4HFHA

The glic pentameric ligand-gated ion channel (wild-type) complexed to bromoform
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfhA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfhA01
1UW6A 4QABA 3UU5A 2YN6A 2UZ6A 2BJ0A 5CO5A 2Y54A 2PGZA 5J5IA 2XQAA 3RI5A 2Y57A 4LMJA 3C84A 3WTKA 5AFNA 5L47A 2PH9A 3C79A 2C9TA 2WZYA 4TWDA 2LKHA 5HCJA 4UM1A 2XZ6A 3RQWA 2YOEA 2BR8A 4A97A 2XQ7A 5HEHA 5J5GA 3WTMA 5HEGA 4HFDA 2XNTA 2XYSA 5SYOA 2XQ6A 2X00A 4IREA 2BYSA 3RIAA 4ZRUA 5AFLA 3TLUA 3UUBA 2WNLA 2WNCA 2MAWA 4QH5A 3SQ9A 4LMKA 3U8NA 5AFHA 5JMEA 2X00D 3WTHA 5AFMB 4DBMA 4XK9A 4TNVA 2XQ4A 4QAAA 2M6BA 3T4MA 2XQ9A 2BYNA 3EHZA 4ILBA 2XNUA 2BG9C 4F8HA 1I9BA 4UM3P 4NPPA 4A98A 1OEDA 3U8LA 2ZJVA 3ZDGA 5J0ZA 4ZJSA 5HEUA 1UV6A 3TLTA 3JADA 4XHEA 3IGQA 5J5HA 3WIPA 4LMLA 4ZZBA 4ZK1A 5L4EA 2BR7A 4ZR6A 2BYRA 4TWFA 4UM3S 2YKSA 3UQ4A 2WN9A 2LM2A 2Y58A 3ZKRA 3P50A 2YMDA 2WNJA 2BYQA 3TLWA 4IL9A 5KE4A 3PMZA 5HCMA 3WTJA 3RIFA 3U8JA 3JAFA 1OEDE 4IL4A 3WTLA 4AFTA 5BP0A 4AFGA 4QACA 1UX2A 4AFHA 2BYPA 5HEOA 4B5DA 4QH4A 2Y56A 4ZK4A 5LXBA 3SQ6A 4HFIA 3EI0A 2QC1B 4PIRA 3UU4A 4WV9A 2XQ5A 5AFMA 4UY2A 1OEDC 2LLYA 3TLSA 2M6IA 5AINA 2BG9B 4HFCA 4HFHA 4TNWA 3SH1A 3ZDHA 3JAEA 4QH1A 3UU6A 3WTOA 3U8KA 3TLVA 3RQUA 4Z90A 4NZBA 2W8GA 3PEOA 4BQTA 5BW2A 4X5TA 3EAMA 3UU3A 2XZ5A 4FRRA 2XQ3A 2KSRA 5J5FA 3RHWA 3LSVA 4HFEA 2ZJUA 4Z91A 2LKGA 4COFA 5IUXA 2XNVA 2VL0A 2YMEA 4EZ1A 5FJVA 5AFKA 5KZUA 4BFQA 4HFBA 4ZJTA 4UM3A 3WTNA 2W8FA 3SIOA 4ILAA 4ALXA 5HEJA 3WTIA 4D01A 3UQ7A 4HQPA 5AFJA 2XYTA 4ILCA 2BG9E 4UXUA 3P4WA 5CFBA 1OEDB 4TWHA 3UU8A 4ZZCA 3GUAA 5LG3A 2XQ8A 5BRXA 5L4HA 2Y7YA 3U8MA 2BG9A 5TVCA
chains in the Genus database with same CATH superfamily
3RYHE 3PV0F 3RH3A 2UXCT 2CA5A 5AFNA 2VKOA 4WNKA 2YINA 2BBJA 5SYOA 2XQ6A 1U5PA 2WNCA 3PTRB 2YU2A 2XZEA 2X68A 3AEAA 4QAAA 2JRKA 3Q5WA 3ZDGA 4Z8XA 2Q9QA 4ZK1A 4IIJE 2W66A 3LFMA 3FXEB 4U2ZA 5LHGB 4OHFA 2E2AA 4TUYE 2ZLYA 4GOUA 3VRAA 5FNVE 3SFEA 2WAUA 2V7LA 4PK4A 3ZDHA 1WLXA 3JAEA 3RKGA 3ZSTA 3O1JA 5FY7A 2WBLA 2LKGA 2Y48B 5J1GA 4COFA 4ERRA 4JI1T 4ISTA 1JNZA 4HWHA 2F4VT 4KP3C 2WZIA 3CX7B 4DV7T 2WB5A 3NRYA 3B57A 1S35A 5HWXA 2KMFA 4U33A 2JQKA 1WFDA 2L8KA 2XTLA 3WTKA 4DR3T 4TWDA 2W00A 3MACA 4LF6T 4HFDA 2DI4A 4AQFA 1YXRA 2X00D 5M4YA 3RF1A 1UX4A 2XNUA 3AEBA 3FZLB 3JADA 2BKPA 4UVCB 5JDGA 3TKLB 2DLRA 2BBHA 5CGMA 1MIVA 2WN9A 2G0UA 2OV9A 3ONXA 3CKDA 5ADXL 2BS3A 3AB3B 4B5DA 2CHOA 1NAFA 5LXBA 3N2GE 4DR7T 1T8BA 3N9NA 3P4PA 4EXTA 4IE4A 4GKKT 5AQPB 2DCFA 2ZM8A 4LFBT 1YQ3A 4LF9T 3X1DA 3ZMUB 4UVAB 2ODVA 2W62A 3ZMTB 3CPZA 4OK0A 3UUNA 4U7YA 3N9MA 1MMDA 2W8FA 3UQ7A 4YXDA 2XQ8A 1UCUA 2J47A 2BKOA 3H3MA 2DHRA 5EK4A 3P7IA 4NXNT 3PUAA 3N9QA 4U7IA 2BJ0A 5HXCA 3AEDA 4LMJA 2LKHA 3JCFA 5AQVB 2E9XD 1MMAA 5LGNB 3LK3B 1W9RA 4BJNA 5DABA 4HFVA 3TLUA 5JMEA 3SQ9A 5IHYA 2XQ4A 5TAOA 3CX6B 4L0RA 4EAHA 5C2TA 2LHRA 3C50A 5JDNA 5J5HA 2M67A 3AA7B 4JI3T 4L9IA 4QWNB 3VRBA 3PUQA 2CXLA 3F57A 3PUSA 4TWFA 4UM3S 2CMRA 1D0ZA 3P50A 2AE9A 3PMZA 3RPUA 1OEDE 2RP4A 3CMLA 2DWGA 2IIUA 1OEDC 3RGLA 3OJAA 4HFHA 4ZS3A 3HA4A 4H9RC 3PU8A 1HNXT 3UFGA 3Q5EA 2LSIA 1MMNA 3T1HT 2L3LA 4UR9A 3EAMA 2V6YA 2X9XA 5JDLA 4DMVA 2J1DG 3IHRA 2R6GF 5LMUT 2FJAA 4QXBB 5FJVA 1NEKA 2XAJB 3HKDE 2P9BA 4D01A 3ZCIA 4EZHA 3G06A 3RRCA 1NWMX 2Y7YA 4HWCA 3M65A 5KDMC 1D0XA 4PFOA 4YLHA 3ZPOA 4PJLA 3CX8B 5AQMB 2LEHA 2WWVA 4F6RC 1Y01A 3ZMVB 5ABFA 2FJEA 2BG9C 1X79A 5LGTB 1YW0A 4PW8A 1UV6A 2Q9QD 5JR9C 4FJOA 4PJNA 3RX6A 3MA9A 4YT0A 2Y58A 3C64A 4YHJA 4PK5A 4IL9A 3EDUA 5HCMA 2X9YA 3AEGA 1XNRT 4ILUA 5LOVE 4DR6T 3QK6A 4GYSA 3IBPA 2K9AA 4AQYT 1G73A 4HFCA 5EK3A 4KMCA 1T7SA 3AAAB 4I43B 2VVSA 4KUMB 4BQTA 4PAGA 3MK7C 1I6ZA 2LSJA 5CB4E 3ZN1B 1XMOT 2VL0A 5CJ5A 2VKDA 2GK9A 5AQGB 4DV3T 2UUBT 2ACXA 3P4WA 4ZZCA 5LG3A 1FMVA 3FHNA 2X9WA 2ZM2A 3U8MA 4HGAA 5ETWA 3EDVA 5TVCA 3QNUA 4EEBA 2V6XA 2Y54A 3SOLA 3ANWA 4P1NA 3KINB 4H63H 2XNTA 4UIGA 5KXJA 3ZC1A 2BYSA 5AQFB 2H7VC 4LMKA 3FXDB 3U8NA 3NKZA 4DNDA 2M6BA 3EHZA 3U8LA 3PU3A 3UT5E 3ZLIA 4IDNA 1ZV4X 3GN5B 2XQYA 3OTOT 4AKIA 3RYFE 3KV6A 1B7TA 1N32T 2E9XC 3ZT5A 4CN6A 2WMNA 1KEYA 1MIYA 3V5SA 3AE5A 3E08A 4O4JE 3OPCA 4CN4A 5BP0A 4OYKA 4ZK4A 3AE2A 5L3EB 4O4LE 4CQIA 1E7PA 1UUSA 4DBQA 5AINA 3ONLC 2MOZA 2UUCT 5AQRB 2FJBA 2NTYA 4JEHB 3LSVA 2DWKA 4DIDB 3AAIA 3BQLA 3VR9A 2IMLA 4B3ST 4EZ1A 4M1PA 5FVLA 2NW7A 4G2AA 4KX6A 4CI1B 5C8YE 4C91A 4V1Av 3FZFB 3GUAA 3N9LA 2A72A 2XQAA 2WM9A 3UULA 1IBMT 2C9TA 3ZN0B 3ZEFB 1E2AA 2XQ7A 2B76A 3UUXB 4B6XA 3WTMA 2D0UA 2WZHA 2NWBA 4ZRUA 2WNLA 2MAWA 4IDQA 4JUYA 2ACZA 1U4QA 3HKEE 4EIWA 4U31A 3AEEA 5JVDE 1LVFA 2EHOB 4TN7B 4AKLA 4DBRA 4BJMA 3ZJ2A 4A98A 3I9YA 2KINB 2V7IA 4ZJSA 3RC8A 4IE0A 5JDFA 2BYRA 4DUZT 4XAXB 5FKYA 2YMDA 2WNJA 3CVRA 1IZNB 4OYJA 2NW9A 2WCAA 5ABEA 2BYPA 3VU7H 4IE7A 2A2FX 3VR8A 2JQHA 2FBWA 4UY2A 2H89A 3LBXB 2HN2A 2Q9QC 4MALA 4ANJA 4J2CA 3TLVA 2W8GA 4WYVA 1NENA 2KSRA 3C4ZA 4X20E 1ZKEA 3R6NA 2HPJA 5FYMA 4ZI3C 3K1SA 1QUUA 2W63A 4BAYB 4AXPA 2JQ9A 3LK42 4CXXA 4DO0A 3UU8A 3Q9DA 2WDRA 4U2YA 1HS7A 4JI0T 2XY8B 4QABA 1KF6A 1XZYA 5CO5A 3LDQB 3GMIA 5LHHB 3C79A 5AQNB 5AQJB 4I4TE 5HAXA 4XBFB 2XAQB 1M62A 4ZEYA 2A9UA 1J5WA 1S94A 2VWAA 2E5LT 1IJ5A 2I6HA 2B1EA 5IWAT 2XASB 5DQVA 4ZI7E 5AQSB 3EABA 3QB5A 2CHNA 4NPPA 4X64T 1Z0PA 2KNDA 2UXDT 3ZKRA 3A8YC 1OXZA 5CA0E 3MJXA 4AQFC 5LBMA 4YTPA 4MBQA 1XDPA 5LHIB 4LFCT 2XAHB 4QHOA 3J9X1 3P4RA 5FL0A 3O1IA 2C0SA 2OLTA 5LYJE 1J5ET 3UU3A 4U3CA 4FRRA 3RHWA 5FXWA 3PUVF 3UUMA 1KNPA 3K3NA 5KZUA 5BMVE 2J4GA 2JQQA 4JLEA 4O2BE 4NXMT 2XM2A 2N1GA 1D1BA 5CFBA 2MPKA 3DTOA 3AEFA 3CK6A 5FXVA 2UXBT 2NR4A 4YSXA 5LNKA 2YN6A 3HKBE 4EYYR 1GQEA 3WAKA 2LM9A 3DP7A 4E7ZA 2IAKA 4JEUB 3S4UA 2I0MA 2Y8DA 2BR8A 2KWIB 3D0TA 4IDOA 3RIAA 4CXWA 3RKOA 3OYZA 4HKAA 3N2OA 3PUGA 4F8HA 2V1DB 5J2UE 3EUHA 3ZMSB 1US7B 2VVNA 3L39A 1M7KA 1T98A 2LE8A 3VKHA 3DJBA 5L3CB 4O4IE 1FJGT 5HYAA 3OKQA 1VCTA 2WMOA 4UF0B 5FY1A 3LJCA 1D1AA 3SFDA 1VOMA 4AFHA 1WR0A 4QH4A 1KK7A 1AJ3A 4HFIA 3NVOA 4WV9A 3ZMZB 1FIOA 2WP9A 5IYZE 1BR2A 3SH1A 2W61A 4TV9E 2IUBA 4N78D 3VKGA 2LSKA 3K8PC 5GONE 3PE0A 5J5FA 2XQ3A 3P8CD 1L0VA 2ZM0A 1YD8G 2CLYC 3CQXC 4DR1T 4EGWA 4NUUA 4K0UA 3UFEA 2YMEA 5AFKA 3P4SA 2BS4A 5DJQC 5JDQA 1I94T 3SIOA 2KXPB 4TX5A 4E7SA 2XHEB 2HN1A 2C5JA 2PGZA 2XUEA 1WYBA 4EZ4A 3P4QA 2YOEA 3UTKA 3VHLA 4OFZA 4TV8E 5HEHA 2CBJA 3WI3A 4ASKA 4H9OC 4QKNA 4QH5A 3ABVA 1HG2A 4XK9A 3L8RA 4DVDA 3ZC0A 4CI2B 2BVLA 2XQ9A 2VK9A 5HXSA 2CRBA 2QYWA 1X9BA 3ETVA 2XAFB 2YDQA 4PFPA 2PTFA 2IW5B 1HF8A 2BVMA 3SS1A 2OA5A 1ZP0A 4HTEA 3NRXA 1IBKT 1N36T 4ZI2D 3JAFA 3WTLA 2JMKA 1FEWA 3E0ZA 5JTGA 1HFAA 5CA1E 4PIRA 2FJDA 3AA6B 2ZMAA 3U8KA 1SHZC 2UXNB 3GN5A 2WWUA 3IA3A 5HXRA 5FXXA 4MHCA 3RC3A 4KHZF 3C51A 3SRZA 4AI6A 2KWHA 4PNIA 4UV8B 3OYXA 4Z91A 3ETUA 2IC9A 3AAEB 3CQCB 4BFQA 4ZJTA 4UM3A 4ALXA 3WTIA 3AVSA 1UX5A 2VKJA 4JI8T 4UXUA 2HH7A 1OEDB 1OWAA 5BRXA 1SA0E 5LA6E 2WSSV 1QLBA 3E22E 3KBUA 3BQIA 2CXFA 2UZ6A 3Q5XA 3HL6A 1ZOYA 2BDEA 3RI5A 2WZYA 3C4WA 5F5WA 3GWHA 5HEGA 3NZPA 2XYSA 2YK0A 4IREA 5AFLA 5FP3A 4MLKA 1EZ3A 2CCQA 4DBMA 3AA1B 4DR2T 2C5IT 4KI0F 4JI7T 2YDSA 2BYNA 2X67A 4JI4T 1DU2A 2H7OA 2V26A 2CXDA 3WIPA 4ZR6A 2VURA 3AXJB 3JC6D 3MKDA 3TLWA 3NBXX 1V9DA 2KT9A 4I0UA 2RA1A 2E5VA 2FUPA 1W09A 5JREA 2QC1B 3NZQA 2BG9B 4GYRA 3AE7A 2EHOA 4X62T 4QXCB 3CQGB 4HWFA 4NZBA 5LXTE 5JR9B 4X5TA 5FMNA 4TZ4C 1YKHB 2I59A 5L3GB 1LRZA 4I50E 2CBIA 1O3XA 3LBXA 1Y64B 4DV2T 2V5DA 3RIUA 4P0AA 4AQGA 5C3JA 3KFWX 3N9OA 4H9PC 1R8IA 4GK0E 1T72A 5JDHA 5AFMB 2C5KT 4EB6E 2MTQA 4DV5T 3RYIE 4ZXLA 3CIRA 2W0GA 2H3RA 4WBNE 2JIWA 2VL8A 4EYUA 4LF7T 3W15B 3PUZF 5KX5E 4UEMA 2RPAA 4QX7B 2BYQA 3KV5A 3RIFA 1BR0A 5LCYA 2NOXA 4QACA 2XAGB 5HEOA 3FZKB 4CN1A 3EI0A 3RRWA 3UU4A 2LLYA 2LOSA 2PG8A 2QA7A 1YKEB 3NWIA 1HX1B 4YJ3E 1HTJF 3OBVE 2LRKA 1E1HB 1CHUA 5FY0A 2E9XB 4ZI2C 3FBZA 3O4XE 5L3DB 1H7CA 2JPFA 1Z8UA 4C90A 2W4XA 5LG4A 5LGUB 2V7MA 2VB6A 4HQPA 3AE6A 3FZMB 3F31A 4TWHA 4JBWF 1BR1A 4MFRA 5AQHB 5FL1A 2DNXA 3F2EA 1JNRA 3I9WA 1FMWA 2PH9A 4WZXA 4UM1A 4YJ2E 4UXNB 4KBMB 4JYAT 5AFHA 2X0LB 1J1JA 4ISSA 3PJAJ 2D0TA 3Q2MA 1WYCA 4WW0A 1I9BA 5LP6E 1YQ4A 3B5MA 5J0ZA 5DQWA 5HEUA 4XHEA 2IDOB 1KNRA 4GKJT 3ZYKA 4ZHQE 2LM2A 2N2NA 5L2LA 3FBLA 2BZBA 3CWZB 5KE4A 3AECA 3I0QA 5AQOB 3HKCE 3AE1A 4AFTA 2CWYA 1UX2A 4I55E 3AVRA 3SQ6A 4X1IE 4IDZA 1LKXA 4IDPA 1UK5A 1QSDA 3WTOA 1SE7A 3Q5DA 3QOFA 3T8OA 3JC6C 2MBGA 2ZM6T 4IT4A 5BW2A 4QXHB 2VKHA 2LOPA 2ZJUA 3N2KE 5JH7E 1MIWA 2QRXA 5IUXA 2W67A 2XNVA 3SWHA 2CPTA 3WTNA 2ODUA 4UF0A 3AE3A 4O8SA 2V8SV 4AKRB 4AIUA 3A7MA 4QX8B 2Q9QB 3QUJA 2WS3A 5F3JA 2MYSA 5KMGP 4X66T 3PDYA 5AQKB 5L47A 3PUXF 3LK2B 4IE5A 4A97A 5LJNA 4OX9T 4L5GA 5LB7B 1IBLT 5ABGA 3WTHA 3ZJ1A 3I0OA 3K3QC 3H3AA 4H9NC 2SPCA 1XWMA 3KV9A 2LJLA 5AFUL 4LFAT 3L3PA 5L4EA 2X51A 4YFSA 4DR5T 3AE9A 5JQGE 2KLQA 3ZYMA 3KVAA 4H63V 2K5BB 2N9DA 5LBQB 4ZS2A 1KFYA 3U8JA 2WU5A 1XMQT 4NUVA 4JI2T 4YY3T 2E8IA 4NIQA 2PJQA 3R84B 2WDVA 4YHHT 2X0YA 2EHOD 4U72A 3H37A 4B3RT 3ESLA 2WU2A 2IC6A 3BQKA 5HXEA 4A5XA 3MZKB 3A5XA 5FXZA 5JDMA 4CZZB 4H9SE 4DR4T 4JI6T 4BA9A 2KZ7B 3HI2A 4HN9A 4YSYA 3KDSE 3AE8A 1HNZT 4YTMA 4HWIB 4IGUA 2Y57A 3C84A 5HXHA 2NW8A 4YSZA 3KV4A 2UUAT 2Z6EA 4PJMA 3L09A 5J5GA 2X0HA 2CE7A 1ZHCA 5LMNT 3EVYA 2IHR1 3M3ZB 3UUBA 3N9PA 4B3TT 1IAPA 3T4MA 4H9QC 4UM3P 3ONJA 1N34T 2DL1A 3HR0A 1OEDA 4A56A 4JV5T 3TLTA 4PK6A 3ZYLA 4EEDA 3WAJA 5AQLB 3U3IA 3KBTA 3UQ4A 1W0AA 4DV4T 3WTJA 3FZHB 4U74A 3OVUA 1WRDA 3QC9A 4AFGA 2BS2A 5HWYA 2JJ9A 2XQ5A 3RYCE 5J2TE 4TNWA 4LF4T 3K3OA 4QH1A 4YTNA 4ZOLE 4Z90A 4P09A 3PEOA 2HHHT 2CM0A 2XZ5A 5AQUB 5L3FB 4HFEA 5EK2A 2PFVA 4DV0T 3AXJA 1G8XA 2W2UA 3V5UA 3IF8B 1IJ6A 5JRCA 2BG9E 5H6QB 4DMWA 4K0KT 1N33T 2BG9A 2LT3A 4EV6A 5A1LA 3RLFF 1WR6A 3PUYF 2JMHA 5J5IA 1VCSA 5L3BB 5JR9A 4HEAA 2UXXB 5HCJA 2CLYB 2XZ6A 5EZYE 3RQWA 1W0BA 5AQTB 2H88A 2CWOA 4G63A 5AQQB 2NP9A 3B13A 2X00A 1HG5A 2K48A 1LVKA 3ZT7A 2V7KA 2VQFT 5AQIB 1HR0T 3PUWF 4ILBA 4DV6T 4B3MT 4ZI3D 4AKHA 1D1CA 1UGOA 2WQYA 4LMLA 4ZZBA 3ZT6A 2NTXA 2V6YB 1KNZA 3O9XA 2BKNA 1HNWT 5F8PA 4DV1T 2K24A 1MMGA 2V7JA 3PJAA 2PBIA 4KHPT 2LSGA 5AFMA 3TLSA 3GA8A 1MNEA 3BK9A 3UU6A 3I1AA 4PJJA 3RQUA 4X65T 2XJ7A 2XM1A 4UV9B 4JI5T 2QVAA 3T1YT 3AE4A 4UVBB 5ABHA 4AKGA 5FVKA 1MNDA 5JRCB 1CUNA 4HFBA 3U78A 4ILAA 5ABFB 5HEJA 2LHNA 4IHJE 2XYTA 2XSAA 1UURA 2EHOC 4XZCA 1BR4A 4LF8T 2V5CA 1UW6A 4X1KE 3UU5A 3N5LA 3ZCJA 4FI5A 4DUYT 3IEEA 2D5UA 2LSYA 2E9XA 2QGSA 4GK5E 2UU9T 4EOZB 2VQET 4X1YE 3AA0B 4TNVA 2Y6XA 1WCRA 2YDRA 3O1HA 2AXDS 4P0BA 5LJMA 2A3DA 3RIUC 2ZJVA 4HE8A 2X66A 2XSBA 2L9QA 3IGQA 1XDOA 1XNQT 2BR7A 2YEVC 1VRBA 5H6RB 4O4HE 2YKSA 3PURA 4ADZA 3ZSSA 3C4XA 5E0OA 2YU1A 5BR8T 1HCIA 4IL4A 3MXZA 2X9HA 1HX8A 2K3WA 2Y56A 2CEAA 2XPKA 3FB2A 3C98B 2M6IA 2WDQA 4CI3B 4LF5T 4CXYA 2WY2A 4O2AE 2D9DA 4WBOA 3ANWB 2ES0A 1D0YA 4GIWA 3J7Yq 4Q25A 1ZEEA 4HWDA 2VASA 2D2SA 2HPLA 2J62A 3QB5K 4IE6A 5AFJA 3KVBA 1SUMB 4ILCA 3LG7A 2LRLA 5L4HA 4AISA 4UELA
chains in the Genus database with same CATH topology
1UW6A 4QABA 3UU5A 2YN6A 2UZ6A 2BJ0A 5CO5A 2Y54A 2PGZA 5J5IA 2XQAA 3RI5A 2Y57A 4LMJA 3C84A 3WTKA 5AFNA 5L47A 2PH9A 3C79A 2C9TA 2WZYA 4TWDA 2LKHA 5HCJA 4UM1A 2XZ6A 3RQWA 2YOEA 2BR8A 4A97A 2XQ7A 5HEHA 5J5GA 3WTMA 5HEGA 4HFDA 2XNTA 2XYSA 5SYOA 2XQ6A 2X00A 4IREA 2BYSA 3RIAA 4ZRUA 5AFLA 3TLUA 3UUBA 2WNLA 2WNCA 2MAWA 4QH5A 3SQ9A 4LMKA 3U8NA 5AFHA 5JMEA 2X00D 3WTHA 5AFMB 4DBMA 4XK9A 4TNVA 2XQ4A 4QAAA 2M6BA 3T4MA 2XQ9A 2BYNA 3EHZA 4ILBA 2XNUA 2BG9C 4F8HA 1I9BA 4UM3P 4NPPA 4A98A 1OEDA 3U8LA 2ZJVA 3ZDGA 5J0ZA 4ZJSA 5HEUA 1UV6A 3TLTA 3JADA 4XHEA 3IGQA 5J5HA 3WIPA 4LMLA 4ZZBA 4ZK1A 5L4EA 2BR7A 4ZR6A 2BYRA 4TWFA 4UM3S 2YKSA 3UQ4A 2WN9A 2LM2A 2Y58A 3ZKRA 3P50A 2YMDA 2WNJA 2BYQA 3TLWA 4IL9A 5KE4A 3PMZA 5HCMA 3WTJA 3RIFA 3U8JA 3JAFA 1OEDE 4IL4A 3WTLA 4AFTA 5BP0A 4AFGA 4QACA 1UX2A 4AFHA 2BYPA 5HEOA 4B5DA 4QH4A 2Y56A 4ZK4A 5LXBA 3SQ6A 4HFIA 3EI0A 2QC1B 4PIRA 3UU4A 4WV9A 2XQ5A 5AFMA 4UY2A 1OEDC 2LLYA 3TLSA 2M6IA 5AINA 2BG9B 4HFCA 4HFHA 4TNWA 3SH1A 3ZDHA 3JAEA 4QH1A 3UU6A 3WTOA 3U8KA 3TLVA 3RQUA 4Z90A 4NZBA 2W8GA 3PEOA 4BQTA 5BW2A 4X5TA 3EAMA 3UU3A 2XZ5A 4FRRA 2XQ3A 2KSRA 5J5FA 3RHWA 3LSVA 4HFEA 2ZJUA 4Z91A 2LKGA 4COFA 5IUXA 2XNVA 2VL0A 2YMEA 4EZ1A 5FJVA 5AFKA 5KZUA 4BFQA 4HFBA 4ZJTA 4UM3A 3WTNA 2W8FA 3SIOA 4ILAA 4ALXA 5HEJA 3WTIA 4D01A 3UQ7A 4HQPA 5AFJA 2XYTA 4ILCA 2BG9E 4UXUA 3P4WA 5CFBA 1OEDB 4TWHA 3UU8A 4ZZCA 3GUAA 5LG3A 2XQ8A 5BRXA 5L4HA 2Y7YA 3U8MA 2BG9A 5TVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UW6 A;  4QAB A;  3UU5 A;  2YN6 A;  2UZ6 A;  2BJ0 A;  5CO5 A;  2Y54 A;  2PGZ A;  5J5I A;  2XQA A;  3RI5 A;  2Y57 A;  4LMJ A;  3C84 A;  3WTK A;  5AFN A;  5L47 A;  2PH9 A;  3C79 A;  2C9T A;  2WZY A;  4TWD A;  2LKH A;  5HCJ A;  4UM1 A;  2XZ6 A;  3RQW A;  2YOE A;  2BR8 A;  4A97 A;  2XQ7 A;  5HEH A;  5J5G A;  3WTM A;  5HEG A;  4HFD A;  2XNT A;  2XYS A;  5SYO A;  2XQ6 A;  2X00 A;  4IRE A;  2BYS A;  3RIA A;  4ZRU A;  5AFL A;  3TLU A;  3UUB A;  2WNL A;  2WNC A;  2MAW A;  4QH5 A;  3SQ9 A;  4LMK A;  3U8N A;  5AFH A;  5JME A;  2X00 D;  3WTH A;  5AFM B;  4DBM A;  4XK9 A;  4TNV A;  2XQ4 A;  4QAA A;  2M6B A;  3T4M A;  2XQ9 A;  2BYN A;  3EHZ A;  4ILB A;  2XNU A;  2BG9 C;  4F8H A;  1I9B A;  4UM3 P;  4NPP A;  4A98 A;  1OED A;  3U8L A;  2ZJV A;  3ZDG A;  5J0Z A;  4ZJS A;  5HEU A;  1UV6 A;  3TLT A;  3JAD A;  4XHE A;  3IGQ A;  5J5H A;  3WIP A;  4LML A;  4ZZB A;  4ZK1 A;  5L4E A;  2BR7 A;  4ZR6 A;  2BYR A;  4TWF A;  4UM3 S;  2YKS A;  3UQ4 A;  2WN9 A;  2LM2 A;  2Y58 A;  3ZKR A;  3P50 A;  2YMD A;  2WNJ A;  2BYQ A;  3TLW A;  4IL9 A;  5KE4 A;  3PMZ A;  5HCM A;  3WTJ A;  3RIF A;  3U8J A;  3JAF A;  1OED E;  4IL4 A;  3WTL A;  4AFT A;  5BP0 A;  4AFG A;  4QAC A;  1UX2 A;  4AFH A;  2BYP A;  5HEO A;  4B5D A;  4QH4 A;  2Y56 A;  4ZK4 A;  5LXB A;  3SQ6 A;  4HFI A;  3EI0 A;  2QC1 B;  4PIR A;  3UU4 A;  4WV9 A;  2XQ5 A;  5AFM A;  4UY2 A;  1OED C;  2LLY A;  3TLS A;  2M6I A;  5AIN A;  2BG9 B;  4HFC A;  4HFH A;  4TNW A;  3SH1 A;  3ZDH A;  3JAE A;  4QH1 A;  3UU6 A;  3WTO A;  3U8K A;  3TLV A;  3RQU A;  4Z90 A;  4NZB A;  2W8G A;  3PEO A;  4BQT A;  5BW2 A;  4X5T A;  3EAM A;  3UU3 A;  2XZ5 A;  4FRR A;  2XQ3 A;  2KSR A;  5J5F A;  3RHW A;  3LSV A;  4HFE A;  2ZJU A;  4Z91 A;  2LKG A;  4COF A;  5IUX A;  2XNV A;  2VL0 A;  2YME A;  4EZ1 A;  5FJV A;  5AFK A;  5KZU A;  4BFQ A;  4HFB A;  4ZJT A;  4UM3 A;  3WTN A;  2W8F A;  3SIO A;  4ILA A;  4ALX A;  5HEJ A;  3WTI A;  4D01 A;  3UQ7 A;  4HQP A;  5AFJ A;  2XYT A;  4ILC A;  2BG9 E;  4UXU A;  3P4W A;  5CFB A;  1OED B;  4TWH A;  3UU8 A;  4ZZC A;  3GUA A;  5LG3 A;  2XQ8 A;  5BRX A;  5L4H A;  2Y7Y A;  3U8M A;  2BG9 A;  5TVC A; 
#chains in the Genus database with same CATH topology
 3RYH E;  3PV0 F;  3RH3 A;  2UXC T;  2CA5 A;  5AFN A;  2VKO A;  4WNK A;  2YIN A;  2BBJ A;  5SYO A;  2XQ6 A;  1U5P A;  2WNC A;  3PTR B;  2YU2 A;  2XZE A;  2X68 A;  3AEA A;  4QAA A;  2JRK A;  3Q5W A;  3ZDG A;  4Z8X A;  2Q9Q A;  4ZK1 A;  4IIJ E;  2W66 A;  3LFM A;  3FXE B;  4U2Z A;  5LHG B;  4OHF A;  2E2A A;  4TUY E;  2ZLY A;  4GOU A;  3VRA A;  5FNV E;  3SFE A;  2WAU A;  2V7L A;  4PK4 A;  3ZDH A;  1WLX A;  3JAE A;  3RKG A;  3ZST A;  3O1J A;  5FY7 A;  2WBL A;  2LKG A;  2Y48 B;  5J1G A;  4COF A;  4ERR A;  4JI1 T;  4IST A;  1JNZ A;  4HWH A;  2F4V T;  4KP3 C;  2WZI A;  3CX7 B;  4DV7 T;  2WB5 A;  3NRY A;  3B57 A;  1S35 A;  5HWX A;  2KMF A;  4U33 A;  2JQK A;  1WFD A;  2L8K A;  2XTL A;  3WTK A;  4DR3 T;  4TWD A;  2W00 A;  3MAC A;  4LF6 T;  4HFD A;  2DI4 A;  4AQF A;  1YXR A;  2X00 D;  5M4Y A;  3RF1 A;  1UX4 A;  2XNU A;  3AEB A;  3FZL B;  3JAD A;  2BKP A;  4UVC B;  5JDG A;  3TKL B;  2DLR A;  2BBH A;  5CGM A;  1MIV A;  2WN9 A;  2G0U A;  2OV9 A;  3ONX A;  3CKD A;  5ADX L;  2BS3 A;  3AB3 B;  4B5D A;  2CHO A;  1NAF A;  5LXB A;  3N2G E;  4DR7 T;  1T8B A;  3N9N A;  3P4P A;  4EXT A;  4IE4 A;  4GKK T;  5AQP B;  2DCF A;  2ZM8 A;  4LFB T;  1YQ3 A;  4LF9 T;  3X1D A;  3ZMU B;  4UVA B;  2ODV A;  2W62 A;  3ZMT B;  3CPZ A;  4OK0 A;  3UUN A;  4U7Y A;  3N9M A;  1MMD A;  2W8F A;  3UQ7 A;  4YXD A;  2XQ8 A;  1UCU A;  2J47 A;  2BKO A;  3H3M A;  2DHR A;  5EK4 A;  3P7I A;  4NXN T;  3PUA A;  3N9Q A;  4U7I A;  2BJ0 A;  5HXC A;  3AED A;  4LMJ A;  2LKH A;  3JCF A;  5AQV B;  2E9X D;  1MMA A;  5LGN B;  3LK3 B;  1W9R A;  4BJN A;  5DAB A;  4HFV A;  3TLU A;  5JME A;  3SQ9 A;  5IHY A;  2XQ4 A;  5TAO A;  3CX6 B;  4L0R A;  4EAH A;  5C2T A;  2LHR A;  3C50 A;  5JDN A;  5J5H A;  2M67 A;  3AA7 B;  4JI3 T;  4L9I A;  4QWN B;  3VRB A;  3PUQ A;  2CXL A;  3F57 A;  3PUS A;  4TWF A;  4UM3 S;  2CMR A;  1D0Z A;  3P50 A;  2AE9 A;  3PMZ A;  3RPU A;  1OED E;  2RP4 A;  3CML A;  2DWG A;  2IIU A;  1OED C;  3RGL A;  3OJA A;  4HFH A;  4ZS3 A;  3HA4 A;  4H9R C;  3PU8 A;  1HNX T;  3UFG A;  3Q5E A;  2LSI A;  1MMN A;  3T1H T;  2L3L A;  4UR9 A;  3EAM A;  2V6Y A;  2X9X A;  5JDL A;  4DMV A;  2J1D G;  3IHR A;  2R6G F;  5LMU T;  2FJA A;  4QXB B;  5FJV A;  1NEK A;  2XAJ B;  3HKD E;  2P9B A;  4D01 A;  3ZCI A;  4EZH A;  3G06 A;  3RRC A;  1NWM X;  2Y7Y A;  4HWC A;  3M65 A;  5KDM C;  1D0X A;  4PFO A;  4YLH A;  3ZPO A;  4PJL A;  3CX8 B;  5AQM B;  2LEH A;  2WWV A;  4F6R C;  1Y01 A;  3ZMV B;  5ABF A;  2FJE A;  2BG9 C;  1X79 A;  5LGT B;  1YW0 A;  4PW8 A;  1UV6 A;  2Q9Q D;  5JR9 C;  4FJO A;  4PJN A;  3RX6 A;  3MA9 A;  4YT0 A;  2Y58 A;  3C64 A;  4YHJ A;  4PK5 A;  4IL9 A;  3EDU A;  5HCM A;  2X9Y A;  3AEG A;  1XNR T;  4ILU A;  5LOV E;  4DR6 T;  3QK6 A;  4GYS A;  3IBP A;  2K9A A;  4AQY T;  1G73 A;  4HFC A;  5EK3 A;  4KMC A;  1T7S A;  3AAA B;  4I43 B;  2VVS A;  4KUM B;  4BQT A;  4PAG A;  3MK7 C;  1I6Z A;  2LSJ A;  5CB4 E;  3ZN1 B;  1XMO T;  2VL0 A;  5CJ5 A;  2VKD A;  2GK9 A;  5AQG B;  4DV3 T;  2UUB T;  2ACX A;  3P4W A;  4ZZC A;  5LG3 A;  1FMV A;  3FHN A;  2X9W A;  2ZM2 A;  3U8M A;  4HGA A;  5ETW A;  3EDV A;  5TVC A;  3QNU A;  4EEB A;  2V6X A;  2Y54 A;  3SOL A;  3ANW A;  4P1N A;  3KIN B;  4H63 H;  2XNT A;  4UIG A;  5KXJ A;  3ZC1 A;  2BYS A;  5AQF B;  2H7V C;  4LMK A;  3FXD B;  3U8N A;  3NKZ A;  4DND A;  2M6B A;  3EHZ A;  3U8L A;  3PU3 A;  3UT5 E;  3ZLI A;  4IDN A;  1ZV4 X;  3GN5 B;  2XQY A;  3OTO T;  4AKI A;  3RYF E;  3KV6 A;  1B7T A;  1N32 T;  2E9X C;  3ZT5 A;  4CN6 A;  2WMN A;  1KEY A;  1MIY A;  3V5S A;  3AE5 A;  3E08 A;  4O4J E;  3OPC A;  4CN4 A;  5BP0 A;  4OYK A;  4ZK4 A;  3AE2 A;  5L3E B;  4O4L E;  4CQI A;  1E7P A;  1UUS A;  4DBQ A;  5AIN A;  3ONL C;  2MOZ A;  2UUC T;  5AQR B;  2FJB A;  2NTY A;  4JEH B;  3LSV A;  2DWK A;  4DID B;  3AAI A;  3BQL A;  3VR9 A;  2IML A;  4B3S T;  4EZ1 A;  4M1P A;  5FVL A;  2NW7 A;  4G2A A;  4KX6 A;  4CI1 B;  5C8Y E;  4C91 A;  4V1A v;  3FZF B;  3GUA A;  3N9L A;  2A72 A;  2XQA A;  2WM9 A;  3UUL A;  1IBM T;  2C9T A;  3ZN0 B;  3ZEF B;  1E2A A;  2XQ7 A;  2B76 A;  3UUX B;  4B6X A;  3WTM A;  2D0U A;  2WZH A;  2NWB A;  4ZRU A;  2WNL A;  2MAW A;  4IDQ A;  4JUY A;  2ACZ A;  1U4Q A;  3HKE E;  4EIW A;  4U31 A;  3AEE A;  5JVD E;  1LVF A;  2EHO B;  4TN7 B;  4AKL A;  4DBR A;  4BJM A;  3ZJ2 A;  4A98 A;  3I9Y A;  2KIN B;  2V7I A;  4ZJS A;  3RC8 A;  4IE0 A;  5JDF A;  2BYR A;  4DUZ T;  4XAX B;  5FKY A;  2YMD A;  2WNJ A;  3CVR A;  1IZN B;  4OYJ A;  2NW9 A;  2WCA A;  5ABE A;  2BYP A;  3VU7 H;  4IE7 A;  2A2F X;  3VR8 A;  2JQH A;  2FBW A;  4UY2 A;  2H89 A;  3LBX B;  2HN2 A;  2Q9Q C;  4MAL A;  4ANJ A;  4J2C A;  3TLV A;  2W8G A;  4WYV A;  1NEN A;  2KSR A;  3C4Z A;  4X20 E;  1ZKE A;  3R6N A;  2HPJ A;  5FYM A;  4ZI3 C;  3K1S A;  1QUU A;  2W63 A;  4BAY B;  4AXP A;  2JQ9 A;  3LK4 2;  4CXX A;  4DO0 A;  3UU8 A;  3Q9D A;  2WDR A;  4U2Y A;  1HS7 A;  4JI0 T;  2XY8 B;  4QAB A;  1KF6 A;  1XZY A;  5CO5 A;  3LDQ B;  3GMI A;  5LHH B;  3C79 A;  5AQN B;  5AQJ B;  4I4T E;  5HAX A;  4XBF B;  2XAQ B;  1M62 A;  4ZEY A;  2A9U A;  1J5W A;  1S94 A;  2VWA A;  2E5L T;  1IJ5 A;  2I6H A;  2B1E A;  5IWA T;  2XAS B;  5DQV A;  4ZI7 E;  5AQS B;  3EAB A;  3QB5 A;  2CHN A;  4NPP A;  4X64 T;  1Z0P A;  2KND A;  2UXD T;  3ZKR A;  3A8Y C;  1OXZ A;  5CA0 E;  3MJX A;  4AQF C;  5LBM A;  4YTP A;  4MBQ A;  1XDP A;  5LHI B;  4LFC T;  2XAH B;  4QHO A;  3J9X 1;  3P4R A;  5FL0 A;  3O1I A;  2C0S A;  2OLT A;  5LYJ E;  1J5E T;  3UU3 A;  4U3C A;  4FRR A;  3RHW A;  5FXW A;  3PUV F;  3UUM A;  1KNP A;  3K3N A;  5KZU A;  5BMV E;  2J4G A;  2JQQ A;  4JLE A;  4O2B E;  4NXM T;  2XM2 A;  2N1G A;  1D1B A;  5CFB A;  2MPK A;  3DTO A;  3AEF A;  3CK6 A;  5FXV A;  2UXB T;  2NR4 A;  4YSX A;  5LNK A;  2YN6 A;  3HKB E;  4EYY R;  1GQE A;  3WAK A;  2LM9 A;  3DP7 A;  4E7Z A;  2IAK A;  4JEU B;  3S4U A;  2I0M A;  2Y8D A;  2BR8 A;  2KWI B;  3D0T A;  4IDO A;  3RIA A;  4CXW A;  3RKO A;  3OYZ A;  4HKA A;  3N2O A;  3PUG A;  4F8H A;  2V1D B;  5J2U E;  3EUH A;  3ZMS B;  1US7 B;  2VVN A;  3L39 A;  1M7K A;  1T98 A;  2LE8 A;  3VKH A;  3DJB A;  5L3C B;  4O4I E;  1FJG T;  5HYA A;  3OKQ A;  1VCT A;  2WMO A;  4UF0 B;  5FY1 A;  3LJC A;  1D1A A;  3SFD A;  1VOM A;  4AFH A;  1WR0 A;  4QH4 A;  1KK7 A;  1AJ3 A;  4HFI A;  3NVO A;  4WV9 A;  3ZMZ B;  1FIO A;  2WP9 A;  5IYZ E;  1BR2 A;  3SH1 A;  2W61 A;  4TV9 E;  2IUB A;  4N78 D;  3VKG A;  2LSK A;  3K8P C;  5GON E;  3PE0 A;  5J5F A;  2XQ3 A;  3P8C D;  1L0V A;  2ZM0 A;  1YD8 G;  2CLY C;  3CQX C;  4DR1 T;  4EGW A;  4NUU A;  4K0U A;  3UFE A;  2YME A;  5AFK A;  3P4S A;  2BS4 A;  5DJQ C;  5JDQ A;  1I94 T;  3SIO A;  2KXP B;  4TX5 A;  4E7S A;  2XHE B;  2HN1 A;  2C5J A;  2PGZ A;  2XUE A;  1WYB A;  4EZ4 A;  3P4Q A;  2YOE A;  3UTK A;  3VHL A;  4OFZ A;  4TV8 E;  5HEH A;  2CBJ A;  3WI3 A;  4ASK A;  4H9O C;  4QKN A;  4QH5 A;  3ABV A;  1HG2 A;  4XK9 A;  3L8R A;  4DVD A;  3ZC0 A;  4CI2 B;  2BVL A;  2XQ9 A;  2VK9 A;  5HXS A;  2CRB A;  2QYW A;  1X9B A;  3ETV A;  2XAF B;  2YDQ A;  4PFP A;  2PTF A;  2IW5 B;  1HF8 A;  2BVM A;  3SS1 A;  2OA5 A;  1ZP0 A;  4HTE A;  3NRX A;  1IBK T;  1N36 T;  4ZI2 D;  3JAF A;  3WTL A;  2JMK A;  1FEW A;  3E0Z A;  5JTG A;  1HFA A;  5CA1 E;  4PIR A;  2FJD A;  3AA6 B;  2ZMA A;  3U8K A;  1SHZ C;  2UXN B;  3GN5 A;  2WWU A;  3IA3 A;  5HXR A;  5FXX A;  4MHC A;  3RC3 A;  4KHZ F;  3C51 A;  3SRZ A;  4AI6 A;  2KWH A;  4PNI A;  4UV8 B;  3OYX A;  4Z91 A;  3ETU A;  2IC9 A;  3AAE B;  3CQC B;  4BFQ A;  4ZJT A;  4UM3 A;  4ALX A;  3WTI A;  3AVS A;  1UX5 A;  2VKJ A;  4JI8 T;  4UXU A;  2HH7 A;  1OED B;  1OWA A;  5BRX A;  1SA0 E;  5LA6 E;  2WSS V;  1QLB A;  3E22 E;  3KBU A;  3BQI A;  2CXF A;  2UZ6 A;  3Q5X A;  3HL6 A;  1ZOY A;  2BDE A;  3RI5 A;  2WZY A;  3C4W A;  5F5W A;  3GWH A;  5HEG A;  3NZP A;  2XYS A;  2YK0 A;  4IRE A;  5AFL A;  5FP3 A;  4MLK A;  1EZ3 A;  2CCQ A;  4DBM A;  3AA1 B;  4DR2 T;  2C5I T;  4KI0 F;  4JI7 T;  2YDS A;  2BYN A;  2X67 A;  4JI4 T;  1DU2 A;  2H7O A;  2V26 A;  2CXD A;  3WIP A;  4ZR6 A;  2VUR A;  3AXJ B;  3JC6 D;  3MKD A;  3TLW A;  3NBX X;  1V9D A;  2KT9 A;  4I0U A;  2RA1 A;  2E5V A;  2FUP A;  1W09 A;  5JRE A;  2QC1 B;  3NZQ A;  2BG9 B;  4GYR A;  3AE7 A;  2EHO A;  4X62 T;  4QXC B;  3CQG B;  4HWF A;  4NZB A;  5LXT E;  5JR9 B;  4X5T A;  5FMN A;  4TZ4 C;  1YKH B;  2I59 A;  5L3G B;  1LRZ A;  4I50 E;  2CBI A;  1O3X A;  3LBX A;  1Y64 B;  4DV2 T;  2V5D A;  3RIU A;  4P0A A;  4AQG A;  5C3J A;  3KFW X;  3N9O A;  4H9P C;  1R8I A;  4GK0 E;  1T72 A;  5JDH A;  5AFM B;  2C5K T;  4EB6 E;  2MTQ A;  4DV5 T;  3RYI E;  4ZXL A;  3CIR A;  2W0G A;  2H3R A;  4WBN E;  2JIW A;  2VL8 A;  4EYU A;  4LF7 T;  3W15 B;  3PUZ F;  5KX5 E;  4UEM A;  2RPA A;  4QX7 B;  2BYQ A;  3KV5 A;  3RIF A;  1BR0 A;  5LCY A;  2NOX A;  4QAC A;  2XAG B;  5HEO A;  3FZK B;  4CN1 A;  3EI0 A;  3RRW A;  3UU4 A;  2LLY A;  2LOS A;  2PG8 A;  2QA7 A;  1YKE B;  3NWI A;  1HX1 B;  4YJ3 E;  1HTJ F;  3OBV E;  2LRK A;  1E1H B;  1CHU A;  5FY0 A;  2E9X B;  4ZI2 C;  3FBZ A;  3O4X E;  5L3D B;  1H7C A;  2JPF A;  1Z8U A;  4C90 A;  2W4X A;  5LG4 A;  5LGU B;  2V7M A;  2VB6 A;  4HQP A;  3AE6 A;  3FZM B;  3F31 A;  4TWH A;  4JBW F;  1BR1 A;  4MFR A;  5AQH B;  5FL1 A;  2DNX A;  3F2E A;  1JNR A;  3I9W A;  1FMW A;  2PH9 A;  4WZX A;  4UM1 A;  4YJ2 E;  4UXN B;  4KBM B;  4JYA T;  5AFH A;  2X0L B;  1J1J A;  4ISS A;  3PJA J;  2D0T A;  3Q2M A;  1WYC A;  4WW0 A;  1I9B A;  5LP6 E;  1YQ4 A;  3B5M A;  5J0Z A;  5DQW A;  5HEU A;  4XHE A;  2IDO B;  1KNR A;  4GKJ T;  3ZYK A;  4ZHQ E;  2LM2 A;  2N2N A;  5L2L A;  3FBL A;  2BZB A;  3CWZ B;  5KE4 A;  3AEC A;  3I0Q A;  5AQO B;  3HKC E;  3AE1 A;  4AFT A;  2CWY A;  1UX2 A;  4I55 E;  3AVR A;  3SQ6 A;  4X1I E;  4IDZ A;  1LKX A;  4IDP A;  1UK5 A;  1QSD A;  3WTO A;  1SE7 A;  3Q5D A;  3QOF A;  3T8O A;  3JC6 C;  2MBG A;  2ZM6 T;  4IT4 A;  5BW2 A;  4QXH B;  2VKH A;  2LOP A;  2ZJU A;  3N2K E;  5JH7 E;  1MIW A;  2QRX A;  5IUX A;  2W67 A;  2XNV A;  3SWH A;  2CPT A;  3WTN A;  2ODU A;  4UF0 A;  3AE3 A;  4O8S A;  2V8S V;  4AKR B;  4AIU A;  3A7M A;  4QX8 B;  2Q9Q B;  3QUJ A;  2WS3 A;  5F3J A;  2MYS A;  5KMG P;  4X66 T;  3PDY A;  5AQK B;  5L47 A;  3PUX F;  3LK2 B;  4IE5 A;  4A97 A;  5LJN A;  4OX9 T;  4L5G A;  5LB7 B;  1IBL T;  5ABG A;  3WTH A;  3ZJ1 A;  3I0O A;  3K3Q C;  3H3A A;  4H9N C;  2SPC A;  1XWM A;  3KV9 A;  2LJL A;  5AFU L;  4LFA T;  3L3P A;  5L4E A;  2X51 A;  4YFS A;  4DR5 T;  3AE9 A;  5JQG E;  2KLQ A;  3ZYM A;  3KVA A;  4H63 V;  2K5B B;  2N9D A;  5LBQ B;  4ZS2 A;  1KFY A;  3U8J A;  2WU5 A;  1XMQ T;  4NUV A;  4JI2 T;  4YY3 T;  2E8I A;  4NIQ A;  2PJQ A;  3R84 B;  2WDV A;  4YHH T;  2X0Y A;  2EHO D;  4U72 A;  3H37 A;  4B3R T;  3ESL A;  2WU2 A;  2IC6 A;  3BQK A;  5HXE A;  4A5X A;  3MZK B;  3A5X A;  5FXZ A;  5JDM A;  4CZZ B;  4H9S E;  4DR4 T;  4JI6 T;  4BA9 A;  2KZ7 B;  3HI2 A;  4HN9 A;  4YSY A;  3KDS E;  3AE8 A;  1HNZ T;  4YTM A;  4HWI B;  4IGU A;  2Y57 A;  3C84 A;  5HXH A;  2NW8 A;  4YSZ A;  3KV4 A;  2UUA T;  2Z6E A;  4PJM A;  3L09 A;  5J5G A;  2X0H A;  2CE7 A;  1ZHC A;  5LMN T;  3EVY A;  2IHR 1;  3M3Z B;  3UUB A;  3N9P A;  4B3T T;  1IAP A;  3T4M A;  4H9Q C;  4UM3 P;  3ONJ A;  1N34 T;  2DL1 A;  3HR0 A;  1OED A;  4A56 A;  4JV5 T;  3TLT A;  4PK6 A;  3ZYL A;  4EED A;  3WAJ A;  5AQL B;  3U3I A;  3KBT A;  3UQ4 A;  1W0A A;  4DV4 T;  3WTJ A;  3FZH B;  4U74 A;  3OVU A;  1WRD A;  3QC9 A;  4AFG A;  2BS2 A;  5HWY A;  2JJ9 A;  2XQ5 A;  3RYC E;  5J2T E;  4TNW A;  4LF4 T;  3K3O A;  4QH1 A;  4YTN A;  4ZOL E;  4Z90 A;  4P09 A;  3PEO A;  2HHH T;  2CM0 A;  2XZ5 A;  5AQU B;  5L3F B;  4HFE A;  5EK2 A;  2PFV A;  4DV0 T;  3AXJ A;  1G8X A;  2W2U A;  3V5U A;  3IF8 B;  1IJ6 A;  5JRC A;  2BG9 E;  5H6Q B;  4DMW A;  4K0K T;  1N33 T;  2BG9 A;  2LT3 A;  4EV6 A;  5A1L A;  3RLF F;  1WR6 A;  3PUY F;  2JMH A;  5J5I A;  1VCS A;  5L3B B;  5JR9 A;  4HEA A;  2UXX B;  5HCJ A;  2CLY B;  2XZ6 A;  5EZY E;  3RQW A;  1W0B A;  5AQT B;  2H88 A;  2CWO A;  4G63 A;  5AQQ B;  2NP9 A;  3B13 A;  2X00 A;  1HG5 A;  2K48 A;  1LVK A;  3ZT7 A;  2V7K A;  2VQF T;  5AQI B;  1HR0 T;  3PUW F;  4ILB A;  4DV6 T;  4B3M T;  4ZI3 D;  4AKH A;  1D1C A;  1UGO A;  2WQY A;  4LML A;  4ZZB A;  3ZT6 A;  2NTX A;  2V6Y B;  1KNZ A;  3O9X A;  2BKN A;  1HNW T;  5F8P A;  4DV1 T;  2K24 A;  1MMG A;  2V7J A;  3PJA A;  2PBI A;  4KHP T;  2LSG A;  5AFM A;  3TLS A;  3GA8 A;  1MNE A;  3BK9 A;  3UU6 A;  3I1A A;  4PJJ A;  3RQU A;  4X65 T;  2XJ7 A;  2XM1 A;  4UV9 B;  4JI5 T;  2QVA A;  3T1Y T;  3AE4 A;  4UVB B;  5ABH A;  4AKG A;  5FVK A;  1MND A;  5JRC B;  1CUN A;  4HFB A;  3U78 A;  4ILA A;  5ABF B;  5HEJ A;  2LHN A;  4IHJ E;  2XYT A;  2XSA A;  1UUR A;  2EHO C;  4XZC A;  1BR4 A;  4LF8 T;  2V5C A;  1UW6 A;  4X1K E;  3UU5 A;  3N5L A;  3ZCJ A;  4FI5 A;  4DUY T;  3IEE A;  2D5U A;  2LSY A;  2E9X A;  2QGS A;  4GK5 E;  2UU9 T;  4EOZ B;  2VQE T;  4X1Y E;  3AA0 B;  4TNV A;  2Y6X A;  1WCR A;  2YDR A;  3O1H A;  2AXD S;  4P0B A;  5LJM A;  2A3D A;  3RIU C;  2ZJV A;  4HE8 A;  2X66 A;  2XSB A;  2L9Q A;  3IGQ A;  1XDO A;  1XNQ T;  2BR7 A;  2YEV C;  1VRB A;  5H6R B;  4O4H E;  2YKS A;  3PUR A;  4ADZ A;  3ZSS A;  3C4X A;  5E0O A;  2YU1 A;  5BR8 T;  1HCI A;  4IL4 A;  3MXZ A;  2X9H A;  1HX8 A;  2K3W A;  2Y56 A;  2CEA A;  2XPK A;  3FB2 A;  3C98 B;  2M6I A;  2WDQ A;  4CI3 B;  4LF5 T;  4CXY A;  2WY2 A;  4O2A E;  2D9D A;  4WBO A;  3ANW B;  2ES0 A;  1D0Y A;  4GIW A;  3J7Y q;  4Q25 A;  1ZEE A;  4HWD A;  2VAS A;  2D2S A;  2HPL A;  2J62 A;  3QB5 K;  4IE6 A;  5AFJ A;  3KVB A;  1SUM B;  4ILC A;  3LG7 A;  2LRL A;  5L4H A;  4AIS A;  4UEL A; 
#chains in the Genus database with same CATH homology
 1UW6 A;  4QAB A;  3UU5 A;  2YN6 A;  2UZ6 A;  2BJ0 A;  5CO5 A;  2Y54 A;  2PGZ A;  5J5I A;  2XQA A;  3RI5 A;  2Y57 A;  4LMJ A;  3C84 A;  3WTK A;  5AFN A;  5L47 A;  2PH9 A;  3C79 A;  2C9T A;  2WZY A;  4TWD A;  2LKH A;  5HCJ A;  4UM1 A;  2XZ6 A;  3RQW A;  2YOE A;  2BR8 A;  4A97 A;  2XQ7 A;  5HEH A;  5J5G A;  3WTM A;  5HEG A;  4HFD A;  2XNT A;  2XYS A;  5SYO A;  2XQ6 A;  2X00 A;  4IRE A;  2BYS A;  3RIA A;  4ZRU A;  5AFL A;  3TLU A;  3UUB A;  2WNL A;  2WNC A;  2MAW A;  4QH5 A;  3SQ9 A;  4LMK A;  3U8N A;  5AFH A;  5JME A;  2X00 D;  3WTH A;  5AFM B;  4DBM A;  4XK9 A;  4TNV A;  2XQ4 A;  4QAA A;  2M6B A;  3T4M A;  2XQ9 A;  2BYN A;  3EHZ A;  4ILB A;  2XNU A;  2BG9 C;  4F8H A;  1I9B A;  4UM3 P;  4NPP A;  4A98 A;  1OED A;  3U8L A;  2ZJV A;  3ZDG A;  5J0Z A;  4ZJS A;  5HEU A;  1UV6 A;  3TLT A;  3JAD A;  4XHE A;  3IGQ A;  5J5H A;  3WIP A;  4LML A;  4ZZB A;  4ZK1 A;  5L4E A;  2BR7 A;  4ZR6 A;  2BYR A;  4TWF A;  4UM3 S;  2YKS A;  3UQ4 A;  2WN9 A;  2LM2 A;  2Y58 A;  3ZKR A;  3P50 A;  2YMD A;  2WNJ A;  2BYQ A;  3TLW A;  4IL9 A;  5KE4 A;  3PMZ A;  5HCM A;  3WTJ A;  3RIF A;  3U8J A;  3JAF A;  1OED E;  4IL4 A;  3WTL A;  4AFT A;  5BP0 A;  4AFG A;  4QAC A;  1UX2 A;  4AFH A;  2BYP A;  5HEO A;  4B5D A;  4QH4 A;  2Y56 A;  4ZK4 A;  5LXB A;  3SQ6 A;  4HFI A;  3EI0 A;  2QC1 B;  4PIR A;  3UU4 A;  4WV9 A;  2XQ5 A;  5AFM A;  4UY2 A;  1OED C;  2LLY A;  3TLS A;  2M6I A;  5AIN A;  2BG9 B;  4HFC A;  4HFH A;  4TNW A;  3SH1 A;  3ZDH A;  3JAE A;  4QH1 A;  3UU6 A;  3WTO A;  3U8K A;  3TLV A;  3RQU A;  4Z90 A;  4NZB A;  2W8G A;  3PEO A;  4BQT A;  5BW2 A;  4X5T A;  3EAM A;  3UU3 A;  2XZ5 A;  4FRR A;  2XQ3 A;  2KSR A;  5J5F A;  3RHW A;  3LSV A;  4HFE A;  2ZJU A;  4Z91 A;  2LKG A;  4COF A;  5IUX A;  2XNV A;  2VL0 A;  2YME A;  4EZ1 A;  5FJV A;  5AFK A;  5KZU A;  4BFQ A;  4HFB A;  4ZJT A;  4UM3 A;  3WTN A;  2W8F A;  3SIO A;  4ILA A;  4ALX A;  5HEJ A;  3WTI A;  4D01 A;  3UQ7 A;  4HQP A;  5AFJ A;  2XYT A;  4ILC A;  2BG9 E;  4UXU A;  3P4W A;  5CFB A;  1OED B;  4TWH A;  3UU8 A;  4ZZC A;  3GUA A;  5LG3 A;  2XQ8 A;  5BRX A;  5L4H A;  2Y7Y A;  3U8M A;  2BG9 A;  5TVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...