4HFHA

The glic pentameric ligand-gated ion channel (wild-type) complexed to bromoform
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfhA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfhA01
2XQ6A 5HCJA 4UM1A 3C79A 5L47A 4DBMA 2BG9A 5J5FA 4HQPA 3U8MA 4IL9A 4WV9A 3ZDHA 3TLWA 4IREA 2WNJA 4UXUA 4D01A 5AFLA 5AFMB 4Z90A 2W8FA 4XK9A 4LMKA 4COFA 3TLVA 2XZ5A 3JADA 2XNUA 3WTIA 3TLSA 2XYTA 3SQ6A 3PEOA 1OEDA 3UQ4A 4QAAA 5HCMA 5JMEA 4ZRUA 4ILAA 3EI0A 5BP0A 4LMLA 4QACA 5CO5A 4NPPA 3U8NA 4BFQA 4ILCA 2LLYA 3WTOA 2WN9A 2BR8A 4FRRA 2VL0A 5CFBA 3T4MA 5HEUA 2BG9E 4ZJTA 1I9BA 2XNVA 4BQTA 5BW2A 2YMDA 4ZK1A 3GUAA 5SYOA 3RIAA 1OEDB 4ILBA 2BYNA 5HEOA 2BYPA 5HEGA 2Y57A 4Z91A 5IUXA 3UQ7A 4ALXA 2LM2A 3RHWA 4B5DA 4HFEA 2BR7A 2PGZA 2ZJVA 3TLUA 2YOEA 4LMJA 3IGQA 5AFKA 3TLTA 2BYRA 4TNVA 2LKGA 4UM3A 3EAMA 3WIPA 4HFBA 4TWFA 5AFNA 3RQWA 3UU6A 2XQ5A 3WTJA 4NZBA 3UU5A 2Y54A 5L4EA 3JAEA 2WNLA 4PIRA 4QABA 5J0ZA 4F8HA 2PH9A 4EZ1A 1UX2A 5KE4A 4AFGA 2ZJUA 3WTHA 3RI5A 3RQUA 2XQ8A 2WZYA 4TWDA 2X00A 3EHZA 2MAWA 4HFCA 3UU3A 3ZKRA 2Y7YA 5J5IA 2XQ4A 4QH5A 4QH4A 2XYSA 3C84A 5AFHA 2YN6A 4HFHA 3ZDGA 4TNWA 3UU8A 4AFTA 3UUBA 2XQAA 5LXBA 4TWHA 2KSRA 2BG9C 3JAFA 2QC1B 4A97A 5HEJA 3WTKA 2XQ3A 3WTMA 2M6BA 1UV6A 5HEHA 2YMEA 4ZK4A 2X00D 4QH1A 2C9TA 3U8LA 1OEDE 4ZZCA 4UM3S 4IL4A 2M6IA 5BRXA 1OEDC 4HFIA 5LG3A 5AINA 3U8JA 4HFDA 5TVCA 2XQ7A 2YKSA 3P4WA 4ZZBA 2XNTA 2Y56A 2Y58A 5J5HA 3U8KA 5AFJA 5KZUA 3RIFA 4ZJSA 1UW6A 3WTLA 4X5TA 2LKHA 4UM3P 4ZR6A 3UU4A 3P50A 5J5GA 3SIOA 3PMZA 2BJ0A 2BYSA 2BG9B 3LSVA 4XHEA 2BYQA 2W8GA 5L4HA 3SQ9A 3WTNA 2XZ6A 2XQ9A 5AFMA 3SH1A 4A98A 2UZ6A 5FJVA 4AFHA 2WNCA 4UY2A
chains in the Genus database with same CATH superfamily
1N34T 5HCJA 3ZCJA 5LNKA 4ERRA 3RKOA 4HTEA 2JIWA 4LF4T 1IBLT 3EVYA 3ZMZB 4Z90A 2XJ7A 3Q5EA 3NRXA 1WCRA 2H7OA 5F3JA 3AEEA 1Y01A 2XAJB 3PTRB 4EIWA 4YHJA 3QOFA 4K0UA 2V8SV 2WDRA 4FRRA 4I50E 2Y8DA 3PUYF 3GUAA 5LJMA 4HFEA 5L3DB 4HFBA 3RPUA 2X0YA 1Z8UA 5L4EA 1UGOA 3V5UA 3PUWF 2ACZA 3I0OA 4AFGA 4UEMA 3EHZA 2Y7YA 1ZKEA 4LFBT 2DHRA 4X65T 1KNPA 3K1SA 3QUJA 5LXBA 4YSXA 4JV5T 5JDQA 2BS4A 4ZOLE 2C5KT 3K3QC 3AE3A 4IE4A 1OEDC 3AA6B 4X1IE 3OVUA 2DLRA 4WBOA 1H7CA 4DR5T 5J5GA 5M4YA 3LSVA 3NZQA 2X66A 3AA1B 3LK3B 2KWIB 4U31A 3P7IA 4IL9A 4I0UA 4IREA 4D01A 5AFLA 1FMVA 1G8XA 2WU5A 4H9SE 4A5XA 1E7PA 5HCMA 1X9BA 3C51A 4WYVA 1XNQT 5C2TA 4I43B 5BW2A 3CIRA 4ILBA 1XMQT 2YOEA 2WM9A 2BKOA 2BZBA 4UF0B 4CXYA 4HWFA 3RI5A 3ZT5A 4ASKA 3PJAJ 2RA1A 3T8OA 3UUBA 1S35A 1HX8A 3KBUA 5HEHA 2LSJA 4EOZB 3DP7A 4HFIA 3P4WA 2V6XA 2N9DA 4QWNB 3WTLA 2WWVA 5L3CB 4JBWF 3GN5B 2WMOA 3L3PA 5FXZA 3ZSTA 3T1HT 1VCSA 2BG9A 1XMOT 4X1YE 3A7MA 4JYAT 5HAXA 2ES0A 3D0TA 1MMAA 4X1KE 2B76A 3VR8A 3KINB 2H89A 4UELA 5AQQB 4C91A 2X0HA 3NVOA 3AEDA 3VHLA 3C4ZA 3EI0A 4ISTA 4YJ2E 4PFOA 2I6HA 2X67A 5CFBA 3FXEB 3MKDA 3A8YC 4J2CA 4BQTA 3NRYA 5ABFA 4KUMB 3O1HA 3Q5XA 1HCIA 5AFKA 4HE8A 4PFPA 3MJXA 3L8RA 3VU7H 2W67A 2ZM0A 3AAIA 4FI5A 1M62A 4L9IA 4KBMB 3N2GE 3RQUA 2CLYB 3ONJA 5A1LA 4HWHA 2V7LA 5L3FB 3RC3A 3JC6C 4JUYA 2KWHA 3RF1A 5ETWA 3UU8A 5LBMA 1U5PA 3JAFA 5JDGA 5JR9A 2X00D 2Q9QD 1FJGT 2DL1A 4U33A 3TKLB 5JREA 3U8KA 2MOZA 2Z6EA 1UW6A 1QUUA 3BK9A 3V5SA 4AKLA 5LOVE 4UVBB 3SIOA 5H6RB 4E7ZA 1KFYA 3L09A 2LOPA 2UUAT 4HGAA 3G06A 4LFAT 2IUBA 3AE7A 3O4XE 4YSYA 2NTYA 2YDRA 3BQIA 3T1YT 3U8MA 4BJNA 4U7YA 2WNJA 2L8KA 3MACA 1VOMA 3MZKB 3WTIA 2YU1A 2XYTA 5HXEA 3F2EA 3HR0A 3ZT7A 4DMWA 3AEFA 2UU9T 3OKQA 3EABA 1CUNA 5CGMA 2M67A 2YDQA 5ABHA 4I55E 4ZK1A 1R8IA 3DJBA 4JEHB 5TAOA 4B5DA 3AE9A 5E0OA 3VR9A 4JLEA 2LKGA 4MBQA 2Y54A 3U3IA 5AQRB 5LGNB 5J0ZA 4QXHB 1KF6A 1ZOYA 3WTHA 2HHHT 5L3GB 2JQHA 4GK5E 4NXNT 2DNXA 3ZDGA 4TNWA 2XQAA 4EGWA 4KHPT 3P4PA 1WLXA 4OYJA 4HWDA 4CXWA 1MMNA 3NBXX 1UV6A 4MFRA 4ZK4A 4JEUB 2C5IT 4HN9A 1W9RA 3MXZA 2XNTA 2Y56A 4EEDA 3KVBA 4HEAA 1HS7A 2CM0A 2A3DA 3IBPA 5AQOB 4DBRA 4U7IA 1D1CA 3L39A 1D0XA 5FKYA 2E9XA 3SFDA 1KEYA 4Q25A 4KI0F 2XPKA 3SWHA 3TLSA 4ZI3D 1OEDA 1KK7A 2X9XA 4DR2T 2W2UA 1UURA 2XZEA 4BFQA 2BR8A 3LG7A 2Q9QC 5LBQB 4YJ3E 5SYOA 2K48A 5IUXA 4TUYE 1IJ5A 5LHIB 2LM2A 2EHOB 2LRLA 2V1DB 3N9MA 1QLBA 5LA6E 1NEKA 2MBGA 3FBLA 3NZPA 3A5XA 2WWUA 2Q9QA 2X00A 3FZKB 2XHEB 2XQ4A 2W4XA 2SPCA 3SRZA 3N9NA 3MA9A 4CN6A 5LGTB 3HKEE 4UIGA 4XAXB 4JI6T 5KZUA 5AQGB 3FBZA 5L3EB 4AISA 2D5UA 5JRCB 2IAKA 5JR9C 2CE7A 4KX6A 2NOXA 4ZEYA 2K5BB 2UXXB 3SH1A 3ZCIA 3VRAA 3FZMB 4YTNA 3Q2MA 4HWCA 4DR4T 1FMWA 4COFA 1NAFA 4PJNA 2AXDS 3C50A 1KNZA 2KLQA 3PUVF 2WCAA 4DV1T 1EZ3A 3RIUA 1LVKA 5C8YE 3M3ZB 4ZI7E 1J5WA 1ZEEA 3WAJA 3AEAA 4IT4A 4NIQA 1D0ZA 4CXXA 3N9PA 1HR0T 3OBVE 4QXCB 5L3BB 1YQ4A 4UM3A 1D1BA 4DR3T 5F5WA 4PIRA 4PK6A 2PH9A 5JRCA 3ZMTB 4YFSA 3I9YA 1MMDA 2XQ8A 4YHHT 4QH4A 5KX5E 4O4LE 3GN5A 2OV9A 2BVLA 4AFTA 5HXRA 1MIYA 1VCTA 2DWKA 5LMUT 4A97A 3ZEFB 5GONE 1IZNB 2ACXA 1NENA 3N2OA 3RYCE 4IL4A 3UT5E 3RH3A 1N32T 3N9OA 2E9XB 2CBJA 2IIUA 4UV9B 2E9XD 2V26A 2LJLA 2NW9A 4YT0A 3NKZA 2WDQA 3PU8A 2V7JA 4B3RT 2YDSA 2RPAA 4OHFA 3OJAA 2W8FA 3UFGA 2X9HA 1IBMT 3OYZA 4U2ZA 3UQ4A 3HI2A 4H9NC 4EZHA 2C0SA 3RGLA 1GQEA 2X9YA 1YKHB 5JDHA 5C3JA 3S4UA 2DI4A 1MIWA 3N9QA 2Y57A 4QX8B 4FJOA 3RHWA 1BR0A 3RLFF 2ZJVA 5J2TE 3WIPA 1US7B 2XQ5A 4IDOA 5AQPB 5KE4A 4QKNA 3CMLA 3ETVA 2NW8A 4LF7T 4K0KT 2BKNA 4LFCT 4HFHA 3FHNA 2BDEA 3CX8B 3AE2A 2WY2A 3AE4A 4LF5T 2VB6A 2H3RA 2NP9A 2C9TA 3C98B 4JI7T 4ZZCA 4UM3S 3K8PC 4HFDA 5TVCA 2XQ7A 4UVCB 2XQYA 2JMKA 4H9QC 3AE5A 4X5TA 4H9RC 2W62A 4NUVA 2BG9B 3WI3A 5KDMC 2NR4A 3WTNA 2V6YB 4UV8B 3KVAA 4AQYT 4UY2A 1T98A 3ONXA 4UM1A 4HQPA 5FL1A 3ZDHA 5JR9B 4X64T 4QX7B 2HPJA 3GA8A 3CPZA 2EHOD 4EXTA 3AEBA 2EHOC 3LFMA 4OX9T 1HX1B 4QAAA 5JMEA 1G73A 4AI6A 2BKPA 4NPPA 2V5CA 2QRXA 2VVNA 2BS2A 3CVRA 3F31A 2FJDA 4ZJTA 1W09A 4YTMA 2JJ9A 4CI3B 1OEDB 4F6RC 2IC9A 2BYPA 3X1DA 4CZZB 4NUUA 3K3OA 2V7MA 1X79A 1LRZA 3E08A 2WB5A 2BYRA 4MALA 3PUGA 4AQGA 1DU2A 3WTJA 2ZM2A 4NZBA 4CQIA 4F8HA 5AQKB 2I0MA 5JDNA 2AE9A 4QH5A 4V1Av 3HA4A 5HXHA 5AQIB 2WAUA 4IDZA 4PAGA 4N78D 2IDOB 5JH7E 2B1EA 1UX4A 2E9XC 4GYSA 2CHNA 2V7IA 1HTJF 2CXDA 2VKOA 2BS3A 2JPFA 3KV9A 4PK5A 5AQJB 4ZR6A 3EDUA 3ZN0B 5JTGA 3U78A 5AQNB 5FYMA 1NWMX 1FIOA 3CQXC 4OYKA 2MPKA 2WNCA 4EB6E 2XQ6A 3I1AA 4DBMA 4ADZA 2MTQA 2J62A 2JQ9A 3TLVA 3M65A 2KNDA 4GIWA 2DCFA 4KHZF 2X9WA 1J1JA 3PUXF 4ILAA 3O9XA 2FUPA 5LHGB 2NTXA 2KZ7B 2MYSA 3IF8B 5BR8T 2N1GA 3PJAA 2W00A 3RYHE 2Y48B 4ISSA 5J2UE 2X68A 4UF0A 1KNRA 3FXDB 2KXPB 4H9PC 3UQ7A 2V5DA 3AXJB 3IEEA 5HXSA 4WNKA 4XZCA 1N33T 4H9OC 4OFZA 1JNRA 3PV0F 5JDLA 1W0AA 4G63A 2WZYA 5FL0A 2XYSA 5JVDE 3WAKA 4C90A 4JI2T 4IHJE 5HEJA 3FZHB 4IE0A 4AXPA 4GOUA 3AB3B 3H3AA 1ZHCA 1YD8G 5J5HA 4JI0T 1D1AA 2KMFA 2Q9QB 5AFJA 3B57A 2LOSA 4UM3P 1XZYA 5FVKA 3AVRA 1JNZA 5FJVA 3ZJ1A 4IE5A 2P9BA 5LYJE 5J5FA 5FY0A 4GKKT 3ANWA 3QNUA 2CXFA 4UXUA 2D0UA 2W61A 2UXCT 4IIJE 2A2FX 2XNUA 2XZ5A 2LSYA 3QB5K 3Q5WA 4UXNB 4TV9E 4ZRUA 5FXXA 4LMLA 4JI3T 5CO5A 5KXJA 5AQHB 3ETUA 5CA1E 2QYWA 2VL0A 4G2AA 3B13A 5HEUA 2HPLA 3C4WA 4PW8A 1YKEB 3AE1A 2CCQA 2XAGB 1VRBA 3FZLB 5AQLB 3IGQA 4DV4T 2K24A 1HF8A 4AIUA 1E1HB 2VQET 4TV8E 1UX2A 3PE0A 4A56A 1HNZT 4LF8T 3ZKRA 3P4SA 2H7VC 2I59A 1WR0A 4DV0T 4AKHA 2LM9A 4JI5T 4DVDA 5ABFB 4NXMT 5AQSB 4YSZA 1HFAA 1BR2A 3P4QA 2L3LA 2ZLYA 2QGSA 1O3XA 5AFUL 2CXLA 3ZYMA 2CBIA 4PJJA 4O2BE 1BR1A 3HKCE 4ZS3A 1WRDA 3AA7B 2BYQA 2XSBA 4AKIA 5J1GA 3CX7B 2XQ9A 1T8BA 1WYBA 2H88A 1YW0A 3GMIA 2FJBA 3H3MA 4AFHA 5LB7B 2FJEA 2VL8A 1SHZC 1W0BA 4DV6T 1XWMA 1MNDA 3RIUC 2IW5B 3LBXB 2E5LT 1IAPA 5LG4A 2WBLA 1E2AA 3DTOA 3HL6A 2XNVA 4IE7A 3ZT6A 2BYNA 5HEGA 4LF6T 4O4HE 3ZPOA 4PJMA 4B6XA 2WZIA 2W63A 3EAMA 4DV3T 4KMCA 3JAEA 4EZ1A 1LVFA 3BQLA 2FBWA 1UUSA 5DQVA 4CN4A 3HKBE 3FB2A 3AE8A 4BA9A 4IE6A 2LT3A 3NWIA 5AQVB 5AFHA 2YN6A 2WMNA 3AAAB 1WYCA 5FXWA 2NW7A 2VWAA 3E22E 3WTMA 3P4RA 5JDFA 4HWIB 1I94T 4WZXA 5ADXL 1IJ6A 5IWAT 2F4VT 4O2AE 2A9UA 5LXTE 4EEBA 2WZHA 4MHCA 3R84B 4X62T 2VURA 4XHEA 4ZXLA 3ESLA 3C64A 3QB5A 3VKGA 1MIVA 2LE8A 3KV6A 4I4TE 2XZ6A 3ZJ2A 4U74A 4DR7T 4IDNA 3OTOT 3C79A 1SUMB 2A72A 3PURA 5EZYE 3TLWA 2ZM8A 1HNXT 1YQ3A 1UK5A 3F57A 2XAQB 3PEOA 2CWOA 4ZS2A 4ZI2D 3PDYA 3KV5A 2BBJA 4DUZT 4IDQA 2VKHA 1B7TA 1QSDA 2C5JA 2V6YA 4IDPA 2XAFB 4U3CA 2UXBT 2CA5A 4LMJA 3EDVA 3UULA 3C4XA 5AQMB 3ABVA 4E7SA 5LHHB 5FP3A 5JDMA 3ANWB 3ZC0A 4QABA 3HKDE 3ZSSA 3LK2B 3LDQB 4TWDA 4HFCA 3C84A 2BBHA 3RYFE 5H6QB 4PJLA 2YEVC 4QXBB 4DO0A 2G0UA 5CB4E 2VASA 3O1JA 1XNRT 4DV2T 4Z8XA 1UCUA 3U8JA 4DMVA 1CHUA 4ZJSA 2CHOA 4EAHA 2CMRA 5ABGA 3UU4A 3P50A 2BYSA 3CKDA 2XAHB 3SQ9A 2PFVA 3UTKA 2XUEA 5KMGP 2CLYC 1XDOA 2ODUA 5LP6E 2LRKA 3CWZB 1HNWT 2BVMA 4DBQA 4WV9A 3PUZF 4MLKA 2LHNA 3JADA 2WQYA 2PJQA 4ANJA 3ZYLA 3CK6A 4O4JE 2E8IA 4GKJT 1LKXA 2LLYA 3WTOA 1S94A 3I9WA 5AQUB 5FY1A 2QA7A 4DIDB 1I9BA 4TZ4C 5IYZE 2UXNB 2HN2A 5EK2A 4M1PA 3RRWA 3J7Yq 1UX5A 2BR7A 1D0YA 4B3MT 3TLTA 3RYIE 2DWGA 4YTPA 4JI4T 1Z0PA 4HKAA 2MAWA 4JI1T 5ABEA 1L0VA 3R6NA 3N5LA 3SOLA 2VQFT 3ZLIA 4TN7B 2Y6XA 2KSRA 5FXVA 2QC1B 5L2LA 3LK42 2YMEA 2D0TA 4ZZBA 5HXCA 3RIFA 4P0BA 2BJ0A 4AQFC 2XTLA 2E2AA 2W8GA 3SS1A 2YU2A 2UZ6A 2EHOA 2X51A 2XM2A 2CEAA 4JI8T 1HG5A 4DV5T 5LJNA 4PK4A 2J1DG 1SE7A 3SFEA 4AQFA 3AVSA 4O4IE 3UUXB 2WP9A 4WBNE 2BG9E 4O8SA 4EYYR 3K3NA 3ZYKA 1HG2A 4WW0A 4ZI2C 1WFDA 3IA3A 3AA0B 2WU2A 3JC6D 5F8PA 2NWBA 5BMVE 2R6GF 5LGUB 4GYRA 3RQWA 3UU6A 1T72A 5FMNA 2LSKA 3KV4A 2ZJUA 2XY8B 5EK4A 2W0GA 2WS3A 3UU3A 3OPCA 1Y64B 4ZHQE 2BG9C 4L0RA 3WTKA 1ZV4X 2HH7A 2XQ3A 2M6BA 3E0ZA 4ZI3C 3UUNA 3AEGA 5DABA 3QC9A 1OEDE 3KFWX 3J9X1 2XSAA 5LG3A 3IHRA 2YKSA 4AKRB 4CI2B 4YY3T 3UFEA 2L9QA 4DR1T 5LMNT 4B3ST 2E5VA 2LKHA 3ZMVB 4TX5A 1J5ET 5AFMA 4HFVA 4A98A 4EZ4A 2PBIA 2XASB 2PG8A 5L47A 3RKGA 3W15B 2KT9A 1M7KA 3O1IA 5EK3A 2IMLA 4KP3C 2LSGA 3SQ6A 2UUCT 4DUYT 3Q5DA 2VKDA 4ILCA 3AECA 2ODVA 3T4MA 1YXRA 3ONLC 3ZMUB 2VKJA 2W66A 5HEOA 1FEWA 2KINB 4CI1B 5FVLA 4ALXA 5AQTB 4H63H 4AKGA 5CJ5A 4TNVA 2VVSA 2XM1A 4U2YA 2IC6A 3Q9DA 3UU5A 3VRBA 2WNLA 3AXJA 1BR4A 5LCYA 4ILUA 3ZC1A 2JRKA 4UVAB 3JCFA 1AJ3A 3PUAA 2X0LB 4CN1A 4YLHA 5J5IA 5FNVE 1MMGA 4BJMA 5HWXA 3RC8A 4B3TT 1U4QA 5HWYA 4X66T 2FJAA 2OA5A 3N9LA 4U72A 1XDPA 4P09A 3U8LA 5IHYA 2M6IA 3LJCA 2LHRA 4QHOA 5AQFB 5AINA 3MK7C 4DR6T 5CA0E 5HYAA 2UUBT 3RX6A 4XBFB 1OWAA 3PU3A 4GK0E 3FZFB 3KDSE 4DV7T 4UR9A 2OLTA 3QK6A 1MNEA 2CPTA 2PTFA 3B5MA 1WR6A 2D2SA 3CQCB 5AFMB 2QVAA 4XK9A 3VKHA 4LMKA 2LEHA 2WDVA 3AE6A 1ZP0A 2HN1A 5BP0A 2JQKA 2UXDT 1I6ZA 4QACA 3U8NA 2D9DA 4X20E 2WN9A 1T7SA 5JQGE 4BAYB 2GK9A 2RP4A 2K9AA 2YMDA 2YINA 3RIAA 2J47A 4Z91A 4OK0A 2K3WA 4P0AA 2PGZA 3UUMA 1V9DA 3TLUA 4H63V 3EUHA 4PNIA 1SA0E 4TWFA 5AFNA 2VK9A 3ZMSB 3P8CD 4LF9T 3GWHA 4P1NA 3ZN1B 3H37A 5DQWA 3BQKA 1OXZA 4YXDA 3N2KE 2V7KA 3PUQA 3PUSA 5FY7A 3CX6B 4TWHA 3RRCA 2JMHA 4QH1A 3KBTA 4DNDA 5BRXA 3LBXA 2ZMAA 4EYUA 2Y58A 2N2NA 2ZM6T 5DJQC 3CQGB 3AAEB 1IBKT 3PMZA 4L5GA 4IGUA 2J4GA 3OYXA 2JQQA 2IHR1 2WSSV 2CWYA 2LSIA 2YK0A 5L4HA 4EV6A 1N36T 3I0QA 2CRBA
chains in the Genus database with same CATH topology
2XQ6A 5HCJA 4UM1A 3C79A 5L47A 4DBMA 2BG9A 5J5FA 4HQPA 3U8MA 4IL9A 4WV9A 3ZDHA 3TLWA 4IREA 2WNJA 4UXUA 4D01A 5AFLA 5AFMB 4Z90A 2W8FA 4XK9A 4LMKA 4COFA 3TLVA 2XZ5A 3JADA 2XNUA 3WTIA 3TLSA 2XYTA 3SQ6A 3PEOA 1OEDA 3UQ4A 4QAAA 5HCMA 5JMEA 4ZRUA 4ILAA 3EI0A 5BP0A 4LMLA 4QACA 5CO5A 4NPPA 3U8NA 4BFQA 4ILCA 2LLYA 3WTOA 2WN9A 2BR8A 4FRRA 2VL0A 5CFBA 3T4MA 5HEUA 2BG9E 4ZJTA 1I9BA 2XNVA 4BQTA 5BW2A 2YMDA 4ZK1A 3GUAA 5SYOA 3RIAA 1OEDB 4ILBA 2BYNA 5HEOA 2BYPA 5HEGA 2Y57A 4Z91A 5IUXA 3UQ7A 4ALXA 2LM2A 3RHWA 4B5DA 4HFEA 2BR7A 2PGZA 2ZJVA 3TLUA 2YOEA 4LMJA 3IGQA 5AFKA 3TLTA 2BYRA 4TNVA 2LKGA 4UM3A 3EAMA 3WIPA 4HFBA 4TWFA 5AFNA 3RQWA 3UU6A 2XQ5A 3WTJA 4NZBA 3UU5A 2Y54A 5L4EA 3JAEA 2WNLA 4PIRA 4QABA 5J0ZA 4F8HA 2PH9A 4EZ1A 1UX2A 5KE4A 4AFGA 2ZJUA 3WTHA 3RI5A 3RQUA 2XQ8A 2WZYA 4TWDA 2X00A 3EHZA 2MAWA 4HFCA 3UU3A 3ZKRA 2Y7YA 5J5IA 2XQ4A 4QH5A 4QH4A 2XYSA 3C84A 5AFHA 2YN6A 4HFHA 3ZDGA 4TNWA 3UU8A 4AFTA 3UUBA 2XQAA 5LXBA 4TWHA 2KSRA 2BG9C 3JAFA 2QC1B 4A97A 5HEJA 3WTKA 2XQ3A 3WTMA 2M6BA 1UV6A 5HEHA 2YMEA 4ZK4A 2X00D 4QH1A 2C9TA 3U8LA 1OEDE 4ZZCA 4UM3S 4IL4A 2M6IA 5BRXA 1OEDC 4HFIA 5LG3A 5AINA 3U8JA 4HFDA 5TVCA 2XQ7A 2YKSA 3P4WA 4ZZBA 2XNTA 2Y56A 2Y58A 5J5HA 3U8KA 5AFJA 5KZUA 3RIFA 4ZJSA 1UW6A 3WTLA 4X5TA 2LKHA 4UM3P 4ZR6A 3UU4A 3P50A 5J5GA 3SIOA 3PMZA 2BJ0A 2BYSA 2BG9B 3LSVA 4XHEA 2BYQA 2W8GA 5L4HA 3SQ9A 3WTNA 2XZ6A 2XQ9A 5AFMA 3SH1A 4A98A 2UZ6A 5FJVA 4AFHA 2WNCA 4UY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ6 A;  5HCJ A;  4UM1 A;  3C79 A;  5L47 A;  4DBM A;  2BG9 A;  5J5F A;  4HQP A;  3U8M A;  4IL9 A;  4WV9 A;  3ZDH A;  3TLW A;  4IRE A;  2WNJ A;  4UXU A;  4D01 A;  5AFL A;  5AFM B;  4Z90 A;  2W8F A;  4XK9 A;  4LMK A;  4COF A;  3TLV A;  2XZ5 A;  3JAD A;  2XNU A;  3WTI A;  3TLS A;  2XYT A;  3SQ6 A;  3PEO A;  1OED A;  3UQ4 A;  4QAA A;  5HCM A;  5JME A;  4ZRU A;  4ILA A;  3EI0 A;  5BP0 A;  4LML A;  4QAC A;  5CO5 A;  4NPP A;  3U8N A;  4BFQ A;  4ILC A;  2LLY A;  3WTO A;  2WN9 A;  2BR8 A;  4FRR A;  2VL0 A;  5CFB A;  3T4M A;  5HEU A;  2BG9 E;  4ZJT A;  1I9B A;  2XNV A;  4BQT A;  5BW2 A;  2YMD A;  4ZK1 A;  3GUA A;  5SYO A;  3RIA A;  1OED B;  4ILB A;  2BYN A;  5HEO A;  2BYP A;  5HEG A;  2Y57 A;  4Z91 A;  5IUX A;  3UQ7 A;  4ALX A;  2LM2 A;  3RHW A;  4B5D A;  4HFE A;  2BR7 A;  2PGZ A;  2ZJV A;  3TLU A;  2YOE A;  4LMJ A;  3IGQ A;  5AFK A;  3TLT A;  2BYR A;  4TNV A;  2LKG A;  4UM3 A;  3EAM A;  3WIP A;  4HFB A;  4TWF A;  5AFN A;  3RQW A;  3UU6 A;  2XQ5 A;  3WTJ A;  4NZB A;  3UU5 A;  2Y54 A;  5L4E A;  3JAE A;  2WNL A;  4PIR A;  4QAB A;  5J0Z A;  4F8H A;  2PH9 A;  4EZ1 A;  1UX2 A;  5KE4 A;  4AFG A;  2ZJU A;  3WTH A;  3RI5 A;  3RQU A;  2XQ8 A;  2WZY A;  4TWD A;  2X00 A;  3EHZ A;  2MAW A;  4HFC A;  3UU3 A;  3ZKR A;  2Y7Y A;  5J5I A;  2XQ4 A;  4QH5 A;  4QH4 A;  2XYS A;  3C84 A;  5AFH A;  2YN6 A;  4HFH A;  3ZDG A;  4TNW A;  3UU8 A;  4AFT A;  3UUB A;  2XQA A;  5LXB A;  4TWH A;  2KSR A;  2BG9 C;  3JAF A;  2QC1 B;  4A97 A;  5HEJ A;  3WTK A;  2XQ3 A;  3WTM A;  2M6B A;  1UV6 A;  5HEH A;  2YME A;  4ZK4 A;  2X00 D;  4QH1 A;  2C9T A;  3U8L A;  1OED E;  4ZZC A;  4UM3 S;  4IL4 A;  2M6I A;  5BRX A;  1OED C;  4HFI A;  5LG3 A;  5AIN A;  3U8J A;  4HFD A;  5TVC A;  2XQ7 A;  2YKS A;  3P4W A;  4ZZB A;  2XNT A;  2Y56 A;  2Y58 A;  5J5H A;  3U8K A;  5AFJ A;  5KZU A;  3RIF A;  4ZJS A;  1UW6 A;  3WTL A;  4X5T A;  2LKH A;  4UM3 P;  4ZR6 A;  3UU4 A;  3P50 A;  5J5G A;  3SIO A;  3PMZ A;  2BJ0 A;  2BYS A;  2BG9 B;  3LSV A;  4XHE A;  2BYQ A;  2W8G A;  5L4H A;  3SQ9 A;  3WTN A;  2XZ6 A;  2XQ9 A;  5AFM A;  3SH1 A;  4A98 A;  2UZ6 A;  5FJV A;  4AFH A;  2WNC A;  4UY2 A; 
#chains in the Genus database with same CATH topology
 1N34 T;  5HCJ A;  3ZCJ A;  5LNK A;  4ERR A;  3RKO A;  4HTE A;  2JIW A;  4LF4 T;  1IBL T;  3EVY A;  3ZMZ B;  4Z90 A;  2XJ7 A;  3Q5E A;  3NRX A;  1WCR A;  2H7O A;  5F3J A;  3AEE A;  1Y01 A;  2XAJ B;  3PTR B;  4EIW A;  4YHJ A;  3QOF A;  4K0U A;  2V8S V;  2WDR A;  4FRR A;  4I50 E;  2Y8D A;  3PUY F;  3GUA A;  5LJM A;  4HFE A;  5L3D B;  4HFB A;  3RPU A;  2X0Y A;  1Z8U A;  5L4E A;  1UGO A;  3V5U A;  3PUW F;  2ACZ A;  3I0O A;  4AFG A;  4UEM A;  3EHZ A;  2Y7Y A;  1ZKE A;  4LFB T;  2DHR A;  4X65 T;  1KNP A;  3K1S A;  3QUJ A;  5LXB A;  4YSX A;  4JV5 T;  5JDQ A;  2BS4 A;  4ZOL E;  2C5K T;  3K3Q C;  3AE3 A;  4IE4 A;  1OED C;  3AA6 B;  4X1I E;  3OVU A;  2DLR A;  4WBO A;  1H7C A;  4DR5 T;  5J5G A;  5M4Y A;  3LSV A;  3NZQ A;  2X66 A;  3AA1 B;  3LK3 B;  2KWI B;  4U31 A;  3P7I A;  4IL9 A;  4I0U A;  4IRE A;  4D01 A;  5AFL A;  1FMV A;  1G8X A;  2WU5 A;  4H9S E;  4A5X A;  1E7P A;  5HCM A;  1X9B A;  3C51 A;  4WYV A;  1XNQ T;  5C2T A;  4I43 B;  5BW2 A;  3CIR A;  4ILB A;  1XMQ T;  2YOE A;  2WM9 A;  2BKO A;  2BZB A;  4UF0 B;  4CXY A;  4HWF A;  3RI5 A;  3ZT5 A;  4ASK A;  3PJA J;  2RA1 A;  3T8O A;  3UUB A;  1S35 A;  1HX8 A;  3KBU A;  5HEH A;  2LSJ A;  4EOZ B;  3DP7 A;  4HFI A;  3P4W A;  2V6X A;  2N9D A;  4QWN B;  3WTL A;  2WWV A;  5L3C B;  4JBW F;  3GN5 B;  2WMO A;  3L3P A;  5FXZ A;  3ZST A;  3T1H T;  1VCS A;  2BG9 A;  1XMO T;  4X1Y E;  3A7M A;  4JYA T;  5HAX A;  2ES0 A;  3D0T A;  1MMA A;  4X1K E;  2B76 A;  3VR8 A;  3KIN B;  2H89 A;  4UEL A;  5AQQ B;  4C91 A;  2X0H A;  3NVO A;  3AED A;  3VHL A;  3C4Z A;  3EI0 A;  4IST A;  4YJ2 E;  4PFO A;  2I6H A;  2X67 A;  5CFB A;  3FXE B;  3MKD A;  3A8Y C;  4J2C A;  4BQT A;  3NRY A;  5ABF A;  4KUM B;  3O1H A;  3Q5X A;  1HCI A;  5AFK A;  4HE8 A;  4PFP A;  3MJX A;  3L8R A;  3VU7 H;  2W67 A;  2ZM0 A;  3AAI A;  4FI5 A;  1M62 A;  4L9I A;  4KBM B;  3N2G E;  3RQU A;  2CLY B;  3ONJ A;  5A1L A;  4HWH A;  2V7L A;  5L3F B;  3RC3 A;  3JC6 C;  4JUY A;  2KWH A;  3RF1 A;  5ETW A;  3UU8 A;  5LBM A;  1U5P A;  3JAF A;  5JDG A;  5JR9 A;  2X00 D;  2Q9Q D;  1FJG T;  2DL1 A;  4U33 A;  3TKL B;  5JRE A;  3U8K A;  2MOZ A;  2Z6E A;  1UW6 A;  1QUU A;  3BK9 A;  3V5S A;  4AKL A;  5LOV E;  4UVB B;  3SIO A;  5H6R B;  4E7Z A;  1KFY A;  3L09 A;  2LOP A;  2UUA T;  4HGA A;  3G06 A;  4LFA T;  2IUB A;  3AE7 A;  3O4X E;  4YSY A;  2NTY A;  2YDR A;  3BQI A;  3T1Y T;  3U8M A;  4BJN A;  4U7Y A;  2WNJ A;  2L8K A;  3MAC A;  1VOM A;  3MZK B;  3WTI A;  2YU1 A;  2XYT A;  5HXE A;  3F2E A;  3HR0 A;  3ZT7 A;  4DMW A;  3AEF A;  2UU9 T;  3OKQ A;  3EAB A;  1CUN A;  5CGM A;  2M67 A;  2YDQ A;  5ABH A;  4I55 E;  4ZK1 A;  1R8I A;  3DJB A;  4JEH B;  5TAO A;  4B5D A;  3AE9 A;  5E0O A;  3VR9 A;  4JLE A;  2LKG A;  4MBQ A;  2Y54 A;  3U3I A;  5AQR B;  5LGN B;  5J0Z A;  4QXH B;  1KF6 A;  1ZOY A;  3WTH A;  2HHH T;  5L3G B;  2JQH A;  4GK5 E;  4NXN T;  2DNX A;  3ZDG A;  4TNW A;  2XQA A;  4EGW A;  4KHP T;  3P4P A;  1WLX A;  4OYJ A;  4HWD A;  4CXW A;  1MMN A;  3NBX X;  1UV6 A;  4MFR A;  4ZK4 A;  4JEU B;  2C5I T;  4HN9 A;  1W9R A;  3MXZ A;  2XNT A;  2Y56 A;  4EED A;  3KVB A;  4HEA A;  1HS7 A;  2CM0 A;  2A3D A;  3IBP A;  5AQO B;  4DBR A;  4U7I A;  1D1C A;  3L39 A;  1D0X A;  5FKY A;  2E9X A;  3SFD A;  1KEY A;  4Q25 A;  4KI0 F;  2XPK A;  3SWH A;  3TLS A;  4ZI3 D;  1OED A;  1KK7 A;  2X9X A;  4DR2 T;  2W2U A;  1UUR A;  2XZE A;  4BFQ A;  2BR8 A;  3LG7 A;  2Q9Q C;  5LBQ B;  4YJ3 E;  5SYO A;  2K48 A;  5IUX A;  4TUY E;  1IJ5 A;  5LHI B;  2LM2 A;  2EHO B;  2LRL A;  2V1D B;  3N9M A;  1QLB A;  5LA6 E;  1NEK A;  2MBG A;  3FBL A;  3NZP A;  3A5X A;  2WWU A;  2Q9Q A;  2X00 A;  3FZK B;  2XHE B;  2XQ4 A;  2W4X A;  2SPC A;  3SRZ A;  3N9N A;  3MA9 A;  4CN6 A;  5LGT B;  3HKE E;  4UIG A;  4XAX B;  4JI6 T;  5KZU A;  5AQG B;  3FBZ A;  5L3E B;  4AIS A;  2D5U A;  5JRC B;  2IAK A;  5JR9 C;  2CE7 A;  4KX6 A;  2NOX A;  4ZEY A;  2K5B B;  2UXX B;  3SH1 A;  3ZCI A;  3VRA A;  3FZM B;  4YTN A;  3Q2M A;  4HWC A;  4DR4 T;  1FMW A;  4COF A;  1NAF A;  4PJN A;  2AXD S;  3C50 A;  1KNZ A;  2KLQ A;  3PUV F;  2WCA A;  4DV1 T;  1EZ3 A;  3RIU A;  1LVK A;  5C8Y E;  3M3Z B;  4ZI7 E;  1J5W A;  1ZEE A;  3WAJ A;  3AEA A;  4IT4 A;  4NIQ A;  1D0Z A;  4CXX A;  3N9P A;  1HR0 T;  3OBV E;  4QXC B;  5L3B B;  1YQ4 A;  4UM3 A;  1D1B A;  4DR3 T;  5F5W A;  4PIR A;  4PK6 A;  2PH9 A;  5JRC A;  3ZMT B;  4YFS A;  3I9Y A;  1MMD A;  2XQ8 A;  4YHH T;  4QH4 A;  5KX5 E;  4O4L E;  3GN5 A;  2OV9 A;  2BVL A;  4AFT A;  5HXR A;  1MIY A;  1VCT A;  2DWK A;  5LMU T;  4A97 A;  3ZEF B;  5GON E;  1IZN B;  2ACX A;  1NEN A;  3N2O A;  3RYC E;  4IL4 A;  3UT5 E;  3RH3 A;  1N32 T;  3N9O A;  2E9X B;  2CBJ A;  2IIU A;  4UV9 B;  2E9X D;  2V26 A;  2LJL A;  2NW9 A;  4YT0 A;  3NKZ A;  2WDQ A;  3PU8 A;  2V7J A;  4B3R T;  2YDS A;  2RPA A;  4OHF A;  3OJA A;  2W8F A;  3UFG A;  2X9H A;  1IBM T;  3OYZ A;  4U2Z A;  3UQ4 A;  3HI2 A;  4H9N C;  4EZH A;  2C0S A;  3RGL A;  1GQE A;  2X9Y A;  1YKH B;  5JDH A;  5C3J A;  3S4U A;  2DI4 A;  1MIW A;  3N9Q A;  2Y57 A;  4QX8 B;  4FJO A;  3RHW A;  1BR0 A;  3RLF F;  2ZJV A;  5J2T E;  3WIP A;  1US7 B;  2XQ5 A;  4IDO A;  5AQP B;  5KE4 A;  4QKN A;  3CML A;  3ETV A;  2NW8 A;  4LF7 T;  4K0K T;  2BKN A;  4LFC T;  4HFH A;  3FHN A;  2BDE A;  3CX8 B;  3AE2 A;  2WY2 A;  3AE4 A;  4LF5 T;  2VB6 A;  2H3R A;  2NP9 A;  2C9T A;  3C98 B;  4JI7 T;  4ZZC A;  4UM3 S;  3K8P C;  4HFD A;  5TVC A;  2XQ7 A;  4UVC B;  2XQY A;  2JMK A;  4H9Q C;  3AE5 A;  4X5T A;  4H9R C;  2W62 A;  4NUV A;  2BG9 B;  3WI3 A;  5KDM C;  2NR4 A;  3WTN A;  2V6Y B;  4UV8 B;  3KVA A;  4AQY T;  4UY2 A;  1T98 A;  3ONX A;  4UM1 A;  4HQP A;  5FL1 A;  3ZDH A;  5JR9 B;  4X64 T;  4QX7 B;  2HPJ A;  3GA8 A;  3CPZ A;  2EHO D;  4EXT A;  3AEB A;  2EHO C;  3LFM A;  4OX9 T;  1HX1 B;  4QAA A;  5JME A;  1G73 A;  4AI6 A;  2BKP A;  4NPP A;  2V5C A;  2QRX A;  2VVN A;  2BS2 A;  3CVR A;  3F31 A;  2FJD A;  4ZJT A;  1W09 A;  4YTM A;  2JJ9 A;  4CI3 B;  1OED B;  4F6R C;  2IC9 A;  2BYP A;  3X1D A;  4CZZ B;  4NUU A;  3K3O A;  2V7M A;  1X79 A;  1LRZ A;  3E08 A;  2WB5 A;  2BYR A;  4MAL A;  3PUG A;  4AQG A;  1DU2 A;  3WTJ A;  2ZM2 A;  4NZB A;  4CQI A;  4F8H A;  5AQK B;  2I0M A;  5JDN A;  2AE9 A;  4QH5 A;  4V1A v;  3HA4 A;  5HXH A;  5AQI B;  2WAU A;  4IDZ A;  4PAG A;  4N78 D;  2IDO B;  5JH7 E;  2B1E A;  1UX4 A;  2E9X C;  4GYS A;  2CHN A;  2V7I A;  1HTJ F;  2CXD A;  2VKO A;  2BS3 A;  2JPF A;  3KV9 A;  4PK5 A;  5AQJ B;  4ZR6 A;  3EDU A;  3ZN0 B;  5JTG A;  3U78 A;  5AQN B;  5FYM A;  1NWM X;  1FIO A;  3CQX C;  4OYK A;  2MPK A;  2WNC A;  4EB6 E;  2XQ6 A;  3I1A A;  4DBM A;  4ADZ A;  2MTQ A;  2J62 A;  2JQ9 A;  3TLV A;  3M65 A;  2KND A;  4GIW A;  2DCF A;  4KHZ F;  2X9W A;  1J1J A;  3PUX F;  4ILA A;  3O9X A;  2FUP A;  5LHG B;  2NTX A;  2KZ7 B;  2MYS A;  3IF8 B;  5BR8 T;  2N1G A;  3PJA A;  2W00 A;  3RYH E;  2Y48 B;  4ISS A;  5J2U E;  2X68 A;  4UF0 A;  1KNR A;  3FXD B;  2KXP B;  4H9P C;  3UQ7 A;  2V5D A;  3AXJ B;  3IEE A;  5HXS A;  4WNK A;  4XZC A;  1N33 T;  4H9O C;  4OFZ A;  1JNR A;  3PV0 F;  5JDL A;  1W0A A;  4G63 A;  2WZY A;  5FL0 A;  2XYS A;  5JVD E;  3WAK A;  4C90 A;  4JI2 T;  4IHJ E;  5HEJ A;  3FZH B;  4IE0 A;  4AXP A;  4GOU A;  3AB3 B;  3H3A A;  1ZHC A;  1YD8 G;  5J5H A;  4JI0 T;  1D1A A;  2KMF A;  2Q9Q B;  5AFJ A;  3B57 A;  2LOS A;  4UM3 P;  1XZY A;  5FVK A;  3AVR A;  1JNZ A;  5FJV A;  3ZJ1 A;  4IE5 A;  2P9B A;  5LYJ E;  5J5F A;  5FY0 A;  4GKK T;  3ANW A;  3QNU A;  2CXF A;  4UXU A;  2D0U A;  2W61 A;  2UXC T;  4IIJ E;  2A2F X;  2XNU A;  2XZ5 A;  2LSY A;  3QB5 K;  3Q5W A;  4UXN B;  4TV9 E;  4ZRU A;  5FXX A;  4LML A;  4JI3 T;  5CO5 A;  5KXJ A;  5AQH B;  3ETU A;  5CA1 E;  2QYW A;  2VL0 A;  4G2A A;  3B13 A;  5HEU A;  2HPL A;  3C4W A;  4PW8 A;  1YKE B;  3AE1 A;  2CCQ A;  2XAG B;  1VRB A;  3FZL B;  5AQL B;  3IGQ A;  4DV4 T;  2K24 A;  1HF8 A;  4AIU A;  1E1H B;  2VQE T;  4TV8 E;  1UX2 A;  3PE0 A;  4A56 A;  1HNZ T;  4LF8 T;  3ZKR A;  3P4S A;  2H7V C;  2I59 A;  1WR0 A;  4DV0 T;  4AKH A;  2LM9 A;  4JI5 T;  4DVD A;  5ABF B;  4NXM T;  5AQS B;  4YSZ A;  1HFA A;  1BR2 A;  3P4Q A;  2L3L A;  2ZLY A;  2QGS A;  1O3X A;  5AFU L;  2CXL A;  3ZYM A;  2CBI A;  4PJJ A;  4O2B E;  1BR1 A;  3HKC E;  4ZS3 A;  1WRD A;  3AA7 B;  2BYQ A;  2XSB A;  4AKI A;  5J1G A;  3CX7 B;  2XQ9 A;  1T8B A;  1WYB A;  2H88 A;  1YW0 A;  3GMI A;  2FJB A;  3H3M A;  4AFH A;  5LB7 B;  2FJE A;  2VL8 A;  1SHZ C;  1W0B A;  4DV6 T;  1XWM A;  1MND A;  3RIU C;  2IW5 B;  3LBX B;  2E5L T;  1IAP A;  5LG4 A;  2WBL A;  1E2A A;  3DTO A;  3HL6 A;  2XNV A;  4IE7 A;  3ZT6 A;  2BYN A;  5HEG A;  4LF6 T;  4O4H E;  3ZPO A;  4PJM A;  4B6X A;  2WZI A;  2W63 A;  3EAM A;  4DV3 T;  4KMC A;  3JAE A;  4EZ1 A;  1LVF A;  3BQL A;  2FBW A;  1UUS A;  5DQV A;  4CN4 A;  3HKB E;  3FB2 A;  3AE8 A;  4BA9 A;  4IE6 A;  2LT3 A;  3NWI A;  5AQV B;  5AFH A;  2YN6 A;  2WMN A;  3AAA B;  1WYC A;  5FXW A;  2NW7 A;  2VWA A;  3E22 E;  3WTM A;  3P4R A;  5JDF A;  4HWI B;  1I94 T;  4WZX A;  5ADX L;  1IJ6 A;  5IWA T;  2F4V T;  4O2A E;  2A9U A;  5LXT E;  4EEB A;  2WZH A;  4MHC A;  3R84 B;  4X62 T;  2VUR A;  4XHE A;  4ZXL A;  3ESL A;  3C64 A;  3QB5 A;  3VKG A;  1MIV A;  2LE8 A;  3KV6 A;  4I4T E;  2XZ6 A;  3ZJ2 A;  4U74 A;  4DR7 T;  4IDN A;  3OTO T;  3C79 A;  1SUM B;  2A72 A;  3PUR A;  5EZY E;  3TLW A;  2ZM8 A;  1HNX T;  1YQ3 A;  1UK5 A;  3F57 A;  2XAQ B;  3PEO A;  2CWO A;  4ZS2 A;  4ZI2 D;  3PDY A;  3KV5 A;  2BBJ A;  4DUZ T;  4IDQ A;  2VKH A;  1B7T A;  1QSD A;  2C5J A;  2V6Y A;  4IDP A;  2XAF B;  4U3C A;  2UXB T;  2CA5 A;  4LMJ A;  3EDV A;  3UUL A;  3C4X A;  5AQM B;  3ABV A;  4E7S A;  5LHH B;  5FP3 A;  5JDM A;  3ANW B;  3ZC0 A;  4QAB A;  3HKD E;  3ZSS A;  3LK2 B;  3LDQ B;  4TWD A;  4HFC A;  3C84 A;  2BBH A;  3RYF E;  5H6Q B;  4PJL A;  2YEV C;  4QXB B;  4DO0 A;  2G0U A;  5CB4 E;  2VAS A;  3O1J A;  1XNR T;  4DV2 T;  4Z8X A;  1UCU A;  3U8J A;  4DMV A;  1CHU A;  4ZJS A;  2CHO A;  4EAH A;  2CMR A;  5ABG A;  3UU4 A;  3P50 A;  2BYS A;  3CKD A;  2XAH B;  3SQ9 A;  2PFV A;  3UTK A;  2XUE A;  5KMG P;  2CLY C;  1XDO A;  2ODU A;  5LP6 E;  2LRK A;  3CWZ B;  1HNW T;  2BVM A;  4DBQ A;  4WV9 A;  3PUZ F;  4MLK A;  2LHN A;  3JAD A;  2WQY A;  2PJQ A;  4ANJ A;  3ZYL A;  3CK6 A;  4O4J E;  2E8I A;  4GKJ T;  1LKX A;  2LLY A;  3WTO A;  1S94 A;  3I9W A;  5AQU B;  5FY1 A;  2QA7 A;  4DID B;  1I9B A;  4TZ4 C;  5IYZ E;  2UXN B;  2HN2 A;  5EK2 A;  4M1P A;  3RRW A;  3J7Y q;  1UX5 A;  2BR7 A;  1D0Y A;  4B3M T;  3TLT A;  3RYI E;  2DWG A;  4YTP A;  4JI4 T;  1Z0P A;  4HKA A;  2MAW A;  4JI1 T;  5ABE A;  1L0V A;  3R6N A;  3N5L A;  3SOL A;  2VQF T;  3ZLI A;  4TN7 B;  2Y6X A;  2KSR A;  5FXV A;  2QC1 B;  5L2L A;  3LK4 2;  2YME A;  2D0T A;  4ZZB A;  5HXC A;  3RIF A;  4P0B A;  2BJ0 A;  4AQF C;  2XTL A;  2E2A A;  2W8G A;  3SS1 A;  2YU2 A;  2UZ6 A;  2EHO A;  2X51 A;  2XM2 A;  2CEA A;  4JI8 T;  1HG5 A;  4DV5 T;  5LJN A;  4PK4 A;  2J1D G;  1SE7 A;  3SFE A;  4AQF A;  3AVS A;  4O4I E;  3UUX B;  2WP9 A;  4WBN E;  2BG9 E;  4O8S A;  4EYY R;  3K3N A;  3ZYK A;  1HG2 A;  4WW0 A;  4ZI2 C;  1WFD A;  3IA3 A;  3AA0 B;  2WU2 A;  3JC6 D;  5F8P A;  2NWB A;  5BMV E;  2R6G F;  5LGU B;  4GYR A;  3RQW A;  3UU6 A;  1T72 A;  5FMN A;  2LSK A;  3KV4 A;  2ZJU A;  2XY8 B;  5EK4 A;  2W0G A;  2WS3 A;  3UU3 A;  3OPC A;  1Y64 B;  4ZHQ E;  2BG9 C;  4L0R A;  3WTK A;  1ZV4 X;  2HH7 A;  2XQ3 A;  2M6B A;  3E0Z A;  4ZI3 C;  3UUN A;  3AEG A;  5DAB A;  3QC9 A;  1OED E;  3KFW X;  3J9X 1;  2XSA A;  5LG3 A;  3IHR A;  2YKS A;  4AKR B;  4CI2 B;  4YY3 T;  3UFE A;  2L9Q A;  4DR1 T;  5LMN T;  4B3S T;  2E5V A;  2LKH A;  3ZMV B;  4TX5 A;  1J5E T;  5AFM A;  4HFV A;  4A98 A;  4EZ4 A;  2PBI A;  2XAS B;  2PG8 A;  5L47 A;  3RKG A;  3W15 B;  2KT9 A;  1M7K A;  3O1I A;  5EK3 A;  2IML A;  4KP3 C;  2LSG A;  3SQ6 A;  2UUC T;  4DUY T;  3Q5D A;  2VKD A;  4ILC A;  3AEC A;  2ODV A;  3T4M A;  1YXR A;  3ONL C;  3ZMU B;  2VKJ A;  2W66 A;  5HEO A;  1FEW A;  2KIN B;  4CI1 B;  5FVL A;  4ALX A;  5AQT B;  4H63 H;  4AKG A;  5CJ5 A;  4TNV A;  2VVS A;  2XM1 A;  4U2Y A;  2IC6 A;  3Q9D A;  3UU5 A;  3VRB A;  2WNL A;  3AXJ A;  1BR4 A;  5LCY A;  4ILU A;  3ZC1 A;  2JRK A;  4UVA B;  3JCF A;  1AJ3 A;  3PUA A;  2X0L B;  4CN1 A;  4YLH A;  5J5I A;  5FNV E;  1MMG A;  4BJM A;  5HWX A;  3RC8 A;  4B3T T;  1U4Q A;  5HWY A;  4X66 T;  2FJA A;  2OA5 A;  3N9L A;  4U72 A;  1XDP A;  4P09 A;  3U8L A;  5IHY A;  2M6I A;  3LJC A;  2LHR A;  4QHO A;  5AQF B;  5AIN A;  3MK7 C;  4DR6 T;  5CA0 E;  5HYA A;  2UUB T;  3RX6 A;  4XBF B;  1OWA A;  3PU3 A;  4GK0 E;  3FZF B;  3KDS E;  4DV7 T;  4UR9 A;  2OLT A;  3QK6 A;  1MNE A;  2CPT A;  2PTF A;  3B5M A;  1WR6 A;  2D2S A;  3CQC B;  5AFM B;  2QVA A;  4XK9 A;  3VKH A;  4LMK A;  2LEH A;  2WDV A;  3AE6 A;  1ZP0 A;  2HN1 A;  5BP0 A;  2JQK A;  2UXD T;  1I6Z A;  4QAC A;  3U8N A;  2D9D A;  4X20 E;  2WN9 A;  1T7S A;  5JQG E;  4BAY B;  2GK9 A;  2RP4 A;  2K9A A;  2YMD A;  2YIN A;  3RIA A;  2J47 A;  4Z91 A;  4OK0 A;  2K3W A;  4P0A A;  2PGZ A;  3UUM A;  1V9D A;  3TLU A;  4H63 V;  3EUH A;  4PNI A;  1SA0 E;  4TWF A;  5AFN A;  2VK9 A;  3ZMS B;  3P8C D;  4LF9 T;  3GWH A;  4P1N A;  3ZN1 B;  3H37 A;  5DQW A;  3BQK A;  1OXZ A;  4YXD A;  3N2K E;  2V7K A;  3PUQ A;  3PUS A;  5FY7 A;  3CX6 B;  4TWH A;  3RRC A;  2JMH A;  4QH1 A;  3KBT A;  4DND A;  5BRX A;  3LBX A;  2ZMA A;  4EYU A;  2Y58 A;  2N2N A;  2ZM6 T;  5DJQ C;  3CQG B;  3AAE B;  1IBK T;  3PMZ A;  4L5G A;  4IGU A;  2J4G A;  3OYX A;  2JQQ A;  2IHR 1;  2WSS V;  2CWY A;  2LSI A;  2YK0 A;  5L4H A;  4EV6 A;  1N36 T;  3I0Q A;  2CRB A; 
#chains in the Genus database with same CATH homology
 2XQ6 A;  5HCJ A;  4UM1 A;  3C79 A;  5L47 A;  4DBM A;  2BG9 A;  5J5F A;  4HQP A;  3U8M A;  4IL9 A;  4WV9 A;  3ZDH A;  3TLW A;  4IRE A;  2WNJ A;  4UXU A;  4D01 A;  5AFL A;  5AFM B;  4Z90 A;  2W8F A;  4XK9 A;  4LMK A;  4COF A;  3TLV A;  2XZ5 A;  3JAD A;  2XNU A;  3WTI A;  3TLS A;  2XYT A;  3SQ6 A;  3PEO A;  1OED A;  3UQ4 A;  4QAA A;  5HCM A;  5JME A;  4ZRU A;  4ILA A;  3EI0 A;  5BP0 A;  4LML A;  4QAC A;  5CO5 A;  4NPP A;  3U8N A;  4BFQ A;  4ILC A;  2LLY A;  3WTO A;  2WN9 A;  2BR8 A;  4FRR A;  2VL0 A;  5CFB A;  3T4M A;  5HEU A;  2BG9 E;  4ZJT A;  1I9B A;  2XNV A;  4BQT A;  5BW2 A;  2YMD A;  4ZK1 A;  3GUA A;  5SYO A;  3RIA A;  1OED B;  4ILB A;  2BYN A;  5HEO A;  2BYP A;  5HEG A;  2Y57 A;  4Z91 A;  5IUX A;  3UQ7 A;  4ALX A;  2LM2 A;  3RHW A;  4B5D A;  4HFE A;  2BR7 A;  2PGZ A;  2ZJV A;  3TLU A;  2YOE A;  4LMJ A;  3IGQ A;  5AFK A;  3TLT A;  2BYR A;  4TNV A;  2LKG A;  4UM3 A;  3EAM A;  3WIP A;  4HFB A;  4TWF A;  5AFN A;  3RQW A;  3UU6 A;  2XQ5 A;  3WTJ A;  4NZB A;  3UU5 A;  2Y54 A;  5L4E A;  3JAE A;  2WNL A;  4PIR A;  4QAB A;  5J0Z A;  4F8H A;  2PH9 A;  4EZ1 A;  1UX2 A;  5KE4 A;  4AFG A;  2ZJU A;  3WTH A;  3RI5 A;  3RQU A;  2XQ8 A;  2WZY A;  4TWD A;  2X00 A;  3EHZ A;  2MAW A;  4HFC A;  3UU3 A;  3ZKR A;  2Y7Y A;  5J5I A;  2XQ4 A;  4QH5 A;  4QH4 A;  2XYS A;  3C84 A;  5AFH A;  2YN6 A;  4HFH A;  3ZDG A;  4TNW A;  3UU8 A;  4AFT A;  3UUB A;  2XQA A;  5LXB A;  4TWH A;  2KSR A;  2BG9 C;  3JAF A;  2QC1 B;  4A97 A;  5HEJ A;  3WTK A;  2XQ3 A;  3WTM A;  2M6B A;  1UV6 A;  5HEH A;  2YME A;  4ZK4 A;  2X00 D;  4QH1 A;  2C9T A;  3U8L A;  1OED E;  4ZZC A;  4UM3 S;  4IL4 A;  2M6I A;  5BRX A;  1OED C;  4HFI A;  5LG3 A;  5AIN A;  3U8J A;  4HFD A;  5TVC A;  2XQ7 A;  2YKS A;  3P4W A;  4ZZB A;  2XNT A;  2Y56 A;  2Y58 A;  5J5H A;  3U8K A;  5AFJ A;  5KZU A;  3RIF A;  4ZJS A;  1UW6 A;  3WTL A;  4X5T A;  2LKH A;  4UM3 P;  4ZR6 A;  3UU4 A;  3P50 A;  5J5G A;  3SIO A;  3PMZ A;  2BJ0 A;  2BYS A;  2BG9 B;  3LSV A;  4XHE A;  2BYQ A;  2W8G A;  5L4H A;  3SQ9 A;  3WTN A;  2XZ6 A;  2XQ9 A;  5AFM A;  3SH1 A;  4A98 A;  2UZ6 A;  5FJV A;  4AFH A;  2WNC A;  4UY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...