4HFHA

The glic pentameric ligand-gated ion channel (wild-type) complexed to bromoform
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfhA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfhA01
4F8HA 2BYSA 5AFMA 5BP0A 2ZJVA 4ALXA 2XYSA 4ILAA 2XNVA 4DBMA 2XQ3A 2X00A 3WTKA 3GUAA 3SH1A 4NZBA 2YN6A 4ZK4A 4A97A 2LKGA 4UM3A 3UU6A 4TNVA 3EHZA 4QACA 2XQ4A 3WTHA 5JMEA 4TNWA 4TWDA 3UU3A 3UQ4A 2XZ6A 3C84A 3PEOA 5BW2A 5AFLA 5J5GA 4AFTA 2C9TA 3WTMA 2QC1B 4COFA 3RIFA 4QAAA 4HFDA 2XYTA 3ZDGA 5HEGA 2M6IA 4QH5A 3UU5A 3RHWA 3PMZA 2MAWA 4BQTA 4ZZCA 4UM3S 2XQ7A 3P50A 5HEJA 1OEDE 3JADA 4QH4A 2ZJUA 5TVCA 3U8JA 4B5DA 2BG9A 3ZKRA 5CFBA 2Y57A 4D01A 4IL4A 3TLUA 2LKHA 2BG9C 2BR8A 4HFBA 2X00D 3UQ7A 4ILCA 5LG3A 2XNUA 4UM3P 3WIPA 2XQ8A 5IUXA 4BFQA 3TLWA 1UW6A 3SQ6A 3EAMA 2WNLA 4ZZBA 2Y7YA 2BYQA 3WTOA 5HCJA 3SIOA 3ZDHA 5L47A 4XHEA 2XQAA 3U8MA 2UZ6A 3RQUA 3EI0A 3UU4A 5L4EA 2PGZA 1I9BA 5FJVA 3RI5A 3TLTA 3WTJA 1OEDA 5AFNA 4TWHA 3UU8A 5BRXA 5LXBA 2KSRA 2WNJA 5HEOA 4ZR6A 4ZRUA 4IREA 4X5TA 2Y54A 5AINA 4ILBA 2PH9A 2YMEA 1UV6A 2XQ6A 4IL9A 2W8GA 2XNTA 4WV9A 5KE4A 4HFCA 2Y58A 4PIRA 4UXUA 4UY2A 4EZ1A 2BYPA 4QH1A 2YOEA 2WN9A 5CO5A 3U8KA 4LMLA 5AFHA 5AFKA 3U8LA 4A98A 4HFEA 3P4WA 2W8FA 4QABA 5HEUA 2BJ0A 5J5FA 2LLYA 2BG9B 4Z90A 2LM2A 2BYNA 4XK9A 1UX2A 2WNCA 2XZ5A 5J0ZA 4ZJSA 3SQ9A 5J5IA 4ZK1A 2Y56A 5KZUA 2BG9E 2XQ5A 3WTNA 3C79A 3WTLA 3JAFA 4HFIA 4FRRA 4UM1A 3IGQA 5HCMA 5AFJA 4AFGA 3RIAA 3TLSA 4Z91A 2YKSA 1OEDB 4TWFA 2WZYA 5L4HA 3RQWA 4HFHA 3U8NA 5HEHA 2YMDA 5AFMB 5SYOA 2VL0A 4LMJA 4HQPA 3LSVA 3WTIA 5J5HA 4NPPA 3TLVA 4LMKA 2XQ9A 3T4MA 1OEDC 2M6BA 2BR7A 4ZJTA 2BYRA 3UUBA 3JAEA 4AFHA
chains in the Genus database with same CATH superfamily
4YJ2E 2CHOA 2XYSA 2LSIA 3ZN1B 3O9XA 3I0QA 4PK4A 3ONLC 3P4SA 2WWVA 3AB3B 3U78A 2XQ4A 4YTMA 3WTMA 1XZYA 2JRKA 3AEDA 4U7YA 3J9X1 3LK42 4IIJE 4CQIA 4ILUA 2BS3A 1NWMX 2C5JA 5L3BB 4UM3S 3AECA 4JI2T 3DTOA 3VHLA 3KBTA 2A9UA 3WIPA 4UV8B 3FXDB 2Y7YA 2DL1A 3N2GE 5LA6E 2UUBT 5HYAA 1OEDA 4LF8T 4U74A 2JQ9A 3RYIE 1UV6A 1JNRA 5ABHA 3AXJB 2C0SA 1KFYA 3AEEA 5AFKA 2FBWA 1MMDA 2BG9B 5CA1E 2BDEA 1N34T 3LBXB 4XK9A 4FJOA 2BG9E 5C2TA 5FY7A 3IA3A 2CHNA 5JRCA 4CN6A 2HN2A 2DWKA 2UU9T 2LSYA 3ZYKA 2X51A 4NIQA 4HFHA 5AQSB 3ZT7A 4HQPA 2D5UA 2Q9QC 2ZM6T 3K1SA 2V26A 2Q9QA 5JDLA 4ZJTA 2CEAA 5J2UE 5JR9C 2V5CA 3ZMTB 5FXVA 2SPCA 2H3RA 4CN1A 3CMLA 3UU3A 5LBMA 2C5KT 5J5GA 3RIUC 3C4ZA 4O4IE 4EZ4A 1VRBA 4U2YA 2DNXA 4JEHB 3RIFA 4QAAA 4EOZB 5HEGA 4Q25A 4UEMA 3I9YA 2WQYA 4BQTA 4QH4A 4UVBB 2H7VC 2Y57A 3TLUA 4EEBA 4ILCA 3O1IA 5LG3A 4UM3P 2JPFA 3SQ6A 3RYFE 4ZZBA 4JI0T 1X79A 1SA0E 2F4VT 3OPCA 2H7OA 3RQUA 5L4EA 3RI5A 5AFNA 2VVNA 2BBJA 3H37A 4EXTA 3BQKA 4CI2B 2XNTA 2W8GA 1X9BA 4WW0A 2X9HA 2UUCT 4PW8A 2EHOD 1V9DA 3QK6A 2VASA 3NBXX 4IDOA 3AEAA 2KMFA 4B3RT 5KDMC 2KWHA 4ZJSA 5HCMA 4GKKT 2LRKA 4TV8E 3PUXF 3A5XA 1YXRA 2D0UA 3E08A 3ZSSA 1ZOYA 4YSYA 3AVSA 3N9NA 2UUAT 1ZHCA 2XQ3A 3WTKA 3Q5DA 4DV5T 2J47A 3DJBA 3N9QA 2WDRA 4TNVA 2WM9A 3ZT6A 3LK2B 4ZI3D 4COFA 2KZ7B 3ZDGA 2V7JA 2VKHA 2ODUA 1J5WA 3P50A 1CUNA 2LKHA 4P1NA 3TLWA 2XASB 1I94T 1WRDA 1IBMT 1D1CA 4O2BE 3AEBA 3F31A 3SFEA 4ZR6A 5L3EB 4IREA 2I6HA 3VKGA 4UV9B 2E9XB 3N9MA 4I4TE 4KMCA 3C4WA 2KINB 2WDQA 2N9DA 2WN9A 5CO5A 3PV0F 1XMOT 3W15B 3ZT5A 4TUYE 5H6QB 1UX2A 2FUPA 4DV4T 5J0ZA 4GIWA 3ESLA 5CA0E 3WTLA 4X1IE 3HR0A 2KXPB 2BS2A 2LM9A 4Z91A 2YKSA 5HXCA 5BR8T 2WZYA 3RQWA 3MK7C 3PUSA 1H7CA 2VVSA 2OA5A 3MJXA 3L8RA 4F8HA 4JI8T 2LSKA 1M62A 2C5IT 4A56A 4LF4T 3OYXA 2V6YB 4U3CA 2WMNA 5JMEA 3UQ4A 3C84A 3PUYF 2DI4A 2A3DA 1T72A 2X68A 3AXJA 1FMVA 3FB2A 3ZCJA 2BBHA 3RLFF 4P0BA 2IMLA 1IJ6A 5DQVA 5FY1A 5TVCA 4B5DA 3ZKRA 4I43B 1OWAA 2WMOA 2DLRA 4QX7B 1O3XA 5LGTB 2KWIB 2FJEA 4HGAA 5HCJA 1BR4A 2E8IA 2UZ6A 1J5ET 2PGZA 3UU4A 2VURA 1VOMA 5JDGA 3WTJA 3CVRA 3SFDA 4PJMA 4GYSA 4UF0B 4BJMA 4DR2T 1KNZA 4YFSA 4EYUA 5ADXL 4B3ST 4X20E 4KHPT 4TZ4C 4YLHA 5J5FA 2CXDA 1MMNA 4NXMT 2LM2A 3OTOT 4X64T 2CBJA 3PUVF 3SQ9A 4OFZA 4ZK1A 2DCFA 5AQVB 1E1HB 2AXDS 5BMVE 1T8BA 3LK3B 1HS7A 4DV7T 1HX1B 2BKOA 5GONE 1LVFA 2OLTA 5FXXA 1LRZA 5LNKA 3BK9A 3T4MA 5LMUT 5JR9A 4DBMA 2UXBT 4QXCB 2XY8B 3IF8B 1MMAA 1KF6A 4UM3A 3UU6A 3GA8A 5AFLA 1FMWA 1AJ3A 2IW5B 2WSSV 3FBZA 3S4UA 5ABFA 5ABFB 5AQJB 2XAHB 3RRCA 5J2TE 4DV2T 1WLXA 3FZFB 3AE2A 3AE8A 4JI3T 4QXHB 1D1BA 3LBXA 3C64A 5IUXA 4DVDA 4AISA 5DJQC 2B1EA 2WCAA 3EI0A 5JH7E 4LFBT 3FZMB 3BQLA 2KNDA 5ETWA 1N32T 4UVCB 2XQ6A 1D0ZA 4HFCA 5KMGP 1FJGT 4PIRA 2BYPA 1FIOA 5KX5E 5IYZE 5M4YA 5AFHA 3ZEFB 2JJ9A 2A2FX 1WCRA 4CI1B 4IE0A 2H89A 5J5IA 3PURA 2NR4A 1MNEA 3AAAB 2ZLYA 1EZ3A 3PUWF 4DR5T 1NAFA 2XPKA 5LXTE 5AQKB 1QUUA 1D0XA 1US7B 2LHRA 3MZKB 3NWIA 2XAQB 3RF1A 5JDQA 3AAEB 4OHFA 4NXNT 1YQ3A 5F3JA 4A97A 3KBUA 5A1LA 2X9WA 4PJLA 3R84B 4IE6A 2ACZA 3VRBA 1UCUA 3JCFA 3ZMSB 2V6YA 5J1GA 2W63A 1WYCA 1SE7A 5FL0A 2AE9A 2NTYA 2J1DG 4YT0A 3N2KE 2BG9A 3B5MA 4ISTA 2HPLA 2BG9C 2UXNB 3UQ7A 3OYZA 3OBVE 2PJQA 1JNZA 2HPJA 5L47A 4ZI2C 3TLTA 2XSAA 5HWXA 2X67A 3RC8A 2LJLA 3M3ZB 4MALA 2JQKA 1IBLT 3RH3A 3L09A 2IDOB 4E7ZA 1LKXA 3RKOA 5L3GB 3C79A 3JAFA 3MXZA 2XQYA 4AFGA 4LF6T 2JMHA 5HXSA 4H63V 5AQFB 3ZMUB 5LCYA 3AVRA 2PBIA 2X0HA 2XM1A 1YKHB 2VK9A 4LFAT 2Z6EA 3UUXB 4BJNA 5FP3A 4AI6A 1HNWT 4AFTA 4EB6E 4ZS3A 2QC1B 3OJAA 1XMQT 3CQCB 1Y01A 3PMZA 4YSZA 2MAWA 2HH7A 3B13A 1T98A 3EUHA 5ABGA 3AE1A 1YQ4A 4QWNB 3AE4A 5LGUB 3ETVA 1LVKA 3O1HA 4HN9A 4AKGA 4LF5T 3WAJA 4YXDA 3ZJ2A 2XNUA 3RYCE 4DO0A 1UW6A 2VKDA 2GK9A 3ZDHA 4X1KE 4KUMB 5FJVA 4OK0A 5F5WA 4TWHA 4H9OC 4AQFA 5KXJA 2EHOA 2VKJA 2EHOB 4UY2A 2CXLA 3T8OA 4JI1T 3SS1A 3U8KA 3FXEB 2E9XC 2IIUA 2RPAA 4QKNA 5EK2A 4EAHA 2CM0A 1S35A 4IDQA 4I50E 4YY3T 2YEVC 5LP6E 3Q5XA 3ZSTA 5AFJA 4IDZA 3PUAA 2PG8A 3U8NA 2IUBA 5AFMB 2XQ9A 5CGMA 4JI7T 3ZPOA 2NW8A 2Q9QD 2HHHT 5AQNB 4ALXA 3QC9A 4JUYA 3QB5A 2YN6A 4ZK4A 2Y6XA 4IHJE 3RX6A 2KT9A 4A5XA 2W62A 4I0UA 3N9PA 3OVUA 4ZOLE 2WAUA 4IT4A 2W00A 3KINB 5HXHA 3CWZB 4DIDB 2PFVA 1I6ZA 3P7IA 4MHCA 2WBLA 1QSDA 4BFQA 3QUJA 2V8SV 3IEEA 1Z0PA 4HKAA 3NRYA 4EYYR 2V6XA 3U8MA 4XZCA 5IWAT 5AQTB 2YDQA 4O4HE 4AQGA 2BVLA 3ZMZB 2K48A 2YDRA 5LJNA 3CQXC 3SWHA 4L0RA 5DABA 3O1JA 4LMLA 2XAFB 2W4XA 2LLYA 2ZM8A 2CWYA 4UELA 2BYNA 3CIRA 2D2SA 4HTEA 4ADZA 1UGOA 4PFOA 3KVBA 3ONXA 4UXNB 3RGLA 1UUSA 4PK5A 1GQEA 4EV6A 3P4QA 4AIUA 5LYJE 3R6NA 5LHGB 2N2NA 4NPPA 4OYKA 4UVAB 5LOVE 3EVYA 1W9RA 2WU2A 2L3LA 4M1PA 2CLYB 2BYSA 3NVOA 2L9QA 2WDVA 5FVKA 2ZMAA 2LKGA 2WWUA 5H6RB 2WS3A 1U4QA 2J4GA 3CQGB 3SRZA 2YDSA 2VB6A 3T1YT 4ZHQE 3PU3A 4AKIA 1HTJF 2LE8A 4HWHA 2UXXB 2K5BB 5CFBA 4HFBA 2ZM0A 2MBGA 2WZIA 4LF9T 3C98B 3LG7A 3AEGA 3AEFA 2WB5A 3TKLB 3WTOA 2XQAA 4MLKA 4HE8A 4WBOA 2ODVA 3Q9DA 1WR6A 3HA4A 3FZLB 4IGUA 5HEOA 1ZP0A 4DV0T 2DHRA 2RA1A 3MACA 4L9IA 3ZJ1A 3Q5WA 3KV9A 5LMNT 1UX5A 4CXYA 3JC6D 4EGWA 5FNVE 5LJMA 5KZUA 4EEDA 2Y56A 3AA1B 3WTNA 5JVDE 4PJNA 4L5GA 1R8IA 2E9XA 3O4XE 2J62A 3I0OA 1N36T 2V7LA 3A7MA 4DNDA 3PUZF 5EZYE 5FKYA 4CI3B 2BKNA 2M6BA 1FEWA 3EDVA 2NTXA 4AFHA 5L2LA 5BP0A 1MIVA 2IHR1 3ETUA 3EHZA 1KNRA 4TNWA 4TWDA 2XZ6A 2QYWA 2I0MA 2XSBA 5JDNA 2NWBA 5FL1A 3EDUA 2A72A 2XYTA 2K3WA 3NZQA 5FXWA 3AE6A 5HEJA 3PJAA 4JEUB 3U3IA 2UXCT 2ZJUA 4KP3C 4IE7A 3UULA 1YD8G 4E7SA 2JQQA 2X00D 4PAGA 1KK7A 5FXZA 2BS4A 3ONJA 4DR7T 4XHEA 5AQGB 3RRWA 2JQHA 3RIUA 4X5TA 5AQMB 3RKGA 2LOPA 3RC3A 3Q5EA 1MNDA 4EZ1A 2LSGA 2W61A 4YSXA 2MYSA 3C51A 4ZEYA 5L3CB 4H9QC 5TAOA 3ZLIA 1HFAA 4FRRA 5LHIB 2YU1A 3B57A 1MMGA 3TLSA 2V5DA 1HNZT 3P4RA 5L4HA 4WYVA 1OXZA 2K9AA 3AAIA 4U72A 2VL0A 2FJDA 2CPTA 4J2CA 5HXRA 3ZC0A 1HCIA 1XNRT 2ZJVA 4ILAA 4KHZF 4QX8B 2X00A 3ANWA 4DMVA 4JI6T 4DV3T 3VR9A 4QACA 3WTHA 2CBIA 3PEOA 3GMIA 5BW2A 2C9TA 5FVLA 4U7IA 4N78D 4CN4A 1HNXT 1G73A 4WBNE 4ISSA 2CRBA 5HXEA 3C50A 3CKDA 1J1JA 3VR8A 3K8PC 1SHZC 3KV5A 2HN1A 2BR8A 3OKQA 4TN7B 1WR0A 3GN5A 3I1AA 3E22E 5L3DB 4U33A 3QNUA 4YJ3E 4ERRA 3F2EA 4ZI3C 4X65T 2P9BA 4TV9E 2MOZA 4EZHA 5AINA 3MKDA 3CX6B 2YMEA 3N2OA 1ZV4X 5JRCB 3KDSE 1XDPA 2NOXA 5FYMA 2QRXA 4QH1A 4TX5A 4IDNA 2NW7A 3N9OA 2CA5A 2X0LB 2Y8DA 2IC9A 1HG2A 4H9NC 2VL8A 3AA6B 5C8YE 5C3JA 5AQPB 4HWFA 3AE9A 5E0OA 3CX8B 3RIAA 4JLEA 5AFUL 1OEDB 4TWFA 5SYOA 3WTIA 4DR3T 5CB4E 4JI4T 4G63A 1IAPA 1W0BA 4O8SA 2XNVA 2LHNA 4QHOA 5EK3A 4AXPA 5AQUB 1Y64B 5FMNA 2LSJA 4HFDA 1IJ5A 2X9XA 3FZKB 1M7KA 1QLBA 2R6GF 4HFVA 4WNKA 4H9SE 2QA7A 2KLQA 4P09A 4JI5T 5HAXA 2XQ8A 3PTRB 3SIOA 2IAKA 1I9BA 5ABEA 4AKLA 1T7SA 5LXBA 2KSRA 4U2ZA 2V7KA 5AQLB 5KE4A 4KI0F 2Y58A 3QB5K 5AQIB 4DUYT 3U8LA 1IBKT 2D9DA 5HEUA 2BJ0A 1UX4A 2JIWA 2EHOC 4DBQA 3H3MA 5AQQB 2WP9A 2WU5A 2WNCA 2XZ5A 1D1AA 4AKHA 4AKRB 3V5UA 4GYRA 1IZNB 4KX6A 2FJBA 2V7IA 5HEHA 3ZYLA 4CXXA 2V7MA 1VCTA 4GKJT 2D0TA 4ZXLA 2BR7A 4GK5E 2BYRA 3X1DA 3JAEA 5AFMA 3KFWX 2ZM2A 4DUZT 5EK4A 2VWAA 4NZBA 2Y48B 2I59A 1KNPA 2XAGB 4MFRA 2X66A 3GWHA 2XAJB 4H9RC 2M6IA 3KVAA 2LRLA 3VU7H 5LGNB 4UF0A 3HKCE 3FZHB 1OEDE 3LFMA 3U8JA 4D01A 4IL4A 2W0GA 5AQRB 1L0VA 2JMKA 4YHHT 1NENA 2FJAA 2NP9A 3N9LA 1U5PA 2CWOA 5LG4A 3ZCIA 4ZI2D 5F8PA 5BRXA 3UU8A 3Q2MA 4ZRUA 1KEYA 2Y54A 4H9PC 4DBRA 4K0UA 2PH9A 3CX7B 4CXWA 3PJAJ 2DWGA 3BQIA 3HI2A 3UTKA 3ZMVB 1N33T 4X62T 1BR2A 4Z90A 2XHEB 3QOFA 2VKOA 3KV4A 4ASKA 3C4XA 1XNQT 5LB7B 2BVMA 4C90A 2Q9QB 4Z8XA 3IHRA 4IE5A 2VQET 3N5LA 3AE7A 2CCQA 3PDYA 1ZEEA 2MTQA 3JC6C 3UFGA 1MIWA 4IE4A 2BZBA 1MIYA 2WZHA 5JREA 2XM2A 3UUNA 3UFEA 2LT3A 2XJ7A 3SH1A 4GK0E 4OX9T 3ABVA 3PU8A 2X9YA 2CLYC 2YK0A 5LBQB 5FY0A 3SOLA 5AQHB 3F57A 1UK5A 3G06A 3NRXA 2E5LT 4AQFC 2XQ7A 4XBFB 3WAKA 3FBLA 3HKBE 3NZPA 1VCSA 4YTPA 4ZI7E 2WNLA 5JTGA 4MBQA 2OV9A 4ANJA 1ZKEA 3PE0A 5HWYA 4UR9A 1E2AA 4DV6T 2WNJA 3UT5E 2K24A 4G2AA 2NW9A 4K0KT 3UUMA 4IL9A 2M67A 1WYBA 4JYAT 2E9XD 4YHJA 3J7Yq 2VQFT 2YINA 3P4WA 3PUGA 3FHNA 4ZS2A 4I55E 4BA9A 4UM1A 3IGQA 2V1DB 5JDHA 1S94A 2XUEA 2YMDA 2UXDT 3K3QC 5J5HA 4IDPA 1HF8A 3HKDE 2E2AA 5JDFA 3HL6A 1XDOA 2B76A 2WY2A 1BR0A 3GN5B 1YKEB 1W09A 4OYJA 5AQOB 2H88A 2G0UA 4NUVA 1UURA 1SUMB 4F6RC 3HKEE 3UU5A 4GOUA 4ZZCA 2N1GA 3P4PA 3AE3A 3L39A 3A8YC 2QVAA 3WI3A 2L8KA 3EAMA 3K3OA 3CK6A 4WZXA 2BYQA 2CMRA 4PK6A 3VKHA 4NUUA 3P8CD 4DMWA 3EABA 4ILBA 4DV1T 2W67A 5JDMA 1W0AA 4WV9A 4HWIB 4UXUA 5LHHB 2YOEA 4YTNA 1XWMA 4B3MT 2W8FA 2XTLA 4LFCT 2ACXA 5CJ5A 2X0YA 2MPKA 3AE5A 4V1Av 4AQYT 2XQ5A 4DR4T 3AA7B 3VRAA 4HFIA 1HX8A 4KBMB 2BKPA 4QXBB 4JBWF 2CE7A 5JR9B 4LMJA 2RP4A 3TLVA 4LMKA 1OEDC 4PJJA 3UUBA 1NEKA 4C91A 1B7TA 3K3NA 4BAYB 3NKZA 4CZZB 4X66T 3GUAA 4H63H 1HR0T 2W66A 4XAXB 4DR1T 3I9WA 1DU2A 4HEAA 4DR6T 1WFDA 2W2UA 1HG5A 1E7PA 3ZN0B 2XZEA 4QH5A 3RHWA 4FI5A 3LJCA 3AA0B 3JADA 3H3AA 3ANWB 2YU2A 3KV6A 4O2AE 1CHUA 4HWCA 4X1YE 3IBPA 2LOSA 4HWDA 3T1HT 3LDQB 2IC6A 4JV5T 1D0YA 1Z8UA 3PUQA 4U31A 2CXFA 3RPUA 3V5SA 4O4JE 3E0ZA 3MA9A 4EIWA 3ZC1A 5IHYA 5DQWA 5L3FB 3DP7A 3CPZA 3RYHE 4B3TT 4A98A 4HFEA 4UIGA 3ZYMA 3L3PA 4QABA 4PNIA 1G8XA 3D0TA 3M65A 4PFPA 2LEHA 4LF7T 1YW0A 2PTFA 2QGSA 2ES0A 1BR1A 2E5VA 3LSVA 4P0AA 4B6XA 5JQGE 4O4LE
chains in the Genus database with same CATH topology
4F8HA 2BYSA 5AFMA 5BP0A 2ZJVA 4ALXA 2XYSA 4ILAA 2XNVA 4DBMA 2XQ3A 2X00A 3WTKA 3GUAA 3SH1A 4NZBA 2YN6A 4ZK4A 4A97A 2LKGA 4UM3A 3UU6A 4TNVA 3EHZA 4QACA 2XQ4A 3WTHA 5JMEA 4TNWA 4TWDA 3UU3A 3UQ4A 2XZ6A 3C84A 3PEOA 5BW2A 5AFLA 5J5GA 4AFTA 2C9TA 3WTMA 2QC1B 4COFA 3RIFA 4QAAA 4HFDA 2XYTA 3ZDGA 5HEGA 2M6IA 4QH5A 3UU5A 3RHWA 3PMZA 2MAWA 4BQTA 4ZZCA 4UM3S 2XQ7A 3P50A 5HEJA 1OEDE 3JADA 4QH4A 2ZJUA 5TVCA 3U8JA 4B5DA 2BG9A 3ZKRA 5CFBA 2Y57A 4D01A 4IL4A 3TLUA 2LKHA 2BG9C 2BR8A 4HFBA 2X00D 3UQ7A 4ILCA 5LG3A 2XNUA 4UM3P 3WIPA 2XQ8A 5IUXA 4BFQA 3TLWA 1UW6A 3SQ6A 3EAMA 2WNLA 4ZZBA 2Y7YA 2BYQA 3WTOA 5HCJA 3SIOA 3ZDHA 5L47A 4XHEA 2XQAA 3U8MA 2UZ6A 3RQUA 3EI0A 3UU4A 5L4EA 2PGZA 1I9BA 5FJVA 3RI5A 3TLTA 3WTJA 1OEDA 5AFNA 4TWHA 3UU8A 5BRXA 5LXBA 2KSRA 2WNJA 5HEOA 4ZR6A 4ZRUA 4IREA 4X5TA 2Y54A 5AINA 4ILBA 2PH9A 2YMEA 1UV6A 2XQ6A 4IL9A 2W8GA 2XNTA 4WV9A 5KE4A 4HFCA 2Y58A 4PIRA 4UXUA 4UY2A 4EZ1A 2BYPA 4QH1A 2YOEA 2WN9A 5CO5A 3U8KA 4LMLA 5AFHA 5AFKA 3U8LA 4A98A 4HFEA 3P4WA 2W8FA 4QABA 5HEUA 2BJ0A 5J5FA 2LLYA 2BG9B 4Z90A 2LM2A 2BYNA 4XK9A 1UX2A 2WNCA 2XZ5A 5J0ZA 4ZJSA 3SQ9A 5J5IA 4ZK1A 2Y56A 5KZUA 2BG9E 2XQ5A 3WTNA 3C79A 3WTLA 3JAFA 4HFIA 4FRRA 4UM1A 3IGQA 5HCMA 5AFJA 4AFGA 3RIAA 3TLSA 4Z91A 2YKSA 1OEDB 4TWFA 2WZYA 5L4HA 3RQWA 4HFHA 3U8NA 5HEHA 2YMDA 5AFMB 5SYOA 2VL0A 4LMJA 4HQPA 3LSVA 3WTIA 5J5HA 4NPPA 3TLVA 4LMKA 2XQ9A 3T4MA 1OEDC 2M6BA 2BR7A 4ZJTA 2BYRA 3UUBA 3JAEA 4AFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F8H A;  2BYS A;  5AFM A;  5BP0 A;  2ZJV A;  4ALX A;  2XYS A;  4ILA A;  2XNV A;  4DBM A;  2XQ3 A;  2X00 A;  3WTK A;  3GUA A;  3SH1 A;  4NZB A;  2YN6 A;  4ZK4 A;  4A97 A;  2LKG A;  4UM3 A;  3UU6 A;  4TNV A;  3EHZ A;  4QAC A;  2XQ4 A;  3WTH A;  5JME A;  4TNW A;  4TWD A;  3UU3 A;  3UQ4 A;  2XZ6 A;  3C84 A;  3PEO A;  5BW2 A;  5AFL A;  5J5G A;  4AFT A;  2C9T A;  3WTM A;  2QC1 B;  4COF A;  3RIF A;  4QAA A;  4HFD A;  2XYT A;  3ZDG A;  5HEG A;  2M6I A;  4QH5 A;  3UU5 A;  3RHW A;  3PMZ A;  2MAW A;  4BQT A;  4ZZC A;  4UM3 S;  2XQ7 A;  3P50 A;  5HEJ A;  1OED E;  3JAD A;  4QH4 A;  2ZJU A;  5TVC A;  3U8J A;  4B5D A;  2BG9 A;  3ZKR A;  5CFB A;  2Y57 A;  4D01 A;  4IL4 A;  3TLU A;  2LKH A;  2BG9 C;  2BR8 A;  4HFB A;  2X00 D;  3UQ7 A;  4ILC A;  5LG3 A;  2XNU A;  4UM3 P;  3WIP A;  2XQ8 A;  5IUX A;  4BFQ A;  3TLW A;  1UW6 A;  3SQ6 A;  3EAM A;  2WNL A;  4ZZB A;  2Y7Y A;  2BYQ A;  3WTO A;  5HCJ A;  3SIO A;  3ZDH A;  5L47 A;  4XHE A;  2XQA A;  3U8M A;  2UZ6 A;  3RQU A;  3EI0 A;  3UU4 A;  5L4E A;  2PGZ A;  1I9B A;  5FJV A;  3RI5 A;  3TLT A;  3WTJ A;  1OED A;  5AFN A;  4TWH A;  3UU8 A;  5BRX A;  5LXB A;  2KSR A;  2WNJ A;  5HEO A;  4ZR6 A;  4ZRU A;  4IRE A;  4X5T A;  2Y54 A;  5AIN A;  4ILB A;  2PH9 A;  2YME A;  1UV6 A;  2XQ6 A;  4IL9 A;  2W8G A;  2XNT A;  4WV9 A;  5KE4 A;  4HFC A;  2Y58 A;  4PIR A;  4UXU A;  4UY2 A;  4EZ1 A;  2BYP A;  4QH1 A;  2YOE A;  2WN9 A;  5CO5 A;  3U8K A;  4LML A;  5AFH A;  5AFK A;  3U8L A;  4A98 A;  4HFE A;  3P4W A;  2W8F A;  4QAB A;  5HEU A;  2BJ0 A;  5J5F A;  2LLY A;  2BG9 B;  4Z90 A;  2LM2 A;  2BYN A;  4XK9 A;  1UX2 A;  2WNC A;  2XZ5 A;  5J0Z A;  4ZJS A;  3SQ9 A;  5J5I A;  4ZK1 A;  2Y56 A;  5KZU A;  2BG9 E;  2XQ5 A;  3WTN A;  3C79 A;  3WTL A;  3JAF A;  4HFI A;  4FRR A;  4UM1 A;  3IGQ A;  5HCM A;  5AFJ A;  4AFG A;  3RIA A;  3TLS A;  4Z91 A;  2YKS A;  1OED B;  4TWF A;  2WZY A;  5L4H A;  3RQW A;  4HFH A;  3U8N A;  5HEH A;  2YMD A;  5AFM B;  5SYO A;  2VL0 A;  4LMJ A;  4HQP A;  3LSV A;  3WTI A;  5J5H A;  4NPP A;  3TLV A;  4LMK A;  2XQ9 A;  3T4M A;  1OED C;  2M6B A;  2BR7 A;  4ZJT A;  2BYR A;  3UUB A;  3JAE A;  4AFH A; 
#chains in the Genus database with same CATH topology
 4YJ2 E;  2CHO A;  2XYS A;  2LSI A;  3ZN1 B;  3O9X A;  3I0Q A;  4PK4 A;  3ONL C;  3P4S A;  2WWV A;  3AB3 B;  3U78 A;  2XQ4 A;  4YTM A;  3WTM A;  1XZY A;  2JRK A;  3AED A;  4U7Y A;  3J9X 1;  3LK4 2;  4IIJ E;  4CQI A;  4ILU A;  2BS3 A;  1NWM X;  2C5J A;  5L3B B;  4UM3 S;  3AEC A;  4JI2 T;  3DTO A;  3VHL A;  3KBT A;  2A9U A;  3WIP A;  4UV8 B;  3FXD B;  2Y7Y A;  2DL1 A;  3N2G E;  5LA6 E;  2UUB T;  5HYA A;  1OED A;  4LF8 T;  4U74 A;  2JQ9 A;  3RYI E;  1UV6 A;  1JNR A;  5ABH A;  3AXJ B;  2C0S A;  1KFY A;  3AEE A;  5AFK A;  2FBW A;  1MMD A;  2BG9 B;  5CA1 E;  2BDE A;  1N34 T;  3LBX B;  4XK9 A;  4FJO A;  2BG9 E;  5C2T A;  5FY7 A;  3IA3 A;  2CHN A;  5JRC A;  4CN6 A;  2HN2 A;  2DWK A;  2UU9 T;  2LSY A;  3ZYK A;  2X51 A;  4NIQ A;  4HFH A;  5AQS B;  3ZT7 A;  4HQP A;  2D5U A;  2Q9Q C;  2ZM6 T;  3K1S A;  2V26 A;  2Q9Q A;  5JDL A;  4ZJT A;  2CEA A;  5J2U E;  5JR9 C;  2V5C A;  3ZMT B;  5FXV A;  2SPC A;  2H3R A;  4CN1 A;  3CML A;  3UU3 A;  5LBM A;  2C5K T;  5J5G A;  3RIU C;  3C4Z A;  4O4I E;  4EZ4 A;  1VRB A;  4U2Y A;  2DNX A;  4JEH B;  3RIF A;  4QAA A;  4EOZ B;  5HEG A;  4Q25 A;  4UEM A;  3I9Y A;  2WQY A;  4BQT A;  4QH4 A;  4UVB B;  2H7V C;  2Y57 A;  3TLU A;  4EEB A;  4ILC A;  3O1I A;  5LG3 A;  4UM3 P;  2JPF A;  3SQ6 A;  3RYF E;  4ZZB A;  4JI0 T;  1X79 A;  1SA0 E;  2F4V T;  3OPC A;  2H7O A;  3RQU A;  5L4E A;  3RI5 A;  5AFN A;  2VVN A;  2BBJ A;  3H37 A;  4EXT A;  3BQK A;  4CI2 B;  2XNT A;  2W8G A;  1X9B A;  4WW0 A;  2X9H A;  2UUC T;  4PW8 A;  2EHO D;  1V9D A;  3QK6 A;  2VAS A;  3NBX X;  4IDO A;  3AEA A;  2KMF A;  4B3R T;  5KDM C;  2KWH A;  4ZJS A;  5HCM A;  4GKK T;  2LRK A;  4TV8 E;  3PUX F;  3A5X A;  1YXR A;  2D0U A;  3E08 A;  3ZSS A;  1ZOY A;  4YSY A;  3AVS A;  3N9N A;  2UUA T;  1ZHC A;  2XQ3 A;  3WTK A;  3Q5D A;  4DV5 T;  2J47 A;  3DJB A;  3N9Q A;  2WDR A;  4TNV A;  2WM9 A;  3ZT6 A;  3LK2 B;  4ZI3 D;  4COF A;  2KZ7 B;  3ZDG A;  2V7J A;  2VKH A;  2ODU A;  1J5W A;  3P50 A;  1CUN A;  2LKH A;  4P1N A;  3TLW A;  2XAS B;  1I94 T;  1WRD A;  1IBM T;  1D1C A;  4O2B E;  3AEB A;  3F31 A;  3SFE A;  4ZR6 A;  5L3E B;  4IRE A;  2I6H A;  3VKG A;  4UV9 B;  2E9X B;  3N9M A;  4I4T E;  4KMC A;  3C4W A;  2KIN B;  2WDQ A;  2N9D A;  2WN9 A;  5CO5 A;  3PV0 F;  1XMO T;  3W15 B;  3ZT5 A;  4TUY E;  5H6Q B;  1UX2 A;  2FUP A;  4DV4 T;  5J0Z A;  4GIW A;  3ESL A;  5CA0 E;  3WTL A;  4X1I E;  3HR0 A;  2KXP B;  2BS2 A;  2LM9 A;  4Z91 A;  2YKS A;  5HXC A;  5BR8 T;  2WZY A;  3RQW A;  3MK7 C;  3PUS A;  1H7C A;  2VVS A;  2OA5 A;  3MJX A;  3L8R A;  4F8H A;  4JI8 T;  2LSK A;  1M62 A;  2C5I T;  4A56 A;  4LF4 T;  3OYX A;  2V6Y B;  4U3C A;  2WMN A;  5JME A;  3UQ4 A;  3C84 A;  3PUY F;  2DI4 A;  2A3D A;  1T72 A;  2X68 A;  3AXJ A;  1FMV A;  3FB2 A;  3ZCJ A;  2BBH A;  3RLF F;  4P0B A;  2IML A;  1IJ6 A;  5DQV A;  5FY1 A;  5TVC A;  4B5D A;  3ZKR A;  4I43 B;  1OWA A;  2WMO A;  2DLR A;  4QX7 B;  1O3X A;  5LGT B;  2KWI B;  2FJE A;  4HGA A;  5HCJ A;  1BR4 A;  2E8I A;  2UZ6 A;  1J5E T;  2PGZ A;  3UU4 A;  2VUR A;  1VOM A;  5JDG A;  3WTJ A;  3CVR A;  3SFD A;  4PJM A;  4GYS A;  4UF0 B;  4BJM A;  4DR2 T;  1KNZ A;  4YFS A;  4EYU A;  5ADX L;  4B3S T;  4X20 E;  4KHP T;  4TZ4 C;  4YLH A;  5J5F A;  2CXD A;  1MMN A;  4NXM T;  2LM2 A;  3OTO T;  4X64 T;  2CBJ A;  3PUV F;  3SQ9 A;  4OFZ A;  4ZK1 A;  2DCF A;  5AQV B;  1E1H B;  2AXD S;  5BMV E;  1T8B A;  3LK3 B;  1HS7 A;  4DV7 T;  1HX1 B;  2BKO A;  5GON E;  1LVF A;  2OLT A;  5FXX A;  1LRZ A;  5LNK A;  3BK9 A;  3T4M A;  5LMU T;  5JR9 A;  4DBM A;  2UXB T;  4QXC B;  2XY8 B;  3IF8 B;  1MMA A;  1KF6 A;  4UM3 A;  3UU6 A;  3GA8 A;  5AFL A;  1FMW A;  1AJ3 A;  2IW5 B;  2WSS V;  3FBZ A;  3S4U A;  5ABF A;  5ABF B;  5AQJ B;  2XAH B;  3RRC A;  5J2T E;  4DV2 T;  1WLX A;  3FZF B;  3AE2 A;  3AE8 A;  4JI3 T;  4QXH B;  1D1B A;  3LBX A;  3C64 A;  5IUX A;  4DVD A;  4AIS A;  5DJQ C;  2B1E A;  2WCA A;  3EI0 A;  5JH7 E;  4LFB T;  3FZM B;  3BQL A;  2KND A;  5ETW A;  1N32 T;  4UVC B;  2XQ6 A;  1D0Z A;  4HFC A;  5KMG P;  1FJG T;  4PIR A;  2BYP A;  1FIO A;  5KX5 E;  5IYZ E;  5M4Y A;  5AFH A;  3ZEF B;  2JJ9 A;  2A2F X;  1WCR A;  4CI1 B;  4IE0 A;  2H89 A;  5J5I A;  3PUR A;  2NR4 A;  1MNE A;  3AAA B;  2ZLY A;  1EZ3 A;  3PUW F;  4DR5 T;  1NAF A;  2XPK A;  5LXT E;  5AQK B;  1QUU A;  1D0X A;  1US7 B;  2LHR A;  3MZK B;  3NWI A;  2XAQ B;  3RF1 A;  5JDQ A;  3AAE B;  4OHF A;  4NXN T;  1YQ3 A;  5F3J A;  4A97 A;  3KBU A;  5A1L A;  2X9W A;  4PJL A;  3R84 B;  4IE6 A;  2ACZ A;  3VRB A;  1UCU A;  3JCF A;  3ZMS B;  2V6Y A;  5J1G A;  2W63 A;  1WYC A;  1SE7 A;  5FL0 A;  2AE9 A;  2NTY A;  2J1D G;  4YT0 A;  3N2K E;  2BG9 A;  3B5M A;  4IST A;  2HPL A;  2BG9 C;  2UXN B;  3UQ7 A;  3OYZ A;  3OBV E;  2PJQ A;  1JNZ A;  2HPJ A;  5L47 A;  4ZI2 C;  3TLT A;  2XSA A;  5HWX A;  2X67 A;  3RC8 A;  2LJL A;  3M3Z B;  4MAL A;  2JQK A;  1IBL T;  3RH3 A;  3L09 A;  2IDO B;  4E7Z A;  1LKX A;  3RKO A;  5L3G B;  3C79 A;  3JAF A;  3MXZ A;  2XQY A;  4AFG A;  4LF6 T;  2JMH A;  5HXS A;  4H63 V;  5AQF B;  3ZMU B;  5LCY A;  3AVR A;  2PBI A;  2X0H A;  2XM1 A;  1YKH B;  2VK9 A;  4LFA T;  2Z6E A;  3UUX B;  4BJN A;  5FP3 A;  4AI6 A;  1HNW T;  4AFT A;  4EB6 E;  4ZS3 A;  2QC1 B;  3OJA A;  1XMQ T;  3CQC B;  1Y01 A;  3PMZ A;  4YSZ A;  2MAW A;  2HH7 A;  3B13 A;  1T98 A;  3EUH A;  5ABG A;  3AE1 A;  1YQ4 A;  4QWN B;  3AE4 A;  5LGU B;  3ETV A;  1LVK A;  3O1H A;  4HN9 A;  4AKG A;  4LF5 T;  3WAJ A;  4YXD A;  3ZJ2 A;  2XNU A;  3RYC E;  4DO0 A;  1UW6 A;  2VKD A;  2GK9 A;  3ZDH A;  4X1K E;  4KUM B;  5FJV A;  4OK0 A;  5F5W A;  4TWH A;  4H9O C;  4AQF A;  5KXJ A;  2EHO A;  2VKJ A;  2EHO B;  4UY2 A;  2CXL A;  3T8O A;  4JI1 T;  3SS1 A;  3U8K A;  3FXE B;  2E9X C;  2IIU A;  2RPA A;  4QKN A;  5EK2 A;  4EAH A;  2CM0 A;  1S35 A;  4IDQ A;  4I50 E;  4YY3 T;  2YEV C;  5LP6 E;  3Q5X A;  3ZST A;  5AFJ A;  4IDZ A;  3PUA A;  2PG8 A;  3U8N A;  2IUB A;  5AFM B;  2XQ9 A;  5CGM A;  4JI7 T;  3ZPO A;  2NW8 A;  2Q9Q D;  2HHH T;  5AQN B;  4ALX A;  3QC9 A;  4JUY A;  3QB5 A;  2YN6 A;  4ZK4 A;  2Y6X A;  4IHJ E;  3RX6 A;  2KT9 A;  4A5X A;  2W62 A;  4I0U A;  3N9P A;  3OVU A;  4ZOL E;  2WAU A;  4IT4 A;  2W00 A;  3KIN B;  5HXH A;  3CWZ B;  4DID B;  2PFV A;  1I6Z A;  3P7I A;  4MHC A;  2WBL A;  1QSD A;  4BFQ A;  3QUJ A;  2V8S V;  3IEE A;  1Z0P A;  4HKA A;  3NRY A;  4EYY R;  2V6X A;  3U8M A;  4XZC A;  5IWA T;  5AQT B;  2YDQ A;  4O4H E;  4AQG A;  2BVL A;  3ZMZ B;  2K48 A;  2YDR A;  5LJN A;  3CQX C;  3SWH A;  4L0R A;  5DAB A;  3O1J A;  4LML A;  2XAF B;  2W4X A;  2LLY A;  2ZM8 A;  2CWY A;  4UEL A;  2BYN A;  3CIR A;  2D2S A;  4HTE A;  4ADZ A;  1UGO A;  4PFO A;  3KVB A;  3ONX A;  4UXN B;  3RGL A;  1UUS A;  4PK5 A;  1GQE A;  4EV6 A;  3P4Q A;  4AIU A;  5LYJ E;  3R6N A;  5LHG B;  2N2N A;  4NPP A;  4OYK A;  4UVA B;  5LOV E;  3EVY A;  1W9R A;  2WU2 A;  2L3L A;  4M1P A;  2CLY B;  2BYS A;  3NVO A;  2L9Q A;  2WDV A;  5FVK A;  2ZMA A;  2LKG A;  2WWU A;  5H6R B;  2WS3 A;  1U4Q A;  2J4G A;  3CQG B;  3SRZ A;  2YDS A;  2VB6 A;  3T1Y T;  4ZHQ E;  3PU3 A;  4AKI A;  1HTJ F;  2LE8 A;  4HWH A;  2UXX B;  2K5B B;  5CFB A;  4HFB A;  2ZM0 A;  2MBG A;  2WZI A;  4LF9 T;  3C98 B;  3LG7 A;  3AEG A;  3AEF A;  2WB5 A;  3TKL B;  3WTO A;  2XQA A;  4MLK A;  4HE8 A;  4WBO A;  2ODV A;  3Q9D A;  1WR6 A;  3HA4 A;  3FZL B;  4IGU A;  5HEO A;  1ZP0 A;  4DV0 T;  2DHR A;  2RA1 A;  3MAC A;  4L9I A;  3ZJ1 A;  3Q5W A;  3KV9 A;  5LMN T;  1UX5 A;  4CXY A;  3JC6 D;  4EGW A;  5FNV E;  5LJM A;  5KZU A;  4EED A;  2Y56 A;  3AA1 B;  3WTN A;  5JVD E;  4PJN A;  4L5G A;  1R8I A;  2E9X A;  3O4X E;  2J62 A;  3I0O A;  1N36 T;  2V7L A;  3A7M A;  4DND A;  3PUZ F;  5EZY E;  5FKY A;  4CI3 B;  2BKN A;  2M6B A;  1FEW A;  3EDV A;  2NTX A;  4AFH A;  5L2L A;  5BP0 A;  1MIV A;  2IHR 1;  3ETU A;  3EHZ A;  1KNR A;  4TNW A;  4TWD A;  2XZ6 A;  2QYW A;  2I0M A;  2XSB A;  5JDN A;  2NWB A;  5FL1 A;  3EDU A;  2A72 A;  2XYT A;  2K3W A;  3NZQ A;  5FXW A;  3AE6 A;  5HEJ A;  3PJA A;  4JEU B;  3U3I A;  2UXC T;  2ZJU A;  4KP3 C;  4IE7 A;  3UUL A;  1YD8 G;  4E7S A;  2JQQ A;  2X00 D;  4PAG A;  1KK7 A;  5FXZ A;  2BS4 A;  3ONJ A;  4DR7 T;  4XHE A;  5AQG B;  3RRW A;  2JQH A;  3RIU A;  4X5T A;  5AQM B;  3RKG A;  2LOP A;  3RC3 A;  3Q5E A;  1MND A;  4EZ1 A;  2LSG A;  2W61 A;  4YSX A;  2MYS A;  3C51 A;  4ZEY A;  5L3C B;  4H9Q C;  5TAO A;  3ZLI A;  1HFA A;  4FRR A;  5LHI B;  2YU1 A;  3B57 A;  1MMG A;  3TLS A;  2V5D A;  1HNZ T;  3P4R A;  5L4H A;  4WYV A;  1OXZ A;  2K9A A;  3AAI A;  4U72 A;  2VL0 A;  2FJD A;  2CPT A;  4J2C A;  5HXR A;  3ZC0 A;  1HCI A;  1XNR T;  2ZJV A;  4ILA A;  4KHZ F;  4QX8 B;  2X00 A;  3ANW A;  4DMV A;  4JI6 T;  4DV3 T;  3VR9 A;  4QAC A;  3WTH A;  2CBI A;  3PEO A;  3GMI A;  5BW2 A;  2C9T A;  5FVL A;  4U7I A;  4N78 D;  4CN4 A;  1HNX T;  1G73 A;  4WBN E;  4ISS A;  2CRB A;  5HXE A;  3C50 A;  3CKD A;  1J1J A;  3VR8 A;  3K8P C;  1SHZ C;  3KV5 A;  2HN1 A;  2BR8 A;  3OKQ A;  4TN7 B;  1WR0 A;  3GN5 A;  3I1A A;  3E22 E;  5L3D B;  4U33 A;  3QNU A;  4YJ3 E;  4ERR A;  3F2E A;  4ZI3 C;  4X65 T;  2P9B A;  4TV9 E;  2MOZ A;  4EZH A;  5AIN A;  3MKD A;  3CX6 B;  2YME A;  3N2O A;  1ZV4 X;  5JRC B;  3KDS E;  1XDP A;  2NOX A;  5FYM A;  2QRX A;  4QH1 A;  4TX5 A;  4IDN A;  2NW7 A;  3N9O A;  2CA5 A;  2X0L B;  2Y8D A;  2IC9 A;  1HG2 A;  4H9N C;  2VL8 A;  3AA6 B;  5C8Y E;  5C3J A;  5AQP B;  4HWF A;  3AE9 A;  5E0O A;  3CX8 B;  3RIA A;  4JLE A;  5AFU L;  1OED B;  4TWF A;  5SYO A;  3WTI A;  4DR3 T;  5CB4 E;  4JI4 T;  4G63 A;  1IAP A;  1W0B A;  4O8S A;  2XNV A;  2LHN A;  4QHO A;  5EK3 A;  4AXP A;  5AQU B;  1Y64 B;  5FMN A;  2LSJ A;  4HFD A;  1IJ5 A;  2X9X A;  3FZK B;  1M7K A;  1QLB A;  2R6G F;  4HFV A;  4WNK A;  4H9S E;  2QA7 A;  2KLQ A;  4P09 A;  4JI5 T;  5HAX A;  2XQ8 A;  3PTR B;  3SIO A;  2IAK A;  1I9B A;  5ABE A;  4AKL A;  1T7S A;  5LXB A;  2KSR A;  4U2Z A;  2V7K A;  5AQL B;  5KE4 A;  4KI0 F;  2Y58 A;  3QB5 K;  5AQI B;  4DUY T;  3U8L A;  1IBK T;  2D9D A;  5HEU A;  2BJ0 A;  1UX4 A;  2JIW A;  2EHO C;  4DBQ A;  3H3M A;  5AQQ B;  2WP9 A;  2WU5 A;  2WNC A;  2XZ5 A;  1D1A A;  4AKH A;  4AKR B;  3V5U A;  4GYR A;  1IZN B;  4KX6 A;  2FJB A;  2V7I A;  5HEH A;  3ZYL A;  4CXX A;  2V7M A;  1VCT A;  4GKJ T;  2D0T A;  4ZXL A;  2BR7 A;  4GK5 E;  2BYR A;  3X1D A;  3JAE A;  5AFM A;  3KFW X;  2ZM2 A;  4DUZ T;  5EK4 A;  2VWA A;  4NZB A;  2Y48 B;  2I59 A;  1KNP A;  2XAG B;  4MFR A;  2X66 A;  3GWH A;  2XAJ B;  4H9R C;  2M6I A;  3KVA A;  2LRL A;  3VU7 H;  5LGN B;  4UF0 A;  3HKC E;  3FZH B;  1OED E;  3LFM A;  3U8J A;  4D01 A;  4IL4 A;  2W0G A;  5AQR B;  1L0V A;  2JMK A;  4YHH T;  1NEN A;  2FJA A;  2NP9 A;  3N9L A;  1U5P A;  2CWO A;  5LG4 A;  3ZCI A;  4ZI2 D;  5F8P A;  5BRX A;  3UU8 A;  3Q2M A;  4ZRU A;  1KEY A;  2Y54 A;  4H9P C;  4DBR A;  4K0U A;  2PH9 A;  3CX7 B;  4CXW A;  3PJA J;  2DWG A;  3BQI A;  3HI2 A;  3UTK A;  3ZMV B;  1N33 T;  4X62 T;  1BR2 A;  4Z90 A;  2XHE B;  3QOF A;  2VKO A;  3KV4 A;  4ASK A;  3C4X A;  1XNQ T;  5LB7 B;  2BVM A;  4C90 A;  2Q9Q B;  4Z8X A;  3IHR A;  4IE5 A;  2VQE T;  3N5L A;  3AE7 A;  2CCQ A;  3PDY A;  1ZEE A;  2MTQ A;  3JC6 C;  3UFG A;  1MIW A;  4IE4 A;  2BZB A;  1MIY A;  2WZH A;  5JRE A;  2XM2 A;  3UUN A;  3UFE A;  2LT3 A;  2XJ7 A;  3SH1 A;  4GK0 E;  4OX9 T;  3ABV A;  3PU8 A;  2X9Y A;  2CLY C;  2YK0 A;  5LBQ B;  5FY0 A;  3SOL A;  5AQH B;  3F57 A;  1UK5 A;  3G06 A;  3NRX A;  2E5L T;  4AQF C;  2XQ7 A;  4XBF B;  3WAK A;  3FBL A;  3HKB E;  3NZP A;  1VCS A;  4YTP A;  4ZI7 E;  2WNL A;  5JTG A;  4MBQ A;  2OV9 A;  4ANJ A;  1ZKE A;  3PE0 A;  5HWY A;  4UR9 A;  1E2A A;  4DV6 T;  2WNJ A;  3UT5 E;  2K24 A;  4G2A A;  2NW9 A;  4K0K T;  3UUM A;  4IL9 A;  2M67 A;  1WYB A;  4JYA T;  2E9X D;  4YHJ A;  3J7Y q;  2VQF T;  2YIN A;  3P4W A;  3PUG A;  3FHN A;  4ZS2 A;  4I55 E;  4BA9 A;  4UM1 A;  3IGQ A;  2V1D B;  5JDH A;  1S94 A;  2XUE A;  2YMD A;  2UXD T;  3K3Q C;  5J5H A;  4IDP A;  1HF8 A;  3HKD E;  2E2A A;  5JDF A;  3HL6 A;  1XDO A;  2B76 A;  2WY2 A;  1BR0 A;  3GN5 B;  1YKE B;  1W09 A;  4OYJ A;  5AQO B;  2H88 A;  2G0U A;  4NUV A;  1UUR A;  1SUM B;  4F6R C;  3HKE E;  3UU5 A;  4GOU A;  4ZZC A;  2N1G A;  3P4P A;  3AE3 A;  3L39 A;  3A8Y C;  2QVA A;  3WI3 A;  2L8K A;  3EAM A;  3K3O A;  3CK6 A;  4WZX A;  2BYQ A;  2CMR A;  4PK6 A;  3VKH A;  4NUU A;  3P8C D;  4DMW A;  3EAB A;  4ILB A;  4DV1 T;  2W67 A;  5JDM A;  1W0A A;  4WV9 A;  4HWI B;  4UXU A;  5LHH B;  2YOE A;  4YTN A;  1XWM A;  4B3M T;  2W8F A;  2XTL A;  4LFC T;  2ACX A;  5CJ5 A;  2X0Y A;  2MPK A;  3AE5 A;  4V1A v;  4AQY T;  2XQ5 A;  4DR4 T;  3AA7 B;  3VRA A;  4HFI A;  1HX8 A;  4KBM B;  2BKP A;  4QXB B;  4JBW F;  2CE7 A;  5JR9 B;  4LMJ A;  2RP4 A;  3TLV A;  4LMK A;  1OED C;  4PJJ A;  3UUB A;  1NEK A;  4C91 A;  1B7T A;  3K3N A;  4BAY B;  3NKZ A;  4CZZ B;  4X66 T;  3GUA A;  4H63 H;  1HR0 T;  2W66 A;  4XAX B;  4DR1 T;  3I9W A;  1DU2 A;  4HEA A;  4DR6 T;  1WFD A;  2W2U A;  1HG5 A;  1E7P A;  3ZN0 B;  2XZE A;  4QH5 A;  3RHW A;  4FI5 A;  3LJC A;  3AA0 B;  3JAD A;  3H3A A;  3ANW B;  2YU2 A;  3KV6 A;  4O2A E;  1CHU A;  4HWC A;  4X1Y E;  3IBP A;  2LOS A;  4HWD A;  3T1H T;  3LDQ B;  2IC6 A;  4JV5 T;  1D0Y A;  1Z8U A;  3PUQ A;  4U31 A;  2CXF A;  3RPU A;  3V5S A;  4O4J E;  3E0Z A;  3MA9 A;  4EIW A;  3ZC1 A;  5IHY A;  5DQW A;  5L3F B;  3DP7 A;  3CPZ A;  3RYH E;  4B3T T;  4A98 A;  4HFE A;  4UIG A;  3ZYM A;  3L3P A;  4QAB A;  4PNI A;  1G8X A;  3D0T A;  3M65 A;  4PFP A;  2LEH A;  4LF7 T;  1YW0 A;  2PTF A;  2QGS A;  2ES0 A;  1BR1 A;  2E5V A;  3LSV A;  4P0A A;  4B6X A;  5JQG E;  4O4L E; 
#chains in the Genus database with same CATH homology
 4F8H A;  2BYS A;  5AFM A;  5BP0 A;  2ZJV A;  4ALX A;  2XYS A;  4ILA A;  2XNV A;  4DBM A;  2XQ3 A;  2X00 A;  3WTK A;  3GUA A;  3SH1 A;  4NZB A;  2YN6 A;  4ZK4 A;  4A97 A;  2LKG A;  4UM3 A;  3UU6 A;  4TNV A;  3EHZ A;  4QAC A;  2XQ4 A;  3WTH A;  5JME A;  4TNW A;  4TWD A;  3UU3 A;  3UQ4 A;  2XZ6 A;  3C84 A;  3PEO A;  5BW2 A;  5AFL A;  5J5G A;  4AFT A;  2C9T A;  3WTM A;  2QC1 B;  4COF A;  3RIF A;  4QAA A;  4HFD A;  2XYT A;  3ZDG A;  5HEG A;  2M6I A;  4QH5 A;  3UU5 A;  3RHW A;  3PMZ A;  2MAW A;  4BQT A;  4ZZC A;  4UM3 S;  2XQ7 A;  3P50 A;  5HEJ A;  1OED E;  3JAD A;  4QH4 A;  2ZJU A;  5TVC A;  3U8J A;  4B5D A;  2BG9 A;  3ZKR A;  5CFB A;  2Y57 A;  4D01 A;  4IL4 A;  3TLU A;  2LKH A;  2BG9 C;  2BR8 A;  4HFB A;  2X00 D;  3UQ7 A;  4ILC A;  5LG3 A;  2XNU A;  4UM3 P;  3WIP A;  2XQ8 A;  5IUX A;  4BFQ A;  3TLW A;  1UW6 A;  3SQ6 A;  3EAM A;  2WNL A;  4ZZB A;  2Y7Y A;  2BYQ A;  3WTO A;  5HCJ A;  3SIO A;  3ZDH A;  5L47 A;  4XHE A;  2XQA A;  3U8M A;  2UZ6 A;  3RQU A;  3EI0 A;  3UU4 A;  5L4E A;  2PGZ A;  1I9B A;  5FJV A;  3RI5 A;  3TLT A;  3WTJ A;  1OED A;  5AFN A;  4TWH A;  3UU8 A;  5BRX A;  5LXB A;  2KSR A;  2WNJ A;  5HEO A;  4ZR6 A;  4ZRU A;  4IRE A;  4X5T A;  2Y54 A;  5AIN A;  4ILB A;  2PH9 A;  2YME A;  1UV6 A;  2XQ6 A;  4IL9 A;  2W8G A;  2XNT A;  4WV9 A;  5KE4 A;  4HFC A;  2Y58 A;  4PIR A;  4UXU A;  4UY2 A;  4EZ1 A;  2BYP A;  4QH1 A;  2YOE A;  2WN9 A;  5CO5 A;  3U8K A;  4LML A;  5AFH A;  5AFK A;  3U8L A;  4A98 A;  4HFE A;  3P4W A;  2W8F A;  4QAB A;  5HEU A;  2BJ0 A;  5J5F A;  2LLY A;  2BG9 B;  4Z90 A;  2LM2 A;  2BYN A;  4XK9 A;  1UX2 A;  2WNC A;  2XZ5 A;  5J0Z A;  4ZJS A;  3SQ9 A;  5J5I A;  4ZK1 A;  2Y56 A;  5KZU A;  2BG9 E;  2XQ5 A;  3WTN A;  3C79 A;  3WTL A;  3JAF A;  4HFI A;  4FRR A;  4UM1 A;  3IGQ A;  5HCM A;  5AFJ A;  4AFG A;  3RIA A;  3TLS A;  4Z91 A;  2YKS A;  1OED B;  4TWF A;  2WZY A;  5L4H A;  3RQW A;  4HFH A;  3U8N A;  5HEH A;  2YMD A;  5AFM B;  5SYO A;  2VL0 A;  4LMJ A;  4HQP A;  3LSV A;  3WTI A;  5J5H A;  4NPP A;  3TLV A;  4LMK A;  2XQ9 A;  3T4M A;  1OED C;  2M6B A;  2BR7 A;  4ZJT A;  2BYR A;  3UUB A;  3JAE A;  4AFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...