;  4ZI3 D;  1MMN A;  1HNX T;  5HXS A;  2V8S V;  1UCU A;  5LG3 A;  3AE7 A;  3ZT7 A;  5LJM A;  3BQI A;  4PNI A;  2W61 A;  2P9B A;  2X9Y A;  2NOX A;  4ZEY A;  4ZK1 A;  3H3M A;  3RGL A;  2WNC A;  1I6Z A;  1WRD A;  4ILA A;  5JRC B;  3PJA A;  2IML A;  2RP4 A;  2XQ4 A;  1J5W A;  2XAF B;  2YEV C;  4ZI3 C;  3PU8 A;  5AQV B;  2YDR A;  2CA5 A;  3CML A;  2KND A;  4UR9 A;  4ZJS A;  5BMV E;  4PFO A;  3EAB A;  1XWM A;  2WDV A;  5AQP B;  3AEE A;  4UV9 B;  5AFU L;  4FRR A;  4JI6 T;  3OVU A;  5AFN A;  2M67 A;  3P8C D;  4GKK T;  4DV3 T;  1HG2 A;  5IUX A;  2VKJ A;  3A8Y C;  4CI1 B;  3V5S A;  4XHE A;  2VUR A;  4ZZC A;  2WBL A;  4PK5 A;  5LB7 B;  3SFE A;  4UM3 P;  4X1K E;  1J5E T;  5BP0 A;  2V7I A;  3UUB A;  3N9M A;  2D0T A;  4UM3 A;  2W62 A;  4HWF A;  4ZR6 A;  1SA0 E;  2WM9 A;  3O4X E;  4X1Y E;  1HCI A;  5ETW A;  3BK9 A;  2NWB A;  4KHP T;  2E5L T;  4JV5 T;  1ZHC A;  4QH5 A;  2WMN A;  3I0Q A;  3MZK B;  4QH4 A;  2FJA A;  1QSD A;  5AQQ B;  3KFW X;  4JEU B;  5IYZ E;  4XZC A;  2VKO A;  2VVN A;  4IDQ A;  5CA0 E;  2YK0 A;  1VCT A;  2NW9 A;  2LHR A;  2WDQ A;  2BYS A;  3ANW A;  3AEF A;  4K0U A;  4LML A;  1IBL T;  3RLF F;  3FBL A;  4AKR B;  2Y57 A;  3P7I A;  5LGT B;  3NRX A;  3DJB A;  2A2F X;  3O1I A;  1VOM A;  1VRB A;  4IL9 A;  4F6R C;  5AQG B;  2UXD T;  5TVC A;  5TAO A;  2CXD A;  3A5X A;  2N1G A;  3T8O A;  3E0Z A;  3H37 A;  4DV5 T;  1FMV A;  5FNV E;  1Y64 B;  4CN4 A;  3AE4 A;  3QB5 K;  5AQU B;  1WYB A;  1IJ5 A;  4NXM T;  4EV6 A;  3KV4 A;  3C51 A;  4QXB B;  5KE4 A;  1JNZ A;  3LBX B;  5L47 A;  4CZZ B;  2QGS A;  4H63 H;  2MTQ A;  4G2A A;  4JI4 T;  2XY8 B;  1BR4 A;  1WCR A;  2YOE A;  4PAG A;  4I55 E;  4GK0 E;  5L3E B;  4EED A;  4GYR A;  3CX6 B;  1YQ3 A;  4D01 A;  2A72 A;  1IJ6 A;  4A56 A;  3LDQ B;  2XQ7 A;  1XZY A;  4X62 T;  1T72 A;  3LSV A;  3FZL B;  2HHH T;  4IGU A;  5LGU B;  2X9H A;  3HR0 A;  4O4L E;  4U3C A;  2Y7Y A;  2KMF A;  3IGQ A;  1UW6 A;  4HFH A;  2BVL A;  2BS2 A;  4IHJ E;  4JLE A;  1BR2 A;  3EHZ A;  3CQX C;  4K0K T;  3I1A A;  3ZT5 A;  3ZCI A;  2Y6X A;  3TLV A;  3UU3 A;  2I0M A;  3PJA J;  5JTG A;  5L3D B;  3HKC E;  3A7M A;  3AED A;  2PH9 A;  3UUM A;  3ZYL A;  5FY0 A;  5JDN A;  4DR4 T;  2MOZ A;  2XQ5 A;  4LF5 T;  3HL6 A;  2XAS B;  2VKH A;  3NZP A;  2F4V T;  5FKY A;  1D0Z A;  4Z91 A;  4DMV A;  2XQY A;  1UK5 A;  1YQ4 A;  5FJV A;  3QC9 A;  5ADX L;  2KSR A;  3ESL A;  5J2U E;  3N9N A;  4E7Z A;  3ZJ1 A;  3GN5 A;  3UFG A;  4I4T E;  2K24 A;  2LT3 A;  4YTN A;  1LVF A;  2CLY B;  2M6I A;  1HX1 B;  1NWM X;  2ACZ A;  3P4Q A;  1M7K A;  1MMA A;  1LVK A;  3LK2 B;  2UU9 T;  4UXN B;  4V1A v;  1N32 T;  1WYC A;  3X1D A;  4CN1 A;  4IE4 A;  1OED E;  4EOZ B;  2XPK A;  3NRY A;  4TZ4 C;  3RYI E;  1OWA A;  2CMR A;  4YTP A;  4PW8 A;  3C79 A;  1OED B;  1HX8 A;  5JH7 E;  4U7Y A;  4CN6 A;  3IA3 A;  1KEY A;  3UFE A;  3PUA A;  3VHL A;  4PJM A;  1T8B A;  2XTL A;  2A9U A;  4HFI A;  2BG9 A;  2UUA T;  3EVY A;  4HEA A;  2UZ6 A;  2WZI A;  2WZY A;  1QLB A;  4OHF A;  5J5H A;  1XNR T;  4DO0 A;  3PDY A;  4LF4 T;  3ZC1 A;  4KI0 F;  2VQF T;  3RKO A;  5AQM B;  4O8S A;  2LLY A;  2K5B B;  4I50 E;  4HE8 A;  3ZSS A;  4JI1 T;  2ES0 A;  4AFT A;  4BFQ A;  3F31 A;  3UUX B;  1ZV4 X;  3WI3 A;  3WAK A;  4DBM A;  3M65 A;  4B6X A;  4MBQ A;  5J5I A;  1KFY A;  3PUX F;  2LE8 A;  3RQW A;  2CM0 A;  1V9D A;  5HXC A;  3CVR A;  3WTH A;  4J2C A;  4WV9 A;  1SE7 A;  4DR6 T;  3GA8 A;  3RKG A;  5AQS B;  2CRB A;  3RHW A;  3GWH A;  5FXV A;  5CO5 A;  3NZQ A;  2JIW A;  4I0U A;  2CCQ A;  4DR3 T;  2BKN A;  3SWH A;  5J5G A;  4QHO A;  4DV1 T;  2C5K T;  4B3T T;  5HEG A;  2KWH A;  3PE0 A;  3LFM A;  4UEM A;  3FHN A;  5FYM A;  5AQF B;  3DP7 A;  5HWY A;  3IEE A;  4G63 A;  4ZI7 E;  2VB6 A;  1HG5 A;  4QX7 B;  2V1D B;  1LKX A;  2ZLY A;  3EI0 A;  2ODV A;  5HAX A;  1E2A A;  3MXZ A;  3VRB A;  5H6Q B;  3CX8 B;  5LJN A;  2D5U A;  3TLW A;  2XYT A;  1W0A A;  4CI3 B;  2C0S A;  3JAF A;  2K48 A;  1W0B A;  4KMC A;  5AQI B;  2E5V A;  2BG9 B;  2XNV A;  1G73 A;  3CX7 B;  5JQG E;  2HPL A;  2BDE A;  2E9X D;  1UUS A;  3KV5 A;  3AE8 A;  4LF7 T;  3N5L A;  1D0Y A;  3ONL C;  4P09 A;  5EK4 A;  4LF9 T;  3T1Y T;  3Q9D A;  3FZM B;  4F8H A;  4YJ3 E;  1U5P A;  2WB5 A;  2XSA A;  3ONX A;  3O1H A;  2UXX B;  2V7J A;  3ETU A;  2LHN A;  3RC3 A;  3AAI A;  3UTK A;  5H6R B;  5C3J A;  4UEL A;  2K3W A;  3LK3 B;  1S94 A;  3ZT6 A;  2OA5 A;  2J1D G;  4TX5 A;  3ABV A;  3RRC A;  4BJN A;  4HWC A;  4EEB A;  2CLY C;  2X66 A;  3CKD A;  2ZM6 T;  2XAJ B;  4CXW A;  3I0O A;  3MKD A;  4AQF C;  3K3O A;  4BAY B;  4HWD A;  4UV8 B;  2WDR A;  2XZE A;  2H89 A;  5F5W A;  3AA7 B;  3U78 A;  2BS3 A;  1N36 T;  1W9R A;  3VRA A;  4DND A;  4UM3 S;  3L3P A;  4ZI2 C;  5ABH A;  1FJG T;  2X9W A;  2IAK A;  3K3N A;  5HEO A;  4ZHQ E;  3AB3 B;  3EDV A;  1CHU A;  1N34 T;  4GKJ T;  4UVC B;  2X0L B;  3N2G E;  2IC6 A;  2XM2 A;  3C4Z A;  3N2K E;  4KUM B;  2CBJ A;  2XNT A;  5ABG A;  2LSY A;  2H7V C;  5FL0 A;  2NW8 A;  3K3Q C;  5DQW A;  2PG8 A;  5FP3 A;  1YXR A;  2XZ5 A;  2DI4 A;  4HQP A;  4DV2 T;  4WW0 A;  3IF8 B;  2I59 A;  5CJ5 A;  3VR8 A;  3V5U A;  1M62 A;  1HR0 T;  1BR1 A;  5ABF A;  4EGW A;  3QB5 A;  4WZX A;  5FY1 A;  2Y56 A;  2Q9Q D;  5EK2 A;  3AE1 A;  2CEA A;  4KP3 C;  2BYP A;  2EHO D;  3EAM A;  4B3M T;  3KIN B;  2JPF A;  3AXJ B;  1YD8 G;  5AQN B;  4DUY T;  2LKH A;  4UXU A;  2MPK A;  1Z0P A;  2XZ6 A;  2J4G A;  5FXW A;  3RYC E;  4O4I E;  3RC8 A;  2FJB A;  2NP9 A;  3W15 B;  3UUL A;  3HKE E;  4JI2 T;  1I9B A;  3ZMV B;  4DV6 T;  2X0Y A;  3VKG A;  5AFL A;  2WP9 A;  4WNK A;  1UUR A;  3ZEF B;  3UQ7 A;  2BYN A;  4CQI A;  3GN5 B;  4ILC A;  4KHZ F;  5FL1 A;  4AXP A;  3PUR A;  3B13 A;  3J7Y q;  1N33 T;  5FY7 A;  3U8K A;  2LSK A;  1YKE B;  3C4X A;  1R8I A;  3PV0 F;  4HFB A;  5FXX A;  3LK4 2;  4LFC T;  3AEC A;  4X66 T;  5LYJ E;  4IDP A;  4QWN B;  5HWX A;  3QK6 A;  2RPA A;  4MHC A;  4DR2 T;  1T98 A;  4IDO A;  4TV9 E;  5GON E;  2FJE A;  4HKA A;  3SS1 A;  4ZJT A;  4CI2 B;  5AQK B;  4TN7 B;  2LOP A;  3WTI A;  3ONJ A;  2X00 A;  3SQ9 A;  4YJ2 E;  4H9S E;  3QOF A;  5E0O A;  1GQE A;  1ZP0 A;  3AEG A;  1HNZ T;  2X0H A;  3AE2 A;  5FMN A;  2UUC T;  4ZS3 A;  3C50 A;  4O2B E;  4EZH A;  3KDS E;  2J47 A;  3CQC B;  1UX2 A;  2D9D A;  4JI7 T;  3PUY F;  5F8P A;  1FIO A;  2CHO A;  2I6H A;  3DTO A;  2BBJ A;  1D1B A;  3UU5 A;  4X64 T;  4IDN A;  3ZMS B;  5AQH B;  2V6X A;  2WAU A;  2R6G F;  2XAH B;  1ZKE A;  4PFP A;  1WR6 A;  3LBX A;  3ZMZ B;  2ZM2 A;  3PUZ F;  5ABE A;  3OTO T;  4HFV A;  1NAF A;  4E7S A;  5JVD E; 
#chains in the Genus database with same CATH homology
 2KSR A;  2BR7 A;  5IUX A;  2XNT A;  4EZ1 A;  3U8L A;  3U8M A;  2BG9 B;  4ILB A;  4A97 A;  3U8K A;  2XNV A;  4XHE A;  2XNU A;  5J5F A;  4ZRU A;  2LLY A;  4ZZC A;  4QAA A;  2XQA A;  4PIR A;  5L4H A;  2WNJ A;  4UM3 P;  3WTL A;  2VL0 A;  5KE4 A;  5AFM A;  3TLS A;  3P50 A;  2M6I A;  5L47 A;  2X00 D;  5BP0 A;  3PMZ A;  4HFB A;  5CFB A;  3TLT A;  3UUB A;  4AFT A;  2YME A;  4BFQ A;  4DBM A;  4UM3 A;  2BJ0 A;  2YN6 A;  3P4W A;  4ZK4 A;  4TWD A;  5HEH A;  4LMJ A;  4Z90 A;  5SYO A;  5J5I A;  2BYR A;  3RQU A;  4XK9 A;  3WIP A;  4F8H A;  2XZ5 A;  2YOE A;  2ZJV A;  2PGZ A;  4ZR6 A;  4X5T A;  4TWH A;  5J0Z A;  3WTJ A;  4B5D A;  3RQW A;  4HQP A;  4UY2 A;  2XYS A;  3SQ6 A;  1UV6 A;  4ZJT A;  2WNL A;  4LMK A;  4UM1 A;  1OED C;  3UQ4 A;  4QAB A;  5HCJ A;  5AIN A;  5BW2 A;  3RIF A;  3WTH A;  3WTO A;  3ZDG A;  4D01 A;  4WV9 A;  5LG3 A;  5AFM B;  3WTI A;  4QH5 A;  4AFG A;  3SH1 A;  3ZKR A;  3RHW A;  2W8F A;  1OED E;  4QH4 A;  2X00 A;  2BR8 A;  2XQ7 A;  3SQ9 A;  3U8J A;  2Y56 A;  5CO5 A;  3C84 A;  2XQ3 A;  2W8G A;  2BYP A;  4QAC A;  3LSV A;  3U8N A;  2BG9 E;  3UU6 A;  4NZB A;  4ZK1 A;  2WN9 A;  2XQ9 A;  4NPP A;  2MAW A;  5HEU A;  5HEJ A;  3GUA A;  3ZDH A;  2Y7Y A;  3EAM A;  5HCM A;  3IGQ A;  4TWF A;  2WNC A;  3C79 A;  1OED B;  1UW6 A;  2XQ8 A;  4HFH A;  4AFH A;  2BG9 C;  2YMD A;  3UU4 A;  4ILA A;  5LXB A;  2BYS A;  5J5G A;  2LKH A;  3JAE A;  3WTN A;  5BRX A;  4TNW A;  3EHZ A;  4COF A;  2XQ4 A;  1UX2 A;  4ZZB A;  4UXU A;  4LML A;  5HEG A;  2XZ6 A;  3TLV A;  2Y57 A;  2XQ6 A;  2C9T A;  3UU3 A;  3SIO A;  2QC1 B;  4TNV A;  4QH1 A;  4ZJS A;  1OED A;  5L4E A;  2PH9 A;  5KZU A;  2ZJU A;  2BYQ A;  3PEO A;  2Y58 A;  4UM3 S;  4IRE A;  4HFI A;  2BG9 A;  5AFK A;  3RI5 A;  4IL9 A;  2UZ6 A;  3UU5 A;  5TVC A;  4ALX A;  2XQ5 A;  5AFJ A;  3TLU A;  5HEO A;  1I9B A;  3RIA A;  2WZY A;  4A98 A;  4HFE A;  5J5H A;  3EI0 A;  4BQT A;  4HFC A;  4FRR A;  2YKS A;  2Y54 A;  4HFD A;  5AFL A;  4Z91 A;  5JME A;  3WTK A;  2M6B A;  3UQ7 A;  2BYN A;  3JAD A;  2LM2 A;  5AFN A;  3TLW A;  3WTM A;  5AFH A;  2XYT A;  2LKG A;  4IL4 A;  3UU8 A;  3T4M A;  5FJV A;  3JAF A;  4ILC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...