4HFHA

The glic pentameric ligand-gated ion channel (wild-type) complexed to bromoform
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfhA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfhA01
4ZRUA 1OEDC 3ZDGA 5HCMA 5KZUA 5AINA 3T4MA 4TNWA 4ZZBA 4ZZCA 3ZDHA 5HEOA 4BFQA 2MAWA 3JAFA 2Y7YA 4ILBA 5AFMB 4TWDA 4LMJA 3JAEA 2WNJA 5IUXA 4F8HA 2Y58A 2YN6A 1OEDB 3EI0A 5BW2A 2PH9A 4TWHA 3U8KA 3UU8A 2BYQA 2XQ5A 3UU5A 2XQAA 4PIRA 4AFHA 3WTKA 5AFNA 5HEJA 4UY2A 1OEDE 4COFA 2YMEA 4EZ1A 3EHZA 3PMZA 5AFLA 5L4EA 2WNLA 2XNTA 2KSRA 4Z90A 3UQ4A 2UZ6A 5KE4A 4A97A 2C9TA 2BJ0A 4IL9A 2XQ4A 4QH4A 4QACA 2XQ3A 2QC1B 3RI5A 5LXBA 2X00D 2VL0A 2XQ8A 3RQUA 4HFBA 1UW6A 3U8MA 4Z91A 3TLWA 2PGZA 2BR8A 5HEHA 4IL4A 4TNVA 3RIAA 2Y54A 4NZBA 4LMKA 4TWFA 4AFGA 4ZK1A 2M6BA 5J0ZA 4HFDA 5AFJA 4D01A 3RHWA 4UM3A 3TLSA 2Y57A 3WTOA 1UX2A 4ALXA 3ZKRA 2W8FA 4QAAA 5J5GA 3SQ9A 4ZJSA 4HFEA 4UXUA 3JADA 3SH1A 2BG9C 2XYSA 3TLVA 5AFHA 3TLUA 4XHEA 3UU3A 2XNUA 5BP0A 4UM3P 4A98A 2BR7A 5AFMA 3WIPA 1I9BA 4HFIA 2W8GA 3UU4A 2LKHA 3LSVA 1OEDA 2BG9B 2X00A 4UM3S 4ZJTA 5J5HA 3WTJA 5BRXA 5AFKA 4BQTA 3IGQA 3WTNA 2YKSA 4QABA 3SIOA 3U8JA 1UV6A 2LKGA 2XZ5A 2M6IA 3RQWA 4ILCA 2BG9E 2ZJUA 4XK9A 2ZJVA 2XQ6A 4HFHA 5HEUA 3SQ6A 5L47A 3EAMA 5FJVA 2LLYA 3P50A 2LM2A 4LMLA 5TVCA 5HCJA 4UM1A 3UU6A 4ZK4A 3WTMA 4DBMA 4QH1A 5L4HA 2XQ7A 3RIFA 4ILAA 5CFBA 2XZ6A 3WTLA 3WTHA 4FRRA 2WZYA 5JMEA 2WNCA 4B5DA 3PEOA 2BG9A 3TLTA 3P4WA 2Y56A 2XNVA 2YOEA 4IREA 4HQPA 2BYNA 2BYPA 5SYOA 5J5FA 2BYSA 3C84A 2XYTA 4WV9A 5HEGA 3U8LA 4HFCA 4QH5A 3UUBA 3GUAA 2BYRA 3U8NA 2XQ9A 5LG3A 3UQ7A 3C79A 5CO5A 4NPPA 4X5TA 3WTIA 2WN9A 4AFTA 2YMDA 4ZR6A 5J5IA
chains in the Genus database with same CATH superfamily
1BR1A 4GK5E 5KZUA 4JI7T 2EHOC 4ZZCA 5L3BB 4TWDA 2JPFA 3F31A 2ZM0A 4DV1T 2YN6A 3N9OA 5LNKA 2X67A 2BVMA 1JNZA 5CJ5A 4YSXA 2YDSA 3AE1A 4X1YE 5HEJA 1J5ET 4EZ1A 5LHGB 3ZMTB 1VCTA 2ZMAA 4WNKA 2HN1A 3AA0B 1T98A 3FZLB 3FB2A 5J0ZA 4ZS3A 5DQWA 5F5WA 2WS3A 3CQXC 1UX2A 4KX6A 2VQFT 1W9RA 2DNXA 5AQKB 3PJAA 1HR0T 2K5BB 2XUEA 4E7ZA 4IE4A 4BA9A 2EHOA 3A7MA 3KBTA 4X62T 4UEMA 2FJEA 3ZN1B 5EK3A 2XZ5A 1XMOT 2KWHA 4WW0A 5L47A 1KNZA 5DQVA 5KX5E 2CE7A 1HTJF 2J4GA 4QKNA 1X79A 4B5DA 2BG9A 2UUBT 4HQPA 5AQQB 2YU1A 5J1GA 3SWHA 4KI0F 2YEVC 5JTGA 4HWCA 5AINA 1I94T 1XDOA 2Q9QC 5LGNB 2GK9A 3CMLA 2CRBA 2DWKA 5ABEA 3K3QC 3FBLA 5L3GB 3O1JA 2WNLA 1E1HB 4TN7B 4UR9A 4EXTA 3WAKA 3KV4A 5FY0A 2VL0A 3MJXA 2XQ8A 1U4QA 3AAEB 2CPTA 4GKKT 4CQIA 3IF8B 2K48A 3PE0A 5AFJA 5IWAT 3R6NA 3RHWA 4X1IE 3ZKRA 4ZJSA 2HH7A 3HKDE 5EK2A 5ABGA 3ZMVB 2ZM8A 1HS7A 4AKRB 4CN4A 2W8GA 3LG7A 3WTJA 4OFZA 4IDPA 3WTNA 4J2CA 2RP4A 4DV4T 1E2AA 2CXLA 4K0UA 5FMNA 3ZC0A 4X65T 2LM2A 3ANWB 3UU6A 4V1Av 4MHCA 4B3MT 4FRRA 3VR9A 2H7VC 4JI4T 3I9YA 3AA1B 3AE3A 1YKHB 1XNQT 3GUAA 5LA6E 3N2GE 5L3DB 5AFUL 1HX8A 1HG5A 4DUZT 3IHRA 4O4JE 1BR0A 2E8IA 3QNUA 3P4PA 5JDGA 2QVAA 4PIRA 4GK0E 4C91A 2XASB 1OEDE 2LRKA 4JI2T 1HFAA 2X9HA 1ZHCA 3AEEA 5LXBA 2HHHT 4E7SA 5LGUB 3PV0F 4LF9T 4MALA 3Q2MA 2XPKA 4DUYT 2IW5B 3Q9DA 5JREA 2WDQA 3TLSA 2A9UA 2V6YB 2H3RA 4HWDA 4IHJE 4LF4T 4DR6T 2DLRA 3VHLA 5FXWA 2XAFB 3AEDA 1KF6A 2OLTA 1H7CA 1IAPA 1UCUA 2E9XB 4UM3P 3HKEE 4PNIA 3UU4A 2LKHA 3E08A 5J5HA 5LP6E 2J62A 3ZCJA 3RC3A 4AKGA 2WMOA 3ZT5A 3D0TA 3FZKB 2ODVA 3SQ6A 3LBXB 4OX9T 4LFCT 4UM1A 2ACXA 4ZI3D 2CEAA 2RPAA 3AA6B 2UXDT 5JDMA 2XNVA 4P0BA 4ZOLE 2CHOA 4AKIA 4IGUA 4H63V 2DI4A 1O3XA 2F4VT 4EB6E 3QB5K 1NWMX 2YK0A 4KMCA 1OEDC 3S4UA 4UVBB 1ZP0A 4HKAA 3PUGA 3ANWA 4WBNE 2KWIB 3HKBE 3EI0A 2MTQA 5BW2A 4UXNB 4I55E 5JQGE 2CLYC 4MLKA 3VKHA 2C9TA 2LE8A 1MIVA 4QH4A 2ZM6T 2QC1B 2LSKA 2WZHA 2EHOD 5KMGP 2JQKA 5JDNA 4XZCA 5HWYA 3CPZA 4IL4A 4A56A 4D01A 2WDRA 5L2LA 4OK0A 3P4RA 3RGLA 4DR5T 4JI0T 2LT3A 1OEDA 2B76A 4GKJT 3RC8A 5LBQB 1D0XA 4PFPA 2PG8A 2FBWA 1WFDA 2DL1A 1IJ5A 2CWYA 5LGTB 5JDQA 1KFYA 4IDNA 3N2OA 5CGMA 3DTOA 5AQHB 2YOEA 4AQYT 4HTEA 4L9IA 3C79A 3P8CD 4CI3B 3T4MA 2CBJA 5HEOA 1BR4A 3QC9A 5IUXA 3ZCIA 2Y58A 3ZLIA 3ZSSA 4YFSA 4H9OC 3IBPA 2I6HA 5AFNA 3PMZA 2C0SA 4X64T 2M67A 4QWNB 3HA4A 4ZI2C 2NOXA 1J5WA 4HFBA 3OJAA 4EZ4A 1UW6A 4Z91A 2Q9QD 1FMVA 4GYSA 1T7SA 1EZ3A 3N9NA 4O4LE 4A5XA 2N9DA 2NTYA 5JR9C 4GOUA 4NIQA 4QAAA 4HFEA 4JEUB 2LM9A 5BR8T 3FBZA 4I0UA 4HFIA 3FZMB 4JLEA 4AKLA 3PURA 2YDRA 2LKGA 2H89A 5AQMB 2BG9E 3ZYKA 4UV8B 1FIOA 5AQFB 1QSDA 1BR2A 2CA5A 3ZMSB 5AQTB 2LSIA 1DU2A 2WNCA 4CXXA 3PEOA 4H9QC 1HG2A 4XAXB 2V6XA 3L09A 3RKGA 4DV3T 1L0VA 5L3CB 3RIUC 5FL0A 4TUYE 3FZHB 4DMWA 2QA7A 5AQUB 1NENA 1V9DA 2WNJA 3F57A 2X68A 5LHHB 5JDFA 4JV5T 2PH9A 2R6GF 2XQAA 2KINB 3O1HA 4COFA 4IE5A 2NW7A 2XNTA 3HKCE 2H7OA 2OV9A 4DBRA 3ZSTA 2W62A 3PUQA 1HF8A 2B1EA 1YKEB 4KP3C 5GONE 2E2AA 5DJQC 2C5KT 2HPLA 3AAAB 3RYCE 4YSYA 1WYCA 1D1BA 2BS3A 1VCSA 2BG9C 1MMDA 3PUVF 2LSGA 3I9WA 3RIUA 3OKQA 3RRWA 5AFMA 2V7LA 4JUYA 3AEGA 4P1NA 2L9QA 3LSVA 3AECA 4UM3S 4B3TT 2UU9T 4ISSA 3O4XE 4TV8E 2XSBA 1HNZT 2W67A 2VKDA 3P50A 4GIWA 4AIUA 2KNDA 4LF5T 1VRBA 4BJMA 4TV9E 3AVRA 3CX6B 3P4WA 2BYPA 3LK2B 3PUAA 2DWGA 3O9XA 3K8PC 4DR1T 2BBJA 4JEHB 3MZKB 1US7B 1XDPA 3AE5A 2VVNA 2G0UA 3KBUA 2MAWA 1W0AA 1MMGA 4O2AE 3ZMZB 3EDUA 1AJ3A 3PUXF 5FP3A 1JNRA 3DJBA 4BJNA 2JJ9A 4U72A 4M1PA 1UX5A 3B13A 3MKDA 2BVLA 2V7IA 2J1DG 4L5GA 4LMKA 1QUUA 2NTXA 2VK9A 4PAGA 3AVSA 4P09A 2XAHB 4UF0B 3OPCA 3ZMUB 4ALXA 3ZEFB 2WQYA 3AE2A 2XNUA 4ISTA 2UUCT 2WBLA 3ZPOA 3T1HT 4ZJTA 2WWUA 3CX7B 4DR2T 2D0UA 2JRKA 1YW0A 3HI2A 5ETWA 3PUSA 2LLYA 3RIFA 3GA8A 1IZNB 2WZYA 3Q5EA 4ZHQE 1N32T 3I1AA 5ABFB 2JMHA 2XY8B 5SYOA 4QX7B 4WV9A 3U8NA 2XQ9A 3K1SA 3C64A 2A72A 4U3CA 5CO5A 2Y8DA 4TNWA 1IBKT 3QK6A 3FZFB 3QUJA 1HNWT 3M65A 3T1YT 2XQ5A 5M4YA 2V7MA 2YINA 2XM2A 5LB7B 1N36T 5BMVE 2NWBA 1D0YA 3UUXB 1UK5A 3TLWA 5J2TE 4EOZB 1FJGT 4AFGA 2D0TA 3J9X1 4DV2T 3FXEB 2Y57A 3NZQA 5J5GA 5L3EB 5FYMA 3TLVA 4XHEA 3UU3A 4ZI2D 5AQNB 4DBQA 3U78A 5FY7A 1I6ZA 3KV5A 3SIOA 3GN5B 3AB3B 2IIUA 5C8YE 5HCJA 4ZK4A 1SA0E 5L4HA 5A1LA 5CFBA 3V5UA 2W66A 2X0LB 4IDQA 4YTPA 3WI3A 3VRBA 4PK6A 3NRYA 3U3IA 3UUMA 5AQGB 4X5TA 2WY2A 2WN9A 2X66A 5HCMA 2X9YA 3UFEA 3N9MA 2P9BA 3ZDHA 3E22E 2I0MA 3RPUA 3MK7C 1XZYA 3AEBA 4F8HA 4UELA 5FL1A 3OYXA 4U31A 2DCFA 5FXXA 5HWXA 4OYJA 1UURA 1ZEEA 5KE4A 1YQ3A 5LG4A 5LOVE 4EYUA 4WBOA 3PUZF 3BQKA 4CXWA 4LFBT 1B7TA 1CHUA 2JIWA 4EGWA 4IE0A 3CK6A 2VKOA 4EYYR 2X9XA 2E9XC 1YXRA 3KVAA 2XAQB 3WTOA 1YD8G 4U33A 3SQ9A 5JRCB 3ONJA 3L3PA 2BR7A 3OBVE 3RLFF 1XNRT 4HEAA 4H9SE 3LK3B 4EEDA 4JI6T 3NZPA 4NUUA 4MBQA 2MOZA 4K0KT 4YHJA 4I43B 3A8YC 2M6IA 5LYJE 2NR4A 1UUSA 2HPJA 2FJDA 5LMUT 2J47A 2MYSA 4PJLA 3V5SA 3WTMA 4QH1A 4NXMT 2LOSA 4U2YA 3TLTA 1MNDA 2FUPA 3KV9A 2UXCT 2X0YA 3GN5A 3UUBA 2V6YA 1YQ4A 4ZR6A 2K3WA 5KXJA 4CI1B 3JAFA 1M62A 1VOMA 2E9XA 4CI2B 3C98B 3PUWF 4FJOA 3AEFA 2QGSA 3U8KA 1GQEA 2WSSV 3O1IA 3CQCB 3OYZA 2PBIA 2KSRA 4Z90A 3PJAJ 2BJ0A 4I50E 3LBXA 3RYHE 4C90A 4U7IA 4YTNA 4O8SA 3ZC1A 1IBLT 2AXDS 5LBMA 4IIJE 4DR3T 5AQIB 4TNVA 3SS1A 3A5XA 1KNPA 4YJ3E 2VKJA 3Q5WA 2LEHA 4QX8B 3N9QA 5LMNT 1SHZC 1WR6A 1MMAA 2X9WA 5AFHA 2WCAA 4LF6T 1M7KA 2XQYA 3CQGB 3RF1A 3GMIA 2ACZA 4NUVA 2ZJUA 2IUBA 4XK9A 4HFVA 2ODUA 2XAJB 1QLBA 4U74A 2IMLA 3ZYMA 4H9RC 3RRCA 3ETUA 1WYBA 2IHR1 5AQVB 1W0BA 3UUNA 2KMFA 5C2TA 3FHNA 2BYRA 3NBXX 4HGAA 4YTMA 2SPCA 3P7IA 3SFDA 2VKHA 4O4IE 3RH3A 2C5IT 1IJ6A 4DMVA 2A2FX 3C4ZA 2NW9A 2EHOB 4MFRA 3WTKA 4DV0T 2NP9A 3CVRA 2XM1A 2ZM2A 4DR7T 3LDQB 4QHOA 1HCIA 3GWHA 4JYAT 3I0OA 3C51A 3K3NA 3SOLA 3VU7H 4EZHA 4HFDA 2ZLYA 1KK7A 2W00A 4IDOA 2PFVA 3RYFE 4F6RC 2XYSA 5LJNA 3IA3A 3WIPA 2BBHA 2V5CA 2MPKA 5JVDE 5HXRA 1KNRA 5AQLB 2X00A 2V8SV 3CX8B 5FVKA 4DIDB 3IGQA 3MA9A 4XBFB 1T72A 5FXZA 4JI8T 4ZXLA 1SUMB 2XQ7A 4O2BE 4ASKA 3QB5A 2BKPA 2CMRA 3I0QA 5EK4A 3P4SA 3ONXA 3PU3A 2K24A 3AE6A 4FI5A 4IE7A 5HEGA 2W61A 3U8LA 4HFCA 2BDEA 1J1JA 5LG3A 1NEKA 2KT9A 5E0OA 5J5IA 5F8PA 2LHRA 3X1DA 4LF7T 4QXHB 4AXPA 3H3AA 5ABHA 2BYQA 4ZEYA 2Q9QB 2VASA 3DP7A 3JC6C 4UY2A 4CZZB 3H3MA 3VKGA 4N78D 2YMEA 5AFLA 5JDLA 2VURA 5HXHA 4HWFA 1S35A 2H88A 2BZBA 2XQ3A 3J7Yq 5AQRB 2VVSA 2LJLA 2D5UA 4OYKA 1WR0A 3TKLB 2QRXA 2K9AA 2M6BA 2VL8A 3KV6A 3MACA 3ZJ1A 2JQQA 2I59A 3SH1A 1ZOYA 4B3RT 4AKHA 5FVLA 5BRXA 1UV6A 2E5LT 4AQGA 4G2AA 2E9XD 3ETVA 5HYAA 4B3ST 3EAMA 5FJVA 2DHRA 3FXDB 3NWIA 2WZIA 4PFOA 3RX6A 4LF8T 3KINB 4EEBA 4IDZA 4Z8XA 4DV5T 1Y01A 2UXXB 3MXZA 2HN2A 3SFEA 4JI1T 3JCFA 5AQPB 4ILBA 2W0GA 3EDVA 2XTLA 3VRAA 4ZS2A 4AFHA 2Y48B 3LK42 4G63A 2UZ6A 2JQ9A 2L3LA 4IL9A 3CWZB 2CM0A 3NVOA 5H6QB 5LXTE 2XJ7A 4JBWF 5FKYA 1ZV4X 4IE6A 5AQOB 2YU2A 3AXJB 5AQSB 4Q25A 2Q9QA 4H9NC 2JQHA 4ERRA 2LOPA 3M3ZB 1WLXA 2V7KA 4UXUA 2V1DB 2VB6A 4CXYA 2PTFA 3N9PA 4YXDA 2UXNB 5BP0A 5HAXA 3ONLC 1X9BA 5ADXL 1LVFA 4NXNT 4PJNA 4YT0A 4KBMB 2VQET 2YKSA 2WWVA 2X51A 4O4HE 3U8JA 3N9LA 2XQ6A 2WAUA 2E5VA 1FMWA 5HEUA 1XMQT 1IBMT 3PTRB 2LSJA 4LMLA 3R84B 2LSYA 4PK4A 1S94A 1ZKEA 3NKZA 2QYWA 2CBIA 4EV6A 4YY3T 2KLQA 3Q5DA 1D1AA 4UV9B 2V7JA 4QH5A 1R8IA 4UF0A 2V26A 3AAIA 4NPPA 3WTIA 2WM9A 3L8RA 3ZDGA 4PW8A 4DV6T 1LRZA 1Z8UA 4ZZBA 1NAFA 1N33T 2Y7YA 1OEDB 3UU8A 2RA1A 4YJ2E 2BS4A 5FNVE 3OTOT 2IAKA 2UXBT 4X1KE 2WU2A 5L4EA 3UQ4A 4QXBB 2OA5A 2W4XA 4QACA 2L8KA 2X00D 4AI6A 2LHNA 2W2UA 2CLYB 2XZEA 3ZYLA 3HR0A 4H63H 2IDOB 2PGZA 4X66T 4KHZF 2BR8A 2BKNA 4NZBA 1MNEA 5ABFA 1LVKA 3QOFA 3N5LA 1W09A 2W8FA 4PK5A 2Z6EA 2IC9A 5EZYE 5C3JA 3AXJA 4DVDA 1FEWA 1CUNA 4OHFA 5CB4E 5CA0E 2FJAA 3C50A 5F3JA 4HFHA 2XSAA 2CXDA 3ZJ2A 3P4QA 1XWMA 4DBMA 5HXEA 2XZ6A 3WTLA 5JMEA 1G8XA 4AISA 2N1GA 4KHPT 2WB5A 2PJQA 2BYSA 4DR4T 4QXCB 2WDVA 3UQ7A 4X20E 2NW8A 4AFTA 3G06A 3UFGA 4CN6A 4BFQA 1UX4A 4LMJA 4LFAT 1Z0PA 3LJCA 2ES0A 4TWHA 5J2UE 3AE4A 1SE7A 3KFWX 3HL6A 4YLHA 3UT5E 1MMNA 2FJBA 1N34T 3CIRA 2X0HA 4IT4A 4P0AA 4WZXA 1WRDA 2WP9A 1T8BA 4PJJA 3RIAA 4U2ZA 4H9PC 4B6XA 3C4WA 2VWAA 4YSZA 4ADZA 2IC6A 3EABA 1G73A 3JC6D 3BQIA 2MBGA 3B5MA 4ANJA 2BS2A 3JADA 3PDYA 3TLUA 5HXSA 5AQJB 5JR9B 1I9BA 3W15B 4UVCB 5KDMC 4EIWA 2D9DA 2XAGB 4BQTA 5LCYA 2AE9A 4L0RA 3OVUA 2ZJVA 3AE8A 4TX5A 4WYVA 4AQFC 5TVCA 2WU5A 4ILAA 1Y64B 5IHYA 3ZN0B 3N2KE 1MIYA 3ZT7A 4TZ4C 3LFMA 3ZT6A 5DABA 4CN1A 1LKXA 3B57A 5J5FA 2XYTA 4HE8A 3PUYF 3SRZA 4JI3T 4ILUA 2YMDA 4ZRUA 5IYZE 3F2EA 3ESLA 5JRCA 2N2NA 5LHIB 5AFMB 1OWAA 1D0ZA 3JAEA 5LJMA 2A3DA 3AE7A 3UU5A 5FXVA 4YHHT 2YDQA 3KDSE 4HWHA 2W63A 1MIWA 3EHZA 4ZI7E 3AE9A 4A97A 2XQ4A 2CXFA 3IEEA 3EUHA 5H6RB 2BKOA 3H37A 3RI5A 1E7PA 4EAHA 3T8OA 3RQUA 3UULA 3U8MA 5TAOA 2JMKA 4UVAB 2D2SA 3BQLA 3Q5XA 5HEHA 4JI5T 3AA7B 3RKOA 2Y54A 2Y6XA 4AQFA 5L3FB 4TWFA 4ZK1A 5CA1E 3NRXA 2C5JA 4HWIB 2KZ7B 3ABVA 4UM3A 5JDHA 2UUAT 1KEYA 2CHNA 3AEAA 2LRLA 4ZI3C 4UIGA 4GYRA 4A98A 2CWOA 5JH7E 3VR8A 3PU8A 3BK9A 2BG9B 3RYIE 2V5DA 3C4XA 4DNDA 4DV7T 1OXZA 2WMNA 3K3OA 5AFKA 4HN9A 5FY1A 4QABA 3RQWA 4ILCA 4PJMA 3KVBA 3CKDA 3EVYA 1HX1B 1D1CA 2KXPB 3L39A 4U7YA 3UTKA 4BAYB 5JR9A 1WCRA 2XHEB 3WTHA 4I4TE 2CCQA 1UGOA 2Y56A 3E0ZA 4IREA 2BYNA 4KUMB 3WAJA 3C84A 5HXCA 1HNXT 4DO0A 1U5PA
chains in the Genus database with same CATH topology
4ZRUA 1OEDC 3ZDGA 5HCMA 5KZUA 5AINA 3T4MA 4TNWA 4ZZBA 4ZZCA 3ZDHA 5HEOA 4BFQA 2MAWA 3JAFA 2Y7YA 4ILBA 5AFMB 4TWDA 4LMJA 3JAEA 2WNJA 5IUXA 4F8HA 2Y58A 2YN6A 1OEDB 3EI0A 5BW2A 2PH9A 4TWHA 3U8KA 3UU8A 2BYQA 2XQ5A 3UU5A 2XQAA 4PIRA 4AFHA 3WTKA 5AFNA 5HEJA 4UY2A 1OEDE 4COFA 2YMEA 4EZ1A 3EHZA 3PMZA 5AFLA 5L4EA 2WNLA 2XNTA 2KSRA 4Z90A 3UQ4A 2UZ6A 5KE4A 4A97A 2C9TA 2BJ0A 4IL9A 2XQ4A 4QH4A 4QACA 2XQ3A 2QC1B 3RI5A 5LXBA 2X00D 2VL0A 2XQ8A 3RQUA 4HFBA 1UW6A 3U8MA 4Z91A 3TLWA 2PGZA 2BR8A 5HEHA 4IL4A 4TNVA 3RIAA 2Y54A 4NZBA 4LMKA 4TWFA 4AFGA 4ZK1A 2M6BA 5J0ZA 4HFDA 5AFJA 4D01A 3RHWA 4UM3A 3TLSA 2Y57A 3WTOA 1UX2A 4ALXA 3ZKRA 2W8FA 4QAAA 5J5GA 3SQ9A 4ZJSA 4HFEA 4UXUA 3JADA 3SH1A 2BG9C 2XYSA 3TLVA 5AFHA 3TLUA 4XHEA 3UU3A 2XNUA 5BP0A 4UM3P 4A98A 2BR7A 5AFMA 3WIPA 1I9BA 4HFIA 2W8GA 3UU4A 2LKHA 3LSVA 1OEDA 2BG9B 2X00A 4UM3S 4ZJTA 5J5HA 3WTJA 5BRXA 5AFKA 4BQTA 3IGQA 3WTNA 2YKSA 4QABA 3SIOA 3U8JA 1UV6A 2LKGA 2XZ5A 2M6IA 3RQWA 4ILCA 2BG9E 2ZJUA 4XK9A 2ZJVA 2XQ6A 4HFHA 5HEUA 3SQ6A 5L47A 3EAMA 5FJVA 2LLYA 3P50A 2LM2A 4LMLA 5TVCA 5HCJA 4UM1A 3UU6A 4ZK4A 3WTMA 4DBMA 4QH1A 5L4HA 2XQ7A 3RIFA 4ILAA 5CFBA 2XZ6A 3WTLA 3WTHA 4FRRA 2WZYA 5JMEA 2WNCA 4B5DA 3PEOA 2BG9A 3TLTA 3P4WA 2Y56A 2XNVA 2YOEA 4IREA 4HQPA 2BYNA 2BYPA 5SYOA 5J5FA 2BYSA 3C84A 2XYTA 4WV9A 5HEGA 3U8LA 4HFCA 4QH5A 3UUBA 3GUAA 2BYRA 3U8NA 2XQ9A 5LG3A 3UQ7A 3C79A 5CO5A 4NPPA 4X5TA 3WTIA 2WN9A 4AFTA 2YMDA 4ZR6A 5J5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRU A;  1OED C;  3ZDG A;  5HCM A;  5KZU A;  5AIN A;  3T4M A;  4TNW A;  4ZZB A;  4ZZC A;  3ZDH A;  5HEO A;  4BFQ A;  2MAW A;  3JAF A;  2Y7Y A;  4ILB A;  5AFM B;  4TWD A;  4LMJ A;  3JAE A;  2WNJ A;  5IUX A;  4F8H A;  2Y58 A;  2YN6 A;  1OED B;  3EI0 A;  5BW2 A;  2PH9 A;  4TWH A;  3U8K A;  3UU8 A;  2BYQ A;  2XQ5 A;  3UU5 A;  2XQA A;  4PIR A;  4AFH A;  3WTK A;  5AFN A;  5HEJ A;  4UY2 A;  1OED E;  4COF A;  2YME A;  4EZ1 A;  3EHZ A;  3PMZ A;  5AFL A;  5L4E A;  2WNL A;  2XNT A;  2KSR A;  4Z90 A;  3UQ4 A;  2UZ6 A;  5KE4 A;  4A97 A;  2C9T A;  2BJ0 A;  4IL9 A;  2XQ4 A;  4QH4 A;  4QAC A;  2XQ3 A;  2QC1 B;  3RI5 A;  5LXB A;  2X00 D;  2VL0 A;  2XQ8 A;  3RQU A;  4HFB A;  1UW6 A;  3U8M A;  4Z91 A;  3TLW A;  2PGZ A;  2BR8 A;  5HEH A;  4IL4 A;  4TNV A;  3RIA A;  2Y54 A;  4NZB A;  4LMK A;  4TWF A;  4AFG A;  4ZK1 A;  2M6B A;  5J0Z A;  4HFD A;  5AFJ A;  4D01 A;  3RHW A;  4UM3 A;  3TLS A;  2Y57 A;  3WTO A;  1UX2 A;  4ALX A;  3ZKR A;  2W8F A;  4QAA A;  5J5G A;  3SQ9 A;  4ZJS A;  4HFE A;  4UXU A;  3JAD A;  3SH1 A;  2BG9 C;  2XYS A;  3TLV A;  5AFH A;  3TLU A;  4XHE A;  3UU3 A;  2XNU A;  5BP0 A;  4UM3 P;  4A98 A;  2BR7 A;  5AFM A;  3WIP A;  1I9B A;  4HFI A;  2W8G A;  3UU4 A;  2LKH A;  3LSV A;  1OED A;  2BG9 B;  2X00 A;  4UM3 S;  4ZJT A;  5J5H A;  3WTJ A;  5BRX A;  5AFK A;  4BQT A;  3IGQ A;  3WTN A;  2YKS A;  4QAB A;  3SIO A;  3U8J A;  1UV6 A;  2LKG A;  2XZ5 A;  2M6I A;  3RQW A;  4ILC A;  2BG9 E;  2ZJU A;  4XK9 A;  2ZJV A;  2XQ6 A;  4HFH A;  5HEU A;  3SQ6 A;  5L47 A;  3EAM A;  5FJV A;  2LLY A;  3P50 A;  2LM2 A;  4LML A;  5TVC A;  5HCJ A;  4UM1 A;  3UU6 A;  4ZK4 A;  3WTM A;  4DBM A;  4QH1 A;  5L4H A;  2XQ7 A;  3RIF A;  4ILA A;  5CFB A;  2XZ6 A;  3WTL A;  3WTH A;  4FRR A;  2WZY A;  5JME A;  2WNC A;  4B5D A;  3PEO A;  2BG9 A;  3TLT A;  3P4W A;  2Y56 A;  2XNV A;  2YOE A;  4IRE A;  4HQP A;  2BYN A;  2BYP A;  5SYO A;  5J5F A;  2BYS A;  3C84 A;  2XYT A;  4WV9 A;  5HEG A;  3U8L A;  4HFC A;  4QH5 A;  3UUB A;  3GUA A;  2BYR A;  3U8N A;  2XQ9 A;  5LG3 A;  3UQ7 A;  3C79 A;  5CO5 A;  4NPP A;  4X5T A;  3WTI A;  2WN9 A;  4AFT A;  2YMD A;  4ZR6 A;  5J5I A; 
#chains in the Genus database with same CATH topology
 1BR1 A;  4GK5 E;  5KZU A;  4JI7 T;  2EHO C;  4ZZC A;  5L3B B;  4TWD A;  2JPF A;  3F31 A;  2ZM0 A;  4DV1 T;  2YN6 A;  3N9O A;  5LNK A;  2X67 A;  2BVM A;  1JNZ A;  5CJ5 A;  4YSX A;  2YDS A;  3AE1 A;  4X1Y E;  5HEJ A;  1J5E T;  4EZ1 A;  5LHG B;  3ZMT B;  1VCT A;  2ZMA A;  4WNK A;  2HN1 A;  3AA0 B;  1T98 A;  3FZL B;  3FB2 A;  5J0Z A;  4ZS3 A;  5DQW A;  5F5W A;  2WS3 A;  3CQX C;  1UX2 A;  4KX6 A;  2VQF T;  1W9R A;  2DNX A;  5AQK B;  3PJA A;  1HR0 T;  2K5B B;  2XUE A;  4E7Z A;  4IE4 A;  4BA9 A;  2EHO A;  3A7M A;  3KBT A;  4X62 T;  4UEM A;  2FJE A;  3ZN1 B;  5EK3 A;  2XZ5 A;  1XMO T;  2KWH A;  4WW0 A;  5L47 A;  1KNZ A;  5DQV A;  5KX5 E;  2CE7 A;  1HTJ F;  2J4G A;  4QKN A;  1X79 A;  4B5D A;  2BG9 A;  2UUB T;  4HQP A;  5AQQ B;  2YU1 A;  5J1G A;  3SWH A;  4KI0 F;  2YEV C;  5JTG A;  4HWC A;  5AIN A;  1I94 T;  1XDO A;  2Q9Q C;  5LGN B;  2GK9 A;  3CML A;  2CRB A;  2DWK A;  5ABE A;  3K3Q C;  3FBL A;  5L3G B;  3O1J A;  2WNL A;  1E1H B;  4TN7 B;  4UR9 A;  4EXT A;  3WAK A;  3KV4 A;  5FY0 A;  2VL0 A;  3MJX A;  2XQ8 A;  1U4Q A;  3AAE B;  2CPT A;  4GKK T;  4CQI A;  3IF8 B;  2K48 A;  3PE0 A;  5AFJ A;  5IWA T;  3R6N A;  3RHW A;  4X1I E;  3ZKR A;  4ZJS A;  2HH7 A;  3HKD E;  5EK2 A;  5ABG A;  3ZMV B;  2ZM8 A;  1HS7 A;  4AKR B;  4CN4 A;  2W8G A;  3LG7 A;  3WTJ A;  4OFZ A;  4IDP A;  3WTN A;  4J2C A;  2RP4 A;  4DV4 T;  1E2A A;  2CXL A;  4K0U A;  5FMN A;  3ZC0 A;  4X65 T;  2LM2 A;  3ANW B;  3UU6 A;  4V1A v;  4MHC A;  4B3M T;  4FRR A;  3VR9 A;  2H7V C;  4JI4 T;  3I9Y A;  3AA1 B;  3AE3 A;  1YKH B;  1XNQ T;  3GUA A;  5LA6 E;  3N2G E;  5L3D B;  5AFU L;  1HX8 A;  1HG5 A;  4DUZ T;  3IHR A;  4O4J E;  1BR0 A;  2E8I A;  3QNU A;  3P4P A;  5JDG A;  2QVA A;  4PIR A;  4GK0 E;  4C91 A;  2XAS B;  1OED E;  2LRK A;  4JI2 T;  1HFA A;  2X9H A;  1ZHC A;  3AEE A;  5LXB A;  2HHH T;  4E7S A;  5LGU B;  3PV0 F;  4LF9 T;  4MAL A;  3Q2M A;  2XPK A;  4DUY T;  2IW5 B;  3Q9D A;  5JRE A;  2WDQ A;  3TLS A;  2A9U A;  2V6Y B;  2H3R A;  4HWD A;  4IHJ E;  4LF4 T;  4DR6 T;  2DLR A;  3VHL A;  5FXW A;  2XAF B;  3AED A;  1KF6 A;  2OLT A;  1H7C A;  1IAP A;  1UCU A;  2E9X B;  4UM3 P;  3HKE E;  4PNI A;  3UU4 A;  2LKH A;  3E08 A;  5J5H A;  5LP6 E;  2J62 A;  3ZCJ A;  3RC3 A;  4AKG A;  2WMO A;  3ZT5 A;  3D0T A;  3FZK B;  2ODV A;  3SQ6 A;  3LBX B;  4OX9 T;  4LFC T;  4UM1 A;  2ACX A;  4ZI3 D;  2CEA A;  2RPA A;  3AA6 B;  2UXD T;  5JDM A;  2XNV A;  4P0B A;  4ZOL E;  2CHO A;  4AKI A;  4IGU A;  4H63 V;  2DI4 A;  1O3X A;  2F4V T;  4EB6 E;  3QB5 K;  1NWM X;  2YK0 A;  4KMC A;  1OED C;  3S4U A;  4UVB B;  1ZP0 A;  4HKA A;  3PUG A;  3ANW A;  4WBN E;  2KWI B;  3HKB E;  3EI0 A;  2MTQ A;  5BW2 A;  4UXN B;  4I55 E;  5JQG E;  2CLY C;  4MLK A;  3VKH A;  2C9T A;  2LE8 A;  1MIV A;  4QH4 A;  2ZM6 T;  2QC1 B;  2LSK A;  2WZH A;  2EHO D;  5KMG P;  2JQK A;  5JDN A;  4XZC A;  5HWY A;  3CPZ A;  4IL4 A;  4A56 A;  4D01 A;  2WDR A;  5L2L A;  4OK0 A;  3P4R A;  3RGL A;  4DR5 T;  4JI0 T;  2LT3 A;  1OED A;  2B76 A;  4GKJ T;  3RC8 A;  5LBQ B;  1D0X A;  4PFP A;  2PG8 A;  2FBW A;  1WFD A;  2DL1 A;  1IJ5 A;  2CWY A;  5LGT B;  5JDQ A;  1KFY A;  4IDN A;  3N2O A;  5CGM A;  3DTO A;  5AQH B;  2YOE A;  4AQY T;  4HTE A;  4L9I A;  3C79 A;  3P8C D;  4CI3 B;  3T4M A;  2CBJ A;  5HEO A;  1BR4 A;  3QC9 A;  5IUX A;  3ZCI A;  2Y58 A;  3ZLI A;  3ZSS A;  4YFS A;  4H9O C;  3IBP A;  2I6H A;  5AFN A;  3PMZ A;  2C0S A;  4X64 T;  2M67 A;  4QWN B;  3HA4 A;  4ZI2 C;  2NOX A;  1J5W A;  4HFB A;  3OJA A;  4EZ4 A;  1UW6 A;  4Z91 A;  2Q9Q D;  1FMV A;  4GYS A;  1T7S A;  1EZ3 A;  3N9N A;  4O4L E;  4A5X A;  2N9D A;  2NTY A;  5JR9 C;  4GOU A;  4NIQ A;  4QAA A;  4HFE A;  4JEU B;  2LM9 A;  5BR8 T;  3FBZ A;  4I0U A;  4HFI A;  3FZM B;  4JLE A;  4AKL A;  3PUR A;  2YDR A;  2LKG A;  2H89 A;  5AQM B;  2BG9 E;  3ZYK A;  4UV8 B;  1FIO A;  5AQF B;  1QSD A;  1BR2 A;  2CA5 A;  3ZMS B;  5AQT B;  2LSI A;  1DU2 A;  2WNC A;  4CXX A;  3PEO A;  4H9Q C;  1HG2 A;  4XAX B;  2V6X A;  3L09 A;  3RKG A;  4DV3 T;  1L0V A;  5L3C B;  3RIU C;  5FL0 A;  4TUY E;  3FZH B;  4DMW A;  2QA7 A;  5AQU B;  1NEN A;  1V9D A;  2WNJ A;  3F57 A;  2X68 A;  5LHH B;  5JDF A;  4JV5 T;  2PH9 A;  2R6G F;  2XQA A;  2KIN B;  3O1H A;  4COF A;  4IE5 A;  2NW7 A;  2XNT A;  3HKC E;  2H7O A;  2OV9 A;  4DBR A;  3ZST A;  2W62 A;  3PUQ A;  1HF8 A;  2B1E A;  1YKE B;  4KP3 C;  5GON E;  2E2A A;  5DJQ C;  2C5K T;  2HPL A;  3AAA B;  3RYC E;  4YSY A;  1WYC A;  1D1B A;  2BS3 A;  1VCS A;  2BG9 C;  1MMD A;  3PUV F;  2LSG A;  3I9W A;  3RIU A;  3OKQ A;  3RRW A;  5AFM A;  2V7L A;  4JUY A;  3AEG A;  4P1N A;  2L9Q A;  3LSV A;  3AEC A;  4UM3 S;  4B3T T;  2UU9 T;  4ISS A;  3O4X E;  4TV8 E;  2XSB A;  1HNZ T;  2W67 A;  2VKD A;  3P50 A;  4GIW A;  4AIU A;  2KND A;  4LF5 T;  1VRB A;  4BJM A;  4TV9 E;  3AVR A;  3CX6 B;  3P4W A;  2BYP A;  3LK2 B;  3PUA A;  2DWG A;  3O9X A;  3K8P C;  4DR1 T;  2BBJ A;  4JEH B;  3MZK B;  1US7 B;  1XDP A;  3AE5 A;  2VVN A;  2G0U A;  3KBU A;  2MAW A;  1W0A A;  1MMG A;  4O2A E;  3ZMZ B;  3EDU A;  1AJ3 A;  3PUX F;  5FP3 A;  1JNR A;  3DJB A;  4BJN A;  2JJ9 A;  4U72 A;  4M1P A;  1UX5 A;  3B13 A;  3MKD A;  2BVL A;  2V7I A;  2J1D G;  4L5G A;  4LMK A;  1QUU A;  2NTX A;  2VK9 A;  4PAG A;  3AVS A;  4P09 A;  2XAH B;  4UF0 B;  3OPC A;  3ZMU B;  4ALX A;  3ZEF B;  2WQY A;  3AE2 A;  2XNU A;  4IST A;  2UUC T;  2WBL A;  3ZPO A;  3T1H T;  4ZJT A;  2WWU A;  3CX7 B;  4DR2 T;  2D0U A;  2JRK A;  1YW0 A;  3HI2 A;  5ETW A;  3PUS A;  2LLY A;  3RIF A;  3GA8 A;  1IZN B;  2WZY A;  3Q5E A;  4ZHQ E;  1N32 T;  3I1A A;  5ABF B;  2JMH A;  2XY8 B;  5SYO A;  4QX7 B;  4WV9 A;  3U8N A;  2XQ9 A;  3K1S A;  3C64 A;  2A72 A;  4U3C A;  5CO5 A;  2Y8D A;  4TNW A;  1IBK T;  3QK6 A;  3FZF B;  3QUJ A;  1HNW T;  3M65 A;  3T1Y T;  2XQ5 A;  5M4Y A;  2V7M A;  2YIN A;  2XM2 A;  5LB7 B;  1N36 T;  5BMV E;  2NWB A;  1D0Y A;  3UUX B;  1UK5 A;  3TLW A;  5J2T E;  4EOZ B;  1FJG T;  4AFG A;  2D0T A;  3J9X 1;  4DV2 T;  3FXE B;  2Y57 A;  3NZQ A;  5J5G A;  5L3E B;  5FYM A;  3TLV A;  4XHE A;  3UU3 A;  4ZI2 D;  5AQN B;  4DBQ A;  3U78 A;  5FY7 A;  1I6Z A;  3KV5 A;  3SIO A;  3GN5 B;  3AB3 B;  2IIU A;  5C8Y E;  5HCJ A;  4ZK4 A;  1SA0 E;  5L4H A;  5A1L A;  5CFB A;  3V5U A;  2W66 A;  2X0L B;  4IDQ A;  4YTP A;  3WI3 A;  3VRB A;  4PK6 A;  3NRY A;  3U3I A;  3UUM A;  5AQG B;  4X5T A;  2WY2 A;  2WN9 A;  2X66 A;  5HCM A;  2X9Y A;  3UFE A;  3N9M A;  2P9B A;  3ZDH A;  3E22 E;  2I0M A;  3RPU A;  3MK7 C;  1XZY A;  3AEB A;  4F8H A;  4UEL A;  5FL1 A;  3OYX A;  4U31 A;  2DCF A;  5FXX A;  5HWX A;  4OYJ A;  1UUR A;  1ZEE A;  5KE4 A;  1YQ3 A;  5LG4 A;  5LOV E;  4EYU A;  4WBO A;  3PUZ F;  3BQK A;  4CXW A;  4LFB T;  1B7T A;  1CHU A;  2JIW A;  4EGW A;  4IE0 A;  3CK6 A;  2VKO A;  4EYY R;  2X9X A;  2E9X C;  1YXR A;  3KVA A;  2XAQ B;  3WTO A;  1YD8 G;  4U33 A;  3SQ9 A;  5JRC B;  3ONJ A;  3L3P A;  2BR7 A;  3OBV E;  3RLF F;  1XNR T;  4HEA A;  4H9S E;  3LK3 B;  4EED A;  4JI6 T;  3NZP A;  4NUU A;  4MBQ A;  2MOZ A;  4K0K T;  4YHJ A;  4I43 B;  3A8Y C;  2M6I A;  5LYJ E;  2NR4 A;  1UUS A;  2HPJ A;  2FJD A;  5LMU T;  2J47 A;  2MYS A;  4PJL A;  3V5S A;  3WTM A;  4QH1 A;  4NXM T;  2LOS A;  4U2Y A;  3TLT A;  1MND A;  2FUP A;  3KV9 A;  2UXC T;  2X0Y A;  3GN5 A;  3UUB A;  2V6Y A;  1YQ4 A;  4ZR6 A;  2K3W A;  5KXJ A;  4CI1 B;  3JAF A;  1M62 A;  1VOM A;  2E9X A;  4CI2 B;  3C98 B;  3PUW F;  4FJO A;  3AEF A;  2QGS A;  3U8K A;  1GQE A;  2WSS V;  3O1I A;  3CQC B;  3OYZ A;  2PBI A;  2KSR A;  4Z90 A;  3PJA J;  2BJ0 A;  4I50 E;  3LBX A;  3RYH E;  4C90 A;  4U7I A;  4YTN A;  4O8S A;  3ZC1 A;  1IBL T;  2AXD S;  5LBM A;  4IIJ E;  4DR3 T;  5AQI B;  4TNV A;  3SS1 A;  3A5X A;  1KNP A;  4YJ3 E;  2VKJ A;  3Q5W A;  2LEH A;  4QX8 B;  3N9Q A;  5LMN T;  1SHZ C;  1WR6 A;  1MMA A;  2X9W A;  5AFH A;  2WCA A;  4LF6 T;  1M7K A;  2XQY A;  3CQG B;  3RF1 A;  3GMI A;  2ACZ A;  4NUV A;  2ZJU A;  2IUB A;  4XK9 A;  4HFV A;  2ODU A;  2XAJ B;  1QLB A;  4U74 A;  2IML A;  3ZYM A;  4H9R C;  3RRC A;  3ETU A;  1WYB A;  2IHR 1;  5AQV B;  1W0B A;  3UUN A;  2KMF A;  5C2T A;  3FHN A;  2BYR A;  3NBX X;  4HGA A;  4YTM A;  2SPC A;  3P7I A;  3SFD A;  2VKH A;  4O4I E;  3RH3 A;  2C5I T;  1IJ6 A;  4DMV A;  2A2F X;  3C4Z A;  2NW9 A;  2EHO B;  4MFR A;  3WTK A;  4DV0 T;  2NP9 A;  3CVR A;  2XM1 A;  2ZM2 A;  4DR7 T;  3LDQ B;  4QHO A;  1HCI A;  3GWH A;  4JYA T;  3I0O A;  3C51 A;  3K3N A;  3SOL A;  3VU7 H;  4EZH A;  4HFD A;  2ZLY A;  1KK7 A;  2W00 A;  4IDO A;  2PFV A;  3RYF E;  4F6R C;  2XYS A;  5LJN A;  3IA3 A;  3WIP A;  2BBH A;  2V5C A;  2MPK A;  5JVD E;  5HXR A;  1KNR A;  5AQL B;  2X00 A;  2V8S V;  3CX8 B;  5FVK A;  4DID B;  3IGQ A;  3MA9 A;  4XBF B;  1T72 A;  5FXZ A;  4JI8 T;  4ZXL A;  1SUM B;  2XQ7 A;  4O2B E;  4ASK A;  3QB5 A;  2BKP A;  2CMR A;  3I0Q A;  5EK4 A;  3P4S A;  3ONX A;  3PU3 A;  2K24 A;  3AE6 A;  4FI5 A;  4IE7 A;  5HEG A;  2W61 A;  3U8L A;  4HFC A;  2BDE A;  1J1J A;  5LG3 A;  1NEK A;  2KT9 A;  5E0O A;  5J5I A;  5F8P A;  2LHR A;  3X1D A;  4LF7 T;  4QXH B;  4AXP A;  3H3A A;  5ABH A;  2BYQ A;  4ZEY A;  2Q9Q B;  2VAS A;  3DP7 A;  3JC6 C;  4UY2 A;  4CZZ B;  3H3M A;  3VKG A;  4N78 D;  2YME A;  5AFL A;  5JDL A;  2VUR A;  5HXH A;  4HWF A;  1S35 A;  2H88 A;  2BZB A;  2XQ3 A;  3J7Y q;  5AQR B;  2VVS A;  2LJL A;  2D5U A;  4OYK A;  1WR0 A;  3TKL B;  2QRX A;  2K9A A;  2M6B A;  2VL8 A;  3KV6 A;  3MAC A;  3ZJ1 A;  2JQQ A;  2I59 A;  3SH1 A;  1ZOY A;  4B3R T;  4AKH A;  5FVL A;  5BRX A;  1UV6 A;  2E5L T;  4AQG A;  4G2A A;  2E9X D;  3ETV A;  5HYA A;  4B3S T;  3EAM A;  5FJV A;  2DHR A;  3FXD B;  3NWI A;  2WZI A;  4PFO A;  3RX6 A;  4LF8 T;  3KIN B;  4EEB A;  4IDZ A;  4Z8X A;  4DV5 T;  1Y01 A;  2UXX B;  3MXZ A;  2HN2 A;  3SFE A;  4JI1 T;  3JCF A;  5AQP B;  4ILB A;  2W0G A;  3EDV A;  2XTL A;  3VRA A;  4ZS2 A;  4AFH A;  2Y48 B;  3LK4 2;  4G63 A;  2UZ6 A;  2JQ9 A;  2L3L A;  4IL9 A;  3CWZ B;  2CM0 A;  3NVO A;  5H6Q B;  5LXT E;  2XJ7 A;  4JBW F;  5FKY A;  1ZV4 X;  4IE6 A;  5AQO B;  2YU2 A;  3AXJ B;  5AQS B;  4Q25 A;  2Q9Q A;  4H9N C;  2JQH A;  4ERR A;  2LOP A;  3M3Z B;  1WLX A;  2V7K A;  4UXU A;  2V1D B;  2VB6 A;  4CXY A;  2PTF A;  3N9P A;  4YXD A;  2UXN B;  5BP0 A;  5HAX A;  3ONL C;  1X9B A;  5ADX L;  1LVF A;  4NXN T;  4PJN A;  4YT0 A;  4KBM B;  2VQE T;  2YKS A;  2WWV A;  2X51 A;  4O4H E;  3U8J A;  3N9L A;  2XQ6 A;  2WAU A;  2E5V A;  1FMW A;  5HEU A;  1XMQ T;  1IBM T;  3PTR B;  2LSJ A;  4LML A;  3R84 B;  2LSY A;  4PK4 A;  1S94 A;  1ZKE A;  3NKZ A;  2QYW A;  2CBI A;  4EV6 A;  4YY3 T;  2KLQ A;  3Q5D A;  1D1A A;  4UV9 B;  2V7J A;  4QH5 A;  1R8I A;  4UF0 A;  2V26 A;  3AAI A;  4NPP A;  3WTI A;  2WM9 A;  3L8R A;  3ZDG A;  4PW8 A;  4DV6 T;  1LRZ A;  1Z8U A;  4ZZB A;  1NAF A;  1N33 T;  2Y7Y A;  1OED B;  3UU8 A;  2RA1 A;  4YJ2 E;  2BS4 A;  5FNV E;  3OTO T;  2IAK A;  2UXB T;  4X1K E;  2WU2 A;  5L4E A;  3UQ4 A;  4QXB B;  2OA5 A;  2W4X A;  4QAC A;  2L8K A;  2X00 D;  4AI6 A;  2LHN A;  2W2U A;  2CLY B;  2XZE A;  3ZYL A;  3HR0 A;  4H63 H;  2IDO B;  2PGZ A;  4X66 T;  4KHZ F;  2BR8 A;  2BKN A;  4NZB A;  1MNE A;  5ABF A;  1LVK A;  3QOF A;  3N5L A;  1W09 A;  2W8F A;  4PK5 A;  2Z6E A;  2IC9 A;  5EZY E;  5C3J A;  3AXJ A;  4DVD A;  1FEW A;  1CUN A;  4OHF A;  5CB4 E;  5CA0 E;  2FJA A;  3C50 A;  5F3J A;  4HFH A;  2XSA A;  2CXD A;  3ZJ2 A;  3P4Q A;  1XWM A;  4DBM A;  5HXE A;  2XZ6 A;  3WTL A;  5JME A;  1G8X A;  4AIS A;  2N1G A;  4KHP T;  2WB5 A;  2PJQ A;  2BYS A;  4DR4 T;  4QXC B;  2WDV A;  3UQ7 A;  4X20 E;  2NW8 A;  4AFT A;  3G06 A;  3UFG A;  4CN6 A;  4BFQ A;  1UX4 A;  4LMJ A;  4LFA T;  1Z0P A;  3LJC A;  2ES0 A;  4TWH A;  5J2U E;  3AE4 A;  1SE7 A;  3KFW X;  3HL6 A;  4YLH A;  3UT5 E;  1MMN A;  2FJB A;  1N34 T;  3CIR A;  2X0H A;  4IT4 A;  4P0A A;  4WZX A;  1WRD A;  2WP9 A;  1T8B A;  4PJJ A;  3RIA A;  4U2Z A;  4H9P C;  4B6X A;  3C4W A;  2VWA A;  4YSZ A;  4ADZ A;  2IC6 A;  3EAB A;  1G73 A;  3JC6 D;  3BQI A;  2MBG A;  3B5M A;  4ANJ A;  2BS2 A;  3JAD A;  3PDY A;  3TLU A;  5HXS A;  5AQJ B;  5JR9 B;  1I9B A;  3W15 B;  4UVC B;  5KDM C;  4EIW A;  2D9D A;  2XAG B;  4BQT A;  5LCY A;  2AE9 A;  4L0R A;  3OVU A;  2ZJV A;  3AE8 A;  4TX5 A;  4WYV A;  4AQF C;  5TVC A;  2WU5 A;  4ILA A;  1Y64 B;  5IHY A;  3ZN0 B;  3N2K E;  1MIY A;  3ZT7 A;  4TZ4 C;  3LFM A;  3ZT6 A;  5DAB A;  4CN1 A;  1LKX A;  3B57 A;  5J5F A;  2XYT A;  4HE8 A;  3PUY F;  3SRZ A;  4JI3 T;  4ILU A;  2YMD A;  4ZRU A;  5IYZ E;  3F2E A;  3ESL A;  5JRC A;  2N2N A;  5LHI B;  5AFM B;  1OWA A;  1D0Z A;  3JAE A;  5LJM A;  2A3D A;  3AE7 A;  3UU5 A;  5FXV A;  4YHH T;  2YDQ A;  3KDS E;  4HWH A;  2W63 A;  1MIW A;  3EHZ A;  4ZI7 E;  3AE9 A;  4A97 A;  2XQ4 A;  2CXF A;  3IEE A;  3EUH A;  5H6R B;  2BKO A;  3H37 A;  3RI5 A;  1E7P A;  4EAH A;  3T8O A;  3RQU A;  3UUL A;  3U8M A;  5TAO A;  2JMK A;  4UVA B;  2D2S A;  3BQL A;  3Q5X A;  5HEH A;  4JI5 T;  3AA7 B;  3RKO A;  2Y54 A;  2Y6X A;  4AQF A;  5L3F B;  4TWF A;  4ZK1 A;  5CA1 E;  3NRX A;  2C5J A;  4HWI B;  2KZ7 B;  3ABV A;  4UM3 A;  5JDH A;  2UUA T;  1KEY A;  2CHN A;  3AEA A;  2LRL A;  4ZI3 C;  4UIG A;  4GYR A;  4A98 A;  2CWO A;  5JH7 E;  3VR8 A;  3PU8 A;  3BK9 A;  2BG9 B;  3RYI E;  2V5D A;  3C4X A;  4DND A;  4DV7 T;  1OXZ A;  2WMN A;  3K3O A;  5AFK A;  4HN9 A;  5FY1 A;  4QAB A;  3RQW A;  4ILC A;  4PJM A;  3KVB A;  3CKD A;  3EVY A;  1HX1 B;  1D1C A;  2KXP B;  3L39 A;  4U7Y A;  3UTK A;  4BAY B;  5JR9 A;  1WCR A;  2XHE B;  3WTH A;  4I4T E;  2CCQ A;  1UGO A;  2Y56 A;  3E0Z A;  4IRE A;  2BYN A;  4KUM B;  3WAJ A;  3C84 A;  5HXC A;  1HNX T;  4DO0 A;  1U5P A; 
#chains in the Genus database with same CATH homology
 4ZRU A;  1OED C;  3ZDG A;  5HCM A;  5KZU A;  5AIN A;  3T4M A;  4TNW A;  4ZZB A;  4ZZC A;  3ZDH A;  5HEO A;  4BFQ A;  2MAW A;  3JAF A;  2Y7Y A;  4ILB A;  5AFM B;  4TWD A;  4LMJ A;  3JAE A;  2WNJ A;  5IUX A;  4F8H A;  2Y58 A;  2YN6 A;  1OED B;  3EI0 A;  5BW2 A;  2PH9 A;  4TWH A;  3U8K A;  3UU8 A;  2BYQ A;  2XQ5 A;  3UU5 A;  2XQA A;  4PIR A;  4AFH A;  3WTK A;  5AFN A;  5HEJ A;  4UY2 A;  1OED E;  4COF A;  2YME A;  4EZ1 A;  3EHZ A;  3PMZ A;  5AFL A;  5L4E A;  2WNL A;  2XNT A;  2KSR A;  4Z90 A;  3UQ4 A;  2UZ6 A;  5KE4 A;  4A97 A;  2C9T A;  2BJ0 A;  4IL9 A;  2XQ4 A;  4QH4 A;  4QAC A;  2XQ3 A;  2QC1 B;  3RI5 A;  5LXB A;  2X00 D;  2VL0 A;  2XQ8 A;  3RQU A;  4HFB A;  1UW6 A;  3U8M A;  4Z91 A;  3TLW A;  2PGZ A;  2BR8 A;  5HEH A;  4IL4 A;  4TNV A;  3RIA A;  2Y54 A;  4NZB A;  4LMK A;  4TWF A;  4AFG A;  4ZK1 A;  2M6B A;  5J0Z A;  4HFD A;  5AFJ A;  4D01 A;  3RHW A;  4UM3 A;  3TLS A;  2Y57 A;  3WTO A;  1UX2 A;  4ALX A;  3ZKR A;  2W8F A;  4QAA A;  5J5G A;  3SQ9 A;  4ZJS A;  4HFE A;  4UXU A;  3JAD A;  3SH1 A;  2BG9 C;  2XYS A;  3TLV A;  5AFH A;  3TLU A;  4XHE A;  3UU3 A;  2XNU A;  5BP0 A;  4UM3 P;  4A98 A;  2BR7 A;  5AFM A;  3WIP A;  1I9B A;  4HFI A;  2W8G A;  3UU4 A;  2LKH A;  3LSV A;  1OED A;  2BG9 B;  2X00 A;  4UM3 S;  4ZJT A;  5J5H A;  3WTJ A;  5BRX A;  5AFK A;  4BQT A;  3IGQ A;  3WTN A;  2YKS A;  4QAB A;  3SIO A;  3U8J A;  1UV6 A;  2LKG A;  2XZ5 A;  2M6I A;  3RQW A;  4ILC A;  2BG9 E;  2ZJU A;  4XK9 A;  2ZJV A;  2XQ6 A;  4HFH A;  5HEU A;  3SQ6 A;  5L47 A;  3EAM A;  5FJV A;  2LLY A;  3P50 A;  2LM2 A;  4LML A;  5TVC A;  5HCJ A;  4UM1 A;  3UU6 A;  4ZK4 A;  3WTM A;  4DBM A;  4QH1 A;  5L4H A;  2XQ7 A;  3RIF A;  4ILA A;  5CFB A;  2XZ6 A;  3WTL A;  3WTH A;  4FRR A;  2WZY A;  5JME A;  2WNC A;  4B5D A;  3PEO A;  2BG9 A;  3TLT A;  3P4W A;  2Y56 A;  2XNV A;  2YOE A;  4IRE A;  4HQP A;  2BYN A;  2BYP A;  5SYO A;  5J5F A;  2BYS A;  3C84 A;  2XYT A;  4WV9 A;  5HEG A;  3U8L A;  4HFC A;  4QH5 A;  3UUB A;  3GUA A;  2BYR A;  3U8N A;  2XQ9 A;  5LG3 A;  3UQ7 A;  3C79 A;  5CO5 A;  4NPP A;  4X5T A;  3WTI A;  2WN9 A;  4AFT A;  2YMD A;  4ZR6 A;  5J5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...