4HFHA

The glic pentameric ligand-gated ion channel (wild-type) complexed to bromoform
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfhA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfhA01
5AFMA 5KE4A 5L4EA 2BYQA 5AFMB 3U8KA 3UQ4A 4FRRA 4QAAA 3WTLA 5CO5A 3SH1A 3PEOA 4AFGA 5FJVA 4ILCA 2C9TA 3C84A 4BFQA 4UM3S 2BYSA 2W8FA 3PMZA 3U8NA 4HFBA 4HFHA 4ZRUA 2XYTA 4QH5A 3RI5A 2WZYA 2XQ7A 2M6BA 2QC1B 2BR7A 5HCJA 3EI0A 2XQ5A 3U8LA 5LG3A 4LMKA 5HEHA 3ZDHA 1UX2A 3EHZA 2XNUA 5BW2A 4QH4A 5J0ZA 4NPPA 4BQTA 4B5DA 4UXUA 3WTKA 4QACA 2YOEA 2YN6A 3U8MA 2W8GA 4XK9A 2YMDA 3WTJA 5BRXA 2BG9C 4XHEA 4Z91A 4A97A 3UQ7A 2BG9A 2LLYA 2UZ6A 2BG9B 5BP0A 3JAEA 4AFTA 3UUBA 2LKHA 3JADA 2X00A 3RIAA 3UU6A 2BYNA 4AFHA 2KSRA 2Y7YA 4Z90A 2XNTA 5L4HA 3C79A 2PGZA 3UU4A 2VL0A 4UM3P 3WTIA 3SQ9A 4UY2A 3RQWA 2ZJUA 2XQ6A 4ZR6A 3U8JA 5HEOA 2Y54A 4ZK1A 4UM3A 3WTHA 2PH9A 4ZJSA 3RQUA 4TWHA 3RHWA 2XNVA 1OEDE 3LSVA 4IL9A 2XYSA 3UU8A 2YMEA 5AINA 5AFKA 4ILAA 2ZJVA 3GUAA 3JAFA 5J5FA 3TLVA 4IL4A 2LKGA 4QABA 3RIFA 3T4MA 2XQ4A 3TLSA 4TWFA 3WTOA 5SYOA 2BYPA 4TNVA 1OEDC 5J5IA 5JMEA 4ZK4A 3TLUA 5J5HA 1OEDA 2BYRA 1I9BA 4F8HA 4A98A 4TNWA 3SIOA 3ZDGA 3WTMA 4LMJA 2XQ8A 4HFEA 4ZJTA 4PIRA 5AFHA 3UU3A 2BR8A 5AFJA 3EAMA 3P4WA 3WIPA 3UU5A 4ZZBA 2Y57A 2LM2A 4D01A 3WTNA 5CFBA 2Y58A 5L47A 2WNJA 4HFDA 2X00D 2WN9A 4EZ1A 2MAWA 5IUXA 4ILBA 1UV6A 1UW6A 4HFIA 3P50A 2XQ9A 3TLTA 4HFCA 4COFA 3TLWA 4ALXA 4WV9A 5TVCA 3ZKRA 2BG9E 5HEGA 5HCMA 5HEJA 2YKSA 2Y56A 3SQ6A 5AFLA 4TWDA 5AFNA 2XQAA 5LXBA 2XQ3A 4LMLA 2WNLA 4IREA 4HQPA 1OEDB 5HEUA 4QH1A 4UM1A 4X5TA 2BJ0A 5KZUA 2WNCA 4NZBA 2XZ6A 5J5GA 2XZ5A 4ZZCA 2M6IA 4DBMA 3IGQA
chains in the Genus database with same CATH superfamily
4JI7T 5KE4A 5L4EA 2CHNA 5CO5A 4LF7T 2FJEA 3OJAA 3N9PA 3UUXB 5CJ5A 2LSKA 2VQET 2GK9A 2VVSA 4CXXA 2BS3A 2XZEA 3E08A 2BVLA 1CUNA 2YDRA 4XHEA 4I55E 2WM9A 3K3NA 4AKRB 5ADXL 3RIAA 1M62A 4PW8A 2C5JA 1LVFA 2VL8A 2LOPA 1E1HB 3RRCA 2D5UA 3C51A 3E22E 5FY7A 2UXCT 2VK9A 3ZT7A 4CI1B 2VASA 1OEDE 3LFMA 4XAXB 2OV9A 5J2TE 3LK42 5A1LA 5LOVE 3T4MA 3RRWA 4UV8B 5BR8T 2N2NA 2V6XA 4WW0A 5LMNT 4ZXLA 2JQHA 4DV0T 2SPCA 2EHOA 4NUVA 3AEDA 4EZ1A 2CA5A 2BZBA 4H63V 2WQYA 3ZC1A 2MTQA 1CHUA 3EUHA 1E2AA 3CX6B 2XZ6A 5AQGB 2W61A 2ZM6T 3WTLA 1D0YA 2RA1A 3SH1A 2V7MA 3C98B 3AECA 4UM3S 2W8FA 4HFHA 5LHHB 1XNRT 3QNUA 3FBLA 5FVLA 3R6NA 1KNPA 1QUUA 2QA7A 5KXJA 2H7OA 1W0BA 4IE0A 4M1PA 1WCRA 2ACZA 4CXWA 3M3ZB 4YTPA 2X00A 4U2YA 1SA0E 2LSGA 5E0OA 4AFHA 5DJQC 4X1YE 2IC9A 2BDEA 3RGLA 3T1YT 4NXMT 2PGZA 3I9WA 2LSIA 2Q9QA 3AVSA 5AQJB 2BKPA 4TN7B 5LJMA 4QX7B 2LHNA 1N33T 3AE9A 4HE8A 3ETUA 4EYYR 3ZMUB 1XDPA 1YQ4A 3WI3A 2IUBA 5AQFB 3LBXA 1FMWA 2NW8A 3TLUA 3D0TA 3DTOA 2BYRA 2A9UA 2MBGA 5EK2A 3H3AA 4LMJA 3PTRB 2CXLA 5AQRB 2D0TA 4L9IA 5L3GB 2XQ9A 2PG8A 3A8YC 4U74A 4BJNA 2J4GA 3MKDA 4EYUA 2PTFA 4X1KE 1HG2A 3CX8B 4DNDA 4QAAA 3C84A 3OYXA 4HFBA 3ESLA 1XNQT 4BAYB 2XYTA 1UURA 1W0AA 2WZYA 2J47A 3FBZA 3N9LA 5BW2A 5J0ZA 2YOEA 1KF6A 4DV3T 1AJ3A 1HNWT 5JDGA 1ZV4X 2LT3A 2CCQA 2XNTA 3V5SA 4LFAT 1MMDA 4UEMA 3MXZA 4EXTA 4UM3P 2Q9QC 3P8CD 2E9XA 2X0HA 4YHHT 2XAJB 4UM3A 2KZ7B 1IJ6A 3AB3B 2ACXA 4YSXA 3BQLA 3UUMA 4ISSA 1SE7A 5C3JA 3MZKB 3X1DA 4IDZA 4I4TE 4AKIA 3E0ZA 3VKHA 4DR1T 4F6RC 3HR0A 4HWHA 2XQYA 4OYKA 2EHOB 3BQIA 2WNJA 3RYCE 2UUCT 3Q5EA 4AXPA 2ES0A 1UW6A 2FJAA 2MPKA 4DVDA 1UCUA 2Y48B 2WNLA 2V1DB 4PFOA 4UM1A 2BJ0A 5EK4A 3FZLB 4L5GA 5ABGA 4X64T 3SWHA 3AE2A 3LK2B 4ZS2A 4AFGA 4OYJA 3KINB 3N9OA 4MBQA 2QC1B 1HCIA 4YJ3E 4KMCA 3UUNA 4GK5E 3ZMSB 3RKOA 3U8MA 4HGAA 2LRLA 2WWUA 3FB2A 4LF4T 3OYZA 2LE8A 2BYNA 2BS2A 3PUXF 4Q25A 4EEBA 1J5WA 3RX6A 3QK6A 5LHGB 4Z8XA 2Q9QB 5BMVE 2K24A 4KI0F 5ETWA 2XSBA 3AEBA 3CPZA 1VOMA 2FJBA 5JR9A 1U4QA 3RYFE 4IDOA 2YU2A 4EV6A 1NWMX 4IHJE 4AKGA 3LBXB 4XBFB 1T98A 4TWFA 1G73A 2X9YA 1VCSA 5JDMA 2XSAA 3RKGA 2FBWA 3AE1A 3GMIA 4IE7A 4KUMB 2X00D 2X9XA 2D0UA 4CI3B 4O4HE 3ZJ1A 4O4JE 1XZYA 2KINB 3K1SA 4DR2T 2X66A 4G2AA 5FXXA 2Q9QD 3KDSE 2XUEA 3RYHE 4BA9A 2IW5B 1W9RA 2E2AA 3RPUA 4IDQA 2B76A 2CXFA 4G63A 3B57A 2IC6A 3ZYMA 5L3FB 4HWFA 1FJGT 4IE6A 3PMZA 2WMOA 3P4RA 3HKCE 3OBVE 4JEHB 3AAIA 3KBTA 3LJCA 2CLYB 2E5VA 5TAOA 5EK3A 1W09A 4QXCB 5JDQA 4QH4A 3QOFA 3ZPOA 2X9HA 2CMRA 2H88A 2W8GA 2YU1A 2UUAT 4XK9A 2NW7A 2DL1A 1OWAA 1S35A 4J2CA 5IHYA 2WAUA 4O4IE 4JYAT 3PU3A 4QX8B 1X79A 2ZJUA 3NZQA 3L39A 2CRBA 3OTOT 4B6XA 2V5DA 4H9PC 4OFZA 2E9XB 2X0LB 2XNVA 5JR9C 1MIWA 5AQQB 2XAFB 4TV9E 4IL4A 5ABFA 3RIFA 2H89A 2LJLA 4ANJA 2BS4A 4ZS3A 4ASKA 5LGUB 3ZSSA 4GIWA 3KBUA 2X68A 4HFEA 2I0MA 3EAMA 2UXXB 2XPKA 4PK5A 3PE0A 4HFDA 3GA8A 4HEAA 1KFYA 2V6YA 3PUAA 4LF6T 4HFCA 2NOXA 3LDQB 4P1NA 5HEGA 2E9XD 3AEFA 2C5IT 3VR9A 4MHCA 3IGQA 4CN4A 1O3XA 3ONJA 3O1JA 3ZYLA 2WBLA 1X9BA 4LFCT 5DQVA 3CKDA 2XNUA 3AEAA 4YLHA 2ZM8A 4JI0T 4JI3T 4JI2T 4AQFC 4AKLA 1FEWA 3CX7B 2LLYA 4IDNA 4TV8E 2K9AA 3PU8A 4WZXA 4U72A 4X62T 1MMGA 5HWXA 3AEGA 3C4WA 4K0UA 3IHRA 4NUUA 4IE5A 2DLRA 3ANWA 3RQUA 4UVCB 2CBJA 2B1EA 1M7KA 2Y8DA 3V5UA 3AXJA 4CQIA 4HKAA 2ZM0A 3ZJ2A 3RIUA 4PNIA 5L3DB 1I9BA 3N9NA 3PUGA 4DV2T 3ZDGA 3EABA 4PIRA 4X20E 4ZZBA 5JDNA 4D01A 3N9QA 4X66T 2PFVA 4HWIB 2AXDS 4U33A 1JNZA 4NIQA 4P09A 3WAKA 1OEDB 4A5XA 5LB7B 4P0BA 2W4XA 3PUYF 3ZN0B 4WYVA 2M6IA 2UXBT 4PFPA 2WS3A 5LHIB 5KMGP 1KEYA 3C50A 2CBIA 2CWOA 2C9TA 1WR6A 3RYIE 5AQSB 2AE9A 1YD8G 1I94T 3U8LA 5FVKA 2CWYA 3C4ZA 3S4UA 4UXUA 1MNEA 2IAKA 1UX5A 3UQ7A 5HAXA 4GKKT 3JAEA 3I9YA 2LKHA 3P4QA 1N34T 4JLEA 3Q2MA 3OVUA 3KV9A 2VL0A 4JV5T 3IA3A 2W2UA 1UK5A 3BK9A 2V7IA 3F2EA 5AFKA 2A3DA 1MMNA 5HXCA 3RIUC 2H7VC 5J5HA 4ISTA 3NRXA 5JDHA 3KVBA 5CB4E 5FXWA 5DABA 3ETVA 3PJAJ 3RF1A 1N32T 2JJ9A 4O2AE 3TKLB 3UU3A 3PUVF 3WTNA 5L47A 2WN9A 3PJAA 5LJNA 2V6YB 1QSDA 4UVAB 3ZKRA 2BG9E 5HCMA 4O4LE 4KHZF 2LEHA 4JI4T 5LXBA 2PJQA 3Q5WA 2J1DG 2D2SA 2JQQA 5LCYA 4BJMA 4YJ2E 4DR5T 5H6QB 1HNZT 1IZNB 3NWIA 4CI2B 2BYSA 1ZEEA 2KWIB 1XDOA 2UU9T 5LG4A 5DQWA 2YEVC 4B5DA 4BQTA 4JI5T 3VU7H 2W67A 5BRXA 1XMQT 1WR0A 2UZ6A 1WRDA 3ONXA 2LOSA 4YY3T 3P4PA 3UU6A 3VRBA 3B5MA 5C2TA 3MA9A 3WTIA 5FP3A 3UT5E 4ZOLE 1HX1B 3RC3A 5LA6E 3ANWB 3NVOA 1H7CA 2HPJA 2UUBT 2J62A 3K3QC 3KVAA 2RP4A 3AXJB 3HKEE 4PK6A 2DCFA 3U78A 4IGUA 1WLXA 5FNVE 4YTNA 4YSZA 4GOUA 2YINA 4DR7T 5FXZA 1HR0T 4C91A 5AFJA 4JBWF 3UU5A 2V7KA 3NZPA 3H3MA 4DBQA 5IWAT 2BBHA 2N9DA 2E8IA 4IIJE 3QUJA 4TZ4C 3TLTA 3KV6A 4XZCA 2XQ3A 1IAPA 4QH1A 4X5TA 2MOZA 2ODVA 5AQVB 2WU5A 1HX8A 3AAEB 5AFMA 1S94A 5L3EB 4U3CA 1EZ3A 3N2OA 5FJVA 3U8NA 2V5CA 3RI5A 2BR7A 3J7Yq 4H9QC 1J5ET 3FXDB 1UX4A 2RPAA 4JI1T 3SS1A 5LYJE 2YMDA 5CGMA 3WTJA 4TUYE 5JTGA 1HS7A 2V7LA 4ILUA 2NWBA 2W66A 2BKOA 3PUSA 5CA0E 2K3WA 3QB5K 2Y7YA 3VR8A 1ZHCA 5FL0A 2DNXA 2JPFA 3LK3B 2XM1A 3KV5A 2IDOB 4ZR6A 5IYZE 3CQCB 3U8JA 4ZK1A 4UIGA 3UULA 3I1AA 5ABEA 4DO0A 4DV1T 2XHEB 2NR4A 3NKZA 1HG5A 4X65T 5J5FA 2X0YA 1VRBA 2K5BB 5EZYE 3ZLIA 5JMEA 2LHRA 1R8IA 4WBOA 2Y57A 2KWHA 2MAWA 5IUXA 5CA1E 1IBKT 1V9DA 4GYSA 2L8KA 3HA4A 2WNCA 4NZBA 4B3ST 4ZI3C 3PEOA 3PUZF 2XAQB 2ODUA 3AE8A 1G8XA 4B3MT 3EI0A 3L3PA 2VURA 2OLTA 5JREA 1UX2A 2W0GA 3PV0F 3HKBE 3DJBA 1XMOT 2NTXA 4A97A 4U31A 3NBXX 4AKHA 4AQGA 3AE4A 4ZEYA 3JADA 1FMVA 5AQHB 2F4VT 3C79A 2UXNB 3VRAA 5JRCA 5JVDE 5FYMA 4KX6A 2VQFT 5C8YE 1D0ZA 4GKJT 1MIVA 4AQFA 1L0VA 4IL9A 5FY0A 1IJ5A 3EDUA 4HFVA 2WDRA 4FI5A 1IBMT 2BBJA 4JI6T 4DV4T 3Q5DA 1KK7A 3O9XA 2VKDA 3G06A 2VKHA 4DV7T 2L9QA 4IT4A 2XM2A 1MNDA 5AQKB 1WFDA 3H37A 3P50A 4HFIA 3WAJA 5GONE 4DBRA 4DMVA 1GQEA 4UXNB 2WP9A 3UFGA 4HQPA 2BKNA 3C4XA 4OHFA 3FZFB 1YKEB 5J5GA 3O4XE 4DR4T 1T72A 5AFMB 3U8KA 2DI4A 5HYAA 4EOZB 3Q5XA 4ZRUA 2JMHA 3JCFA 4ERRA 4HTEA 4L0RA 4LMKA 2OA5A 3FXEB 3ZSTA 2FJDA 1SHZC 3WTKA 2A72A 2BG9A 4DUZT 4P0AA 2YDQA 3FZMB 3B13A 4KBMB 4OX9T 2V7JA 5HXRA 3AE5A 2CE7A 1N36T 4WNKA 5AQUB 4FJOA 3WTHA 4ZJSA 2DWGA 1MIYA 2QYWA 3LSVA 4ZI3D 3UTKA 3ZCJA 3GUAA 2H3RA 4PAGA 1YW0A 2W63A 3LG7A 2R6GF 4EAHA 4DUYT 3TLSA 1QLBA 3A5XA 3CK6A 3ZMTB 2JQKA 3SIOA 2XAHB 3WTMA 3ONLC 1ZP0A 2BR8A 4YHJA 1HNXT 3WIPA 1U5PA 2L3LA 4EZ4A 2Y58A 4U7YA 5JR9B 2CPTA 5LGNB 4ALXA 4COFA 2I59A 3KFWX 4O2BE 3AE6A 1WYBA 3K8PC 4DV6T 4IREA 2WB5A 3RLFF 5HEUA 3AVRA 3FZHB 2UXDT 4ZZCA 1VCTA 3K3OA 2MYSA 3UQ4A 4FRRA 1JNRA 1BR0A 2JQ9A 4CN1A 2ZM2A 3ZYKA 2WZIA 3DP7A 3CQGB 3PURA 2VB6A 5HWYA 2WY2A 5LG3A 3ZDHA 3O1IA 5HEHA 1YQ3A 4U2ZA 1Z8UA 3F57A 3AA6B 4TX5A 2LSJA 5AQNB 2BG9C 1T8BA 3JC6C 2FUPA 5AQPB 4UF0A 4AFTA 2X9WA 3SRZA 4EEDA 2QRXA 5L4HA 1J1JA 4YTMA 3RQWA 2XQ6A 5JRCB 5HEOA 3ZC0A 3UU8A 1UGOA 2WZHA 3TLVA 4QABA 5SYOA 2W62A 4E7ZA 5J5IA 2LM9A 3BQKA 4JI8T 2BVMA 3SFDA 3CWZB 3RH3A 5HXHA 4QHOA 4YXDA 2WDVA 5ABFB 3TLWA 4B3TT 4WV9A 4ZI2C 5HEJA 4H63H 3P4SA 2X51A 3N2GE 1HTJF 2XJ7A 2NW9A 5F8PA 3O1HA 5KZUA 2K48A 2HN1A 1KNRA 2M67A 1NEKA 4C90A 4YFSA 2XQ7A 1UUSA 5LXTE 2HHHT 2XTLA 3SOLA 3L8RA 1T7SA 1DU2A 4MFRA 4GYRA 1US7B 4QKNA 2C0SA 4I0UA 4EIWA 4I43B 1I6ZA 5H6RB 2BG9B 4LF5T 4Z90A 4UY2A 5LP6E 2YK0A 2PH9A 2EHOC 2KMFA 1MMAA 3UFEA 2YMEA 3MACA 2P9BA 4O8SA 3N2KE 4UV9B 3SFEA 3T8OA 3PDYA 2XQ4A 4E7SA 4UVBB 5FXVA 3WTOA 2BYPA 4AI6A 2XY8B 2HN2A 1WYCA 5LMUT 4PK4A 4EB6E 3JC6D 4H9SE 1ZOYA 2KT9A 3MK7C 4MLKA 1Z0PA 2ZLYA 4EGWA 4PJMA 3AE7A 5TVCA 4DR3T 4QXHB 2YKSA 4HWDA 2IIUA 5JH7E 4DMWA 2A2FX 3VKGA 1ZKEA 1SUMB 4HN9A 1Y01A 2V8SV 5JDFA 4ZI7E 4K0KT 3IBPA 4DIDB 1Y64B 4LF8T 4KHPT 4ZHQE 3P7IA 3ZMZB 1NAFA 1BR1A 4OK0A 2KNDA 1D1BA 3EHZA 4U7IA 2DWKA 3NRYA 4CN6A 5BP0A 4H9OC 4UF0B 1E7PA 1HF8A 4N78D 3HKDE 3MJXA 2JRKA 3CMLA 5AQLB 5KDMC 1LKXA 1IBLT 3N9MA 4ZI2D 3KV4A 3T1HT 5LNKA 3IEEA 2NP9A 3AE3A 4WBNE 3W15B 5L3CB 4TWHA 2YDSA 3CIRA 2XYSA 4ILAA 4AISA 2WSSV 3JAFA 4PJLA 2LKGA 2Y6XA 2IHR1 4V1Av 4GK0E 2CEAA 4EZHA 4ZK4A 3A7MA 3CQXC 1B7TA 1OXZA 4UR9A 2XQ8A 5AFHA 5LBQB 2LM2A 2WWVA 3GN5A 3HL6A 4IE4A 3IF8B 2CLYC 5LGTB 5AQTB 2W00A 3PUQA 5AFLA 1LRZA 3OKQA 4AIUA 1BR2A 3ABVA 2KXPB 5HXSA 2DHRA 5AFUL 2EHOD 5AQIB 3ZT6A 3Q9DA 2BYQA 5M4YA 3GWHA 4PJNA 2QGSA 4QH5A 3QB5A 2N1GA 3QC9A 2VKJA 4PJJA 2HH7A 2V26A 2E9XC 4NPPA 4HWCA 3ZT5A 2VWAA 4AQYT 3ZCIA 2WMNA 1XWMA 2G0UA 1BR4A 5FMNA 4KP3C 3J9X1 4LFBT 5J2UE 5KX5E 3SQ9A 4QXBB 5HXEA 3FZKB 3U3IA 5AINA 3EVYA 2ZJVA 3HI2A 2JMKA 4A56A 5ABHA 1OEDA 4DV5T 4F8HA 4A98A 4DR6T 4NXNT 2QVAA 2JIWA 2NTYA 2HPLA 2WU2A 1LVKA 4QWNB 4ADZA 1UV6A 5J1GA 1D0XA 2Y56A 5AFNA 4TWDA 2XQAA 4LMLA 3I0OA 2C5KT 3C64A 5F3JA 2IMLA 4CXYA 3AA1B 1D1AA 4JEUB 2WDQA 2WCAA 4ILCA 4BFQA 3AA0B 2CXDA 3OPCA 2M6BA 5HCJA 3ZMVB 2XQ5A 4I50E 3PUWF 2CHOA 3EDVA 3M65A 3R84B 4QACA 2YN6A 3AA7B 3N5LA 5L3BB 4LF9T 2I6HA 4Z91A 5JDLA 3UUBA 3F31A 2ZMAA 2KSRA 1FIOA 3UU4A 4JUYA 1YKHB 3AEEA 5FKYA 2Y54A 5L2LA 4YSYA 5FY1A 2D9DA 3RHWA 3AAAB 5LBMA 2PBIA 2XASB 4UELA 4B3RT 1NENA 3FHNA 2KLQA 3VHLA 3I0QA 4TNVA 1OEDC 4CZZB 2LRKA 4H9NC 3ZN1B 2XAGB 4TNWA 5AQOB 4ZJTA 5FL1A 3P4WA 3RC8A 5CFBA 4MALA 1D1CA 2X67A 1KNZA 1YXRA 2Z6EA 3GN5B 4ILBA 3ZEFB 2LSYA 4X1IE 5AQMB 2VKOA 4IDPA 4YT0A 3SQ6A 4H9RC 2CM0A 2VVNA 1HFAA 5F5WA 3CVRA 3L09A 5JQGE 2E5LT 2XZ5A 4DBMA
chains in the Genus database with same CATH topology
5AFMA 5KE4A 5L4EA 2BYQA 5AFMB 3U8KA 3UQ4A 4FRRA 4QAAA 3WTLA 5CO5A 3SH1A 3PEOA 4AFGA 5FJVA 4ILCA 2C9TA 3C84A 4BFQA 4UM3S 2BYSA 2W8FA 3PMZA 3U8NA 4HFBA 4HFHA 4ZRUA 2XYTA 4QH5A 3RI5A 2WZYA 2XQ7A 2M6BA 2QC1B 2BR7A 5HCJA 3EI0A 2XQ5A 3U8LA 5LG3A 4LMKA 5HEHA 3ZDHA 1UX2A 3EHZA 2XNUA 5BW2A 4QH4A 5J0ZA 4NPPA 4BQTA 4B5DA 4UXUA 3WTKA 4QACA 2YOEA 2YN6A 3U8MA 2W8GA 4XK9A 2YMDA 3WTJA 5BRXA 2BG9C 4XHEA 4Z91A 4A97A 3UQ7A 2BG9A 2LLYA 2UZ6A 2BG9B 5BP0A 3JAEA 4AFTA 3UUBA 2LKHA 3JADA 2X00A 3RIAA 3UU6A 2BYNA 4AFHA 2KSRA 2Y7YA 4Z90A 2XNTA 5L4HA 3C79A 2PGZA 3UU4A 2VL0A 4UM3P 3WTIA 3SQ9A 4UY2A 3RQWA 2ZJUA 2XQ6A 4ZR6A 3U8JA 5HEOA 2Y54A 4ZK1A 4UM3A 3WTHA 2PH9A 4ZJSA 3RQUA 4TWHA 3RHWA 2XNVA 1OEDE 3LSVA 4IL9A 2XYSA 3UU8A 2YMEA 5AINA 5AFKA 4ILAA 2ZJVA 3GUAA 3JAFA 5J5FA 3TLVA 4IL4A 2LKGA 4QABA 3RIFA 3T4MA 2XQ4A 3TLSA 4TWFA 3WTOA 5SYOA 2BYPA 4TNVA 1OEDC 5J5IA 5JMEA 4ZK4A 3TLUA 5J5HA 1OEDA 2BYRA 1I9BA 4F8HA 4A98A 4TNWA 3SIOA 3ZDGA 3WTMA 4LMJA 2XQ8A 4HFEA 4ZJTA 4PIRA 5AFHA 3UU3A 2BR8A 5AFJA 3EAMA 3P4WA 3WIPA 3UU5A 4ZZBA 2Y57A 2LM2A 4D01A 3WTNA 5CFBA 2Y58A 5L47A 2WNJA 4HFDA 2X00D 2WN9A 4EZ1A 2MAWA 5IUXA 4ILBA 1UV6A 1UW6A 4HFIA 3P50A 2XQ9A 3TLTA 4HFCA 4COFA 3TLWA 4ALXA 4WV9A 5TVCA 3ZKRA 2BG9E 5HEGA 5HCMA 5HEJA 2YKSA 2Y56A 3SQ6A 5AFLA 4TWDA 5AFNA 2XQAA 5LXBA 2XQ3A 4LMLA 2WNLA 4IREA 4HQPA 1OEDB 5HEUA 4QH1A 4UM1A 4X5TA 2BJ0A 5KZUA 2WNCA 4NZBA 2XZ6A 5J5GA 2XZ5A 4ZZCA 2M6IA 4DBMA 3IGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFM A;  5KE4 A;  5L4E A;  2BYQ A;  5AFM B;  3U8K A;  3UQ4 A;  4FRR A;  4QAA A;  3WTL A;  5CO5 A;  3SH1 A;  3PEO A;  4AFG A;  5FJV A;  4ILC A;  2C9T A;  3C84 A;  4BFQ A;  4UM3 S;  2BYS A;  2W8F A;  3PMZ A;  3U8N A;  4HFB A;  4HFH A;  4ZRU A;  2XYT A;  4QH5 A;  3RI5 A;  2WZY A;  2XQ7 A;  2M6B A;  2QC1 B;  2BR7 A;  5HCJ A;  3EI0 A;  2XQ5 A;  3U8L A;  5LG3 A;  4LMK A;  5HEH A;  3ZDH A;  1UX2 A;  3EHZ A;  2XNU A;  5BW2 A;  4QH4 A;  5J0Z A;  4NPP A;  4BQT A;  4B5D A;  4UXU A;  3WTK A;  4QAC A;  2YOE A;  2YN6 A;  3U8M A;  2W8G A;  4XK9 A;  2YMD A;  3WTJ A;  5BRX A;  2BG9 C;  4XHE A;  4Z91 A;  4A97 A;  3UQ7 A;  2BG9 A;  2LLY A;  2UZ6 A;  2BG9 B;  5BP0 A;  3JAE A;  4AFT A;  3UUB A;  2LKH A;  3JAD A;  2X00 A;  3RIA A;  3UU6 A;  2BYN A;  4AFH A;  2KSR A;  2Y7Y A;  4Z90 A;  2XNT A;  5L4H A;  3C79 A;  2PGZ A;  3UU4 A;  2VL0 A;  4UM3 P;  3WTI A;  3SQ9 A;  4UY2 A;  3RQW A;  2ZJU A;  2XQ6 A;  4ZR6 A;  3U8J A;  5HEO A;  2Y54 A;  4ZK1 A;  4UM3 A;  3WTH A;  2PH9 A;  4ZJS A;  3RQU A;  4TWH A;  3RHW A;  2XNV A;  1OED E;  3LSV A;  4IL9 A;  2XYS A;  3UU8 A;  2YME A;  5AIN A;  5AFK A;  4ILA A;  2ZJV A;  3GUA A;  3JAF A;  5J5F A;  3TLV A;  4IL4 A;  2LKG A;  4QAB A;  3RIF A;  3T4M A;  2XQ4 A;  3TLS A;  4TWF A;  3WTO A;  5SYO A;  2BYP A;  4TNV A;  1OED C;  5J5I A;  5JME A;  4ZK4 A;  3TLU A;  5J5H A;  1OED A;  2BYR A;  1I9B A;  4F8H A;  4A98 A;  4TNW A;  3SIO A;  3ZDG A;  3WTM A;  4LMJ A;  2XQ8 A;  4HFE A;  4ZJT A;  4PIR A;  5AFH A;  3UU3 A;  2BR8 A;  5AFJ A;  3EAM A;  3P4W A;  3WIP A;  3UU5 A;  4ZZB A;  2Y57 A;  2LM2 A;  4D01 A;  3WTN A;  5CFB A;  2Y58 A;  5L47 A;  2WNJ A;  4HFD A;  2X00 D;  2WN9 A;  4EZ1 A;  2MAW A;  5IUX A;  4ILB A;  1UV6 A;  1UW6 A;  4HFI A;  3P50 A;  2XQ9 A;  3TLT A;  4HFC A;  4COF A;  3TLW A;  4ALX A;  4WV9 A;  5TVC A;  3ZKR A;  2BG9 E;  5HEG A;  5HCM A;  5HEJ A;  2YKS A;  2Y56 A;  3SQ6 A;  5AFL A;  4TWD A;  5AFN A;  2XQA A;  5LXB A;  2XQ3 A;  4LML A;  2WNL A;  4IRE A;  4HQP A;  1OED B;  5HEU A;  4QH1 A;  4UM1 A;  4X5T A;  2BJ0 A;  5KZU A;  2WNC A;  4NZB A;  2XZ6 A;  5J5G A;  2XZ5 A;  4ZZC A;  2M6I A;  4DBM A;  3IGQ A; 
#chains in the Genus database with same CATH topology
 4JI7 T;  5KE4 A;  5L4E A;  2CHN A;  5CO5 A;  4LF7 T;  2FJE A;  3OJA A;  3N9P A;  3UUX B;  5CJ5 A;  2LSK A;  2VQE T;  2GK9 A;  2VVS A;  4CXX A;  2BS3 A;  2XZE A;  3E08 A;  2BVL A;  1CUN A;  2YDR A;  4XHE A;  4I55 E;  2WM9 A;  3K3N A;  4AKR B;  5ADX L;  3RIA A;  1M62 A;  4PW8 A;  2C5J A;  1LVF A;  2VL8 A;  2LOP A;  1E1H B;  3RRC A;  2D5U A;  3C51 A;  3E22 E;  5FY7 A;  2UXC T;  2VK9 A;  3ZT7 A;  4CI1 B;  2VAS A;  1OED E;  3LFM A;  4XAX B;  2OV9 A;  5J2T E;  3LK4 2;  5A1L A;  5LOV E;  3T4M A;  3RRW A;  4UV8 B;  5BR8 T;  2N2N A;  2V6X A;  4WW0 A;  5LMN T;  4ZXL A;  2JQH A;  4DV0 T;  2SPC A;  2EHO A;  4NUV A;  3AED A;  4EZ1 A;  2CA5 A;  2BZB A;  4H63 V;  2WQY A;  3ZC1 A;  2MTQ A;  1CHU A;  3EUH A;  1E2A A;  3CX6 B;  2XZ6 A;  5AQG B;  2W61 A;  2ZM6 T;  3WTL A;  1D0Y A;  2RA1 A;  3SH1 A;  2V7M A;  3C98 B;  3AEC A;  4UM3 S;  2W8F A;  4HFH A;  5LHH B;  1XNR T;  3QNU A;  3FBL A;  5FVL A;  3R6N A;  1KNP A;  1QUU A;  2QA7 A;  5KXJ A;  2H7O A;  1W0B A;  4IE0 A;  4M1P A;  1WCR A;  2ACZ A;  4CXW A;  3M3Z B;  4YTP A;  2X00 A;  4U2Y A;  1SA0 E;  2LSG A;  5E0O A;  4AFH A;  5DJQ C;  4X1Y E;  2IC9 A;  2BDE A;  3RGL A;  3T1Y T;  4NXM T;  2PGZ A;  3I9W A;  2LSI A;  2Q9Q A;  3AVS A;  5AQJ B;  2BKP A;  4TN7 B;  5LJM A;  4QX7 B;  2LHN A;  1N33 T;  3AE9 A;  4HE8 A;  3ETU A;  4EYY R;  3ZMU B;  1XDP A;  1YQ4 A;  3WI3 A;  2IUB A;  5AQF B;  3LBX A;  1FMW A;  2NW8 A;  3TLU A;  3D0T A;  3DTO A;  2BYR A;  2A9U A;  2MBG A;  5EK2 A;  3H3A A;  4LMJ A;  3PTR B;  2CXL A;  5AQR B;  2D0T A;  4L9I A;  5L3G B;  2XQ9 A;  2PG8 A;  3A8Y C;  4U74 A;  4BJN A;  2J4G A;  3MKD A;  4EYU A;  2PTF A;  4X1K E;  1HG2 A;  3CX8 B;  4DND A;  4QAA A;  3C84 A;  3OYX A;  4HFB A;  3ESL A;  1XNQ T;  4BAY B;  2XYT A;  1UUR A;  1W0A A;  2WZY A;  2J47 A;  3FBZ A;  3N9L A;  5BW2 A;  5J0Z A;  2YOE A;  1KF6 A;  4DV3 T;  1AJ3 A;  1HNW T;  5JDG A;  1ZV4 X;  2LT3 A;  2CCQ A;  2XNT A;  3V5S A;  4LFA T;  1MMD A;  4UEM A;  3MXZ A;  4EXT A;  4UM3 P;  2Q9Q C;  3P8C D;  2E9X A;  2X0H A;  4YHH T;  2XAJ B;  4UM3 A;  2KZ7 B;  1IJ6 A;  3AB3 B;  2ACX A;  4YSX A;  3BQL A;  3UUM A;  4ISS A;  1SE7 A;  5C3J A;  3MZK B;  3X1D A;  4IDZ A;  4I4T E;  4AKI A;  3E0Z A;  3VKH A;  4DR1 T;  4F6R C;  3HR0 A;  4HWH A;  2XQY A;  4OYK A;  2EHO B;  3BQI A;  2WNJ A;  3RYC E;  2UUC T;  3Q5E A;  4AXP A;  2ES0 A;  1UW6 A;  2FJA A;  2MPK A;  4DVD A;  1UCU A;  2Y48 B;  2WNL A;  2V1D B;  4PFO A;  4UM1 A;  2BJ0 A;  5EK4 A;  3FZL B;  4L5G A;  5ABG A;  4X64 T;  3SWH A;  3AE2 A;  3LK2 B;  4ZS2 A;  4AFG A;  4OYJ A;  3KIN B;  3N9O A;  4MBQ A;  2QC1 B;  1HCI A;  4YJ3 E;  4KMC A;  3UUN A;  4GK5 E;  3ZMS B;  3RKO A;  3U8M A;  4HGA A;  2LRL A;  2WWU A;  3FB2 A;  4LF4 T;  3OYZ A;  2LE8 A;  2BYN A;  2BS2 A;  3PUX F;  4Q25 A;  4EEB A;  1J5W A;  3RX6 A;  3QK6 A;  5LHG B;  4Z8X A;  2Q9Q B;  5BMV E;  2K24 A;  4KI0 F;  5ETW A;  2XSB A;  3AEB A;  3CPZ A;  1VOM A;  2FJB A;  5JR9 A;  1U4Q A;  3RYF E;  4IDO A;  2YU2 A;  4EV6 A;  1NWM X;  4IHJ E;  4AKG A;  3LBX B;  4XBF B;  1T98 A;  4TWF A;  1G73 A;  2X9Y A;  1VCS A;  5JDM A;  2XSA A;  3RKG A;  2FBW A;  3AE1 A;  3GMI A;  4IE7 A;  4KUM B;  2X00 D;  2X9X A;  2D0U A;  4CI3 B;  4O4H E;  3ZJ1 A;  4O4J E;  1XZY A;  2KIN B;  3K1S A;  4DR2 T;  2X66 A;  4G2A A;  5FXX A;  2Q9Q D;  3KDS E;  2XUE A;  3RYH E;  4BA9 A;  2IW5 B;  1W9R A;  2E2A A;  3RPU A;  4IDQ A;  2B76 A;  2CXF A;  4G63 A;  3B57 A;  2IC6 A;  3ZYM A;  5L3F B;  4HWF A;  1FJG T;  4IE6 A;  3PMZ A;  2WMO A;  3P4R A;  3HKC E;  3OBV E;  4JEH B;  3AAI A;  3KBT A;  3LJC A;  2CLY B;  2E5V A;  5TAO A;  5EK3 A;  1W09 A;  4QXC B;  5JDQ A;  4QH4 A;  3QOF A;  3ZPO A;  2X9H A;  2CMR A;  2H88 A;  2W8G A;  2YU1 A;  2UUA T;  4XK9 A;  2NW7 A;  2DL1 A;  1OWA A;  1S35 A;  4J2C A;  5IHY A;  2WAU A;  4O4I E;  4JYA T;  3PU3 A;  4QX8 B;  1X79 A;  2ZJU A;  3NZQ A;  3L39 A;  2CRB A;  3OTO T;  4B6X A;  2V5D A;  4H9P C;  4OFZ A;  2E9X B;  2X0L B;  2XNV A;  5JR9 C;  1MIW A;  5AQQ B;  2XAF B;  4TV9 E;  4IL4 A;  5ABF A;  3RIF A;  2H89 A;  2LJL A;  4ANJ A;  2BS4 A;  4ZS3 A;  4ASK A;  5LGU B;  3ZSS A;  4GIW A;  3KBU A;  2X68 A;  4HFE A;  2I0M A;  3EAM A;  2UXX B;  2XPK A;  4PK5 A;  3PE0 A;  4HFD A;  3GA8 A;  4HEA A;  1KFY A;  2V6Y A;  3PUA A;  4LF6 T;  4HFC A;  2NOX A;  3LDQ B;  4P1N A;  5HEG A;  2E9X D;  3AEF A;  2C5I T;  3VR9 A;  4MHC A;  3IGQ A;  4CN4 A;  1O3X A;  3ONJ A;  3O1J A;  3ZYL A;  2WBL A;  1X9B A;  4LFC T;  5DQV A;  3CKD A;  2XNU A;  3AEA A;  4YLH A;  2ZM8 A;  4JI0 T;  4JI3 T;  4JI2 T;  4AQF C;  4AKL A;  1FEW A;  3CX7 B;  2LLY A;  4IDN A;  4TV8 E;  2K9A A;  3PU8 A;  4WZX A;  4U72 A;  4X62 T;  1MMG A;  5HWX A;  3AEG A;  3C4W A;  4K0U A;  3IHR A;  4NUU A;  4IE5 A;  2DLR A;  3ANW A;  3RQU A;  4UVC B;  2CBJ A;  2B1E A;  1M7K A;  2Y8D A;  3V5U A;  3AXJ A;  4CQI A;  4HKA A;  2ZM0 A;  3ZJ2 A;  3RIU A;  4PNI A;  5L3D B;  1I9B A;  3N9N A;  3PUG A;  4DV2 T;  3ZDG A;  3EAB A;  4PIR A;  4X20 E;  4ZZB A;  5JDN A;  4D01 A;  3N9Q A;  4X66 T;  2PFV A;  4HWI B;  2AXD S;  4U33 A;  1JNZ A;  4NIQ A;  4P09 A;  3WAK A;  1OED B;  4A5X A;  5LB7 B;  4P0B A;  2W4X A;  3PUY F;  3ZN0 B;  4WYV A;  2M6I A;  2UXB T;  4PFP A;  2WS3 A;  5LHI B;  5KMG P;  1KEY A;  3C50 A;  2CBI A;  2CWO A;  2C9T A;  1WR6 A;  3RYI E;  5AQS B;  2AE9 A;  1YD8 G;  1I94 T;  3U8L A;  5FVK A;  2CWY A;  3C4Z A;  3S4U A;  4UXU A;  1MNE A;  2IAK A;  1UX5 A;  3UQ7 A;  5HAX A;  4GKK T;  3JAE A;  3I9Y A;  2LKH A;  3P4Q A;  1N34 T;  4JLE A;  3Q2M A;  3OVU A;  3KV9 A;  2VL0 A;  4JV5 T;  3IA3 A;  2W2U A;  1UK5 A;  3BK9 A;  2V7I A;  3F2E A;  5AFK A;  2A3D A;  1MMN A;  5HXC A;  3RIU C;  2H7V C;  5J5H A;  4IST A;  3NRX A;  5JDH A;  3KVB A;  5CB4 E;  5FXW A;  5DAB A;  3ETV A;  3PJA J;  3RF1 A;  1N32 T;  2JJ9 A;  4O2A E;  3TKL B;  3UU3 A;  3PUV F;  3WTN A;  5L47 A;  2WN9 A;  3PJA A;  5LJN A;  2V6Y B;  1QSD A;  4UVA B;  3ZKR A;  2BG9 E;  5HCM A;  4O4L E;  4KHZ F;  2LEH A;  4JI4 T;  5LXB A;  2PJQ A;  3Q5W A;  2J1D G;  2D2S A;  2JQQ A;  5LCY A;  4BJM A;  4YJ2 E;  4DR5 T;  5H6Q B;  1HNZ T;  1IZN B;  3NWI A;  4CI2 B;  2BYS A;  1ZEE A;  2KWI B;  1XDO A;  2UU9 T;  5LG4 A;  5DQW A;  2YEV C;  4B5D A;  4BQT A;  4JI5 T;  3VU7 H;  2W67 A;  5BRX A;  1XMQ T;  1WR0 A;  2UZ6 A;  1WRD A;  3ONX A;  2LOS A;  4YY3 T;  3P4P A;  3UU6 A;  3VRB A;  3B5M A;  5C2T A;  3MA9 A;  3WTI A;  5FP3 A;  3UT5 E;  4ZOL E;  1HX1 B;  3RC3 A;  5LA6 E;  3ANW B;  3NVO A;  1H7C A;  2HPJ A;  2UUB T;  2J62 A;  3K3Q C;  3KVA A;  2RP4 A;  3AXJ B;  3HKE E;  4PK6 A;  2DCF A;  3U78 A;  4IGU A;  1WLX A;  5FNV E;  4YTN A;  4YSZ A;  4GOU A;  2YIN A;  4DR7 T;  5FXZ A;  1HR0 T;  4C91 A;  5AFJ A;  4JBW F;  3UU5 A;  2V7K A;  3NZP A;  3H3M A;  4DBQ A;  5IWA T;  2BBH A;  2N9D A;  2E8I A;  4IIJ E;  3QUJ A;  4TZ4 C;  3TLT A;  3KV6 A;  4XZC A;  2XQ3 A;  1IAP A;  4QH1 A;  4X5T A;  2MOZ A;  2ODV A;  5AQV B;  2WU5 A;  1HX8 A;  3AAE B;  5AFM A;  1S94 A;  5L3E B;  4U3C A;  1EZ3 A;  3N2O A;  5FJV A;  3U8N A;  2V5C A;  3RI5 A;  2BR7 A;  3J7Y q;  4H9Q C;  1J5E T;  3FXD B;  1UX4 A;  2RPA A;  4JI1 T;  3SS1 A;  5LYJ E;  2YMD A;  5CGM A;  3WTJ A;  4TUY E;  5JTG A;  1HS7 A;  2V7L A;  4ILU A;  2NWB A;  2W66 A;  2BKO A;  3PUS A;  5CA0 E;  2K3W A;  3QB5 K;  2Y7Y A;  3VR8 A;  1ZHC A;  5FL0 A;  2DNX A;  2JPF A;  3LK3 B;  2XM1 A;  3KV5 A;  2IDO B;  4ZR6 A;  5IYZ E;  3CQC B;  3U8J A;  4ZK1 A;  4UIG A;  3UUL A;  3I1A A;  5ABE A;  4DO0 A;  4DV1 T;  2XHE B;  2NR4 A;  3NKZ A;  1HG5 A;  4X65 T;  5J5F A;  2X0Y A;  1VRB A;  2K5B B;  5EZY E;  3ZLI A;  5JME A;  2LHR A;  1R8I A;  4WBO A;  2Y57 A;  2KWH A;  2MAW A;  5IUX A;  5CA1 E;  1IBK T;  1V9D A;  4GYS A;  2L8K A;  3HA4 A;  2WNC A;  4NZB A;  4B3S T;  4ZI3 C;  3PEO A;  3PUZ F;  2XAQ B;  2ODU A;  3AE8 A;  1G8X A;  4B3M T;  3EI0 A;  3L3P A;  2VUR A;  2OLT A;  5JRE A;  1UX2 A;  2W0G A;  3PV0 F;  3HKB E;  3DJB A;  1XMO T;  2NTX A;  4A97 A;  4U31 A;  3NBX X;  4AKH A;  4AQG A;  3AE4 A;  4ZEY A;  3JAD A;  1FMV A;  5AQH B;  2F4V T;  3C79 A;  2UXN B;  3VRA A;  5JRC A;  5JVD E;  5FYM A;  4KX6 A;  2VQF T;  5C8Y E;  1D0Z A;  4GKJ T;  1MIV A;  4AQF A;  1L0V A;  4IL9 A;  5FY0 A;  1IJ5 A;  3EDU A;  4HFV A;  2WDR A;  4FI5 A;  1IBM T;  2BBJ A;  4JI6 T;  4DV4 T;  3Q5D A;  1KK7 A;  3O9X A;  2VKD A;  3G06 A;  2VKH A;  4DV7 T;  2L9Q A;  4IT4 A;  2XM2 A;  1MND A;  5AQK B;  1WFD A;  3H37 A;  3P50 A;  4HFI A;  3WAJ A;  5GON E;  4DBR A;  4DMV A;  1GQE A;  4UXN B;  2WP9 A;  3UFG A;  4HQP A;  2BKN A;  3C4X A;  4OHF A;  3FZF B;  1YKE B;  5J5G A;  3O4X E;  4DR4 T;  1T72 A;  5AFM B;  3U8K A;  2DI4 A;  5HYA A;  4EOZ B;  3Q5X A;  4ZRU A;  2JMH A;  3JCF A;  4ERR A;  4HTE A;  4L0R A;  4LMK A;  2OA5 A;  3FXE B;  3ZST A;  2FJD A;  1SHZ C;  3WTK A;  2A72 A;  2BG9 A;  4DUZ T;  4P0A A;  2YDQ A;  3FZM B;  3B13 A;  4KBM B;  4OX9 T;  2V7J A;  5HXR A;  3AE5 A;  2CE7 A;  1N36 T;  4WNK A;  5AQU B;  4FJO A;  3WTH A;  4ZJS A;  2DWG A;  1MIY A;  2QYW A;  3LSV A;  4ZI3 D;  3UTK A;  3ZCJ A;  3GUA A;  2H3R A;  4PAG A;  1YW0 A;  2W63 A;  3LG7 A;  2R6G F;  4EAH A;  4DUY T;  3TLS A;  1QLB A;  3A5X A;  3CK6 A;  3ZMT B;  2JQK A;  3SIO A;  2XAH B;  3WTM A;  3ONL C;  1ZP0 A;  2BR8 A;  4YHJ A;  1HNX T;  3WIP A;  1U5P A;  2L3L A;  4EZ4 A;  2Y58 A;  4U7Y A;  5JR9 B;  2CPT A;  5LGN B;  4ALX A;  4COF A;  2I59 A;  3KFW X;  4O2B E;  3AE6 A;  1WYB A;  3K8P C;  4DV6 T;  4IRE A;  2WB5 A;  3RLF F;  5HEU A;  3AVR A;  3FZH B;  2UXD T;  4ZZC A;  1VCT A;  3K3O A;  2MYS A;  3UQ4 A;  4FRR A;  1JNR A;  1BR0 A;  2JQ9 A;  4CN1 A;  2ZM2 A;  3ZYK A;  2WZI A;  3DP7 A;  3CQG B;  3PUR A;  2VB6 A;  5HWY A;  2WY2 A;  5LG3 A;  3ZDH A;  3O1I A;  5HEH A;  1YQ3 A;  4U2Z A;  1Z8U A;  3F57 A;  3AA6 B;  4TX5 A;  2LSJ A;  5AQN B;  2BG9 C;  1T8B A;  3JC6 C;  2FUP A;  5AQP B;  4UF0 A;  4AFT A;  2X9W A;  3SRZ A;  4EED A;  2QRX A;  5L4H A;  1J1J A;  4YTM A;  3RQW A;  2XQ6 A;  5JRC B;  5HEO A;  3ZC0 A;  3UU8 A;  1UGO A;  2WZH A;  3TLV A;  4QAB A;  5SYO A;  2W62 A;  4E7Z A;  5J5I A;  2LM9 A;  3BQK A;  4JI8 T;  2BVM A;  3SFD A;  3CWZ B;  3RH3 A;  5HXH A;  4QHO A;  4YXD A;  2WDV A;  5ABF B;  3TLW A;  4B3T T;  4WV9 A;  4ZI2 C;  5HEJ A;  4H63 H;  3P4S A;  2X51 A;  3N2G E;  1HTJ F;  2XJ7 A;  2NW9 A;  5F8P A;  3O1H A;  5KZU A;  2K48 A;  2HN1 A;  1KNR A;  2M67 A;  1NEK A;  4C90 A;  4YFS A;  2XQ7 A;  1UUS A;  5LXT E;  2HHH T;  2XTL A;  3SOL A;  3L8R A;  1T7S A;  1DU2 A;  4MFR A;  4GYR A;  1US7 B;  4QKN A;  2C0S A;  4I0U A;  4EIW A;  4I43 B;  1I6Z A;  5H6R B;  2BG9 B;  4LF5 T;  4Z90 A;  4UY2 A;  5LP6 E;  2YK0 A;  2PH9 A;  2EHO C;  2KMF A;  1MMA A;  3UFE A;  2YME A;  3MAC A;  2P9B A;  4O8S A;  3N2K E;  4UV9 B;  3SFE A;  3T8O A;  3PDY A;  2XQ4 A;  4E7S A;  4UVB B;  5FXV A;  3WTO A;  2BYP A;  4AI6 A;  2XY8 B;  2HN2 A;  1WYC A;  5LMU T;  4PK4 A;  4EB6 E;  3JC6 D;  4H9S E;  1ZOY A;  2KT9 A;  3MK7 C;  4MLK A;  1Z0P A;  2ZLY A;  4EGW A;  4PJM A;  3AE7 A;  5TVC A;  4DR3 T;  4QXH B;  2YKS A;  4HWD A;  2IIU A;  5JH7 E;  4DMW A;  2A2F X;  3VKG A;  1ZKE A;  1SUM B;  4HN9 A;  1Y01 A;  2V8S V;  5JDF A;  4ZI7 E;  4K0K T;  3IBP A;  4DID B;  1Y64 B;  4LF8 T;  4KHP T;  4ZHQ E;  3P7I A;  3ZMZ B;  1NAF A;  1BR1 A;  4OK0 A;  2KND A;  1D1B A;  3EHZ A;  4U7I A;  2DWK A;  3NRY A;  4CN6 A;  5BP0 A;  4H9O C;  4UF0 B;  1E7P A;  1HF8 A;  4N78 D;  3HKD E;  3MJX A;  2JRK A;  3CML A;  5AQL B;  5KDM C;  1LKX A;  1IBL T;  3N9M A;  4ZI2 D;  3KV4 A;  3T1H T;  5LNK A;  3IEE A;  2NP9 A;  3AE3 A;  4WBN E;  3W15 B;  5L3C B;  4TWH A;  2YDS A;  3CIR A;  2XYS A;  4ILA A;  4AIS A;  2WSS V;  3JAF A;  4PJL A;  2LKG A;  2Y6X A;  2IHR 1;  4V1A v;  4GK0 E;  2CEA A;  4EZH A;  4ZK4 A;  3A7M A;  3CQX C;  1B7T A;  1OXZ A;  4UR9 A;  2XQ8 A;  5AFH A;  5LBQ B;  2LM2 A;  2WWV A;  3GN5 A;  3HL6 A;  4IE4 A;  3IF8 B;  2CLY C;  5LGT B;  5AQT B;  2W00 A;  3PUQ A;  5AFL A;  1LRZ A;  3OKQ A;  4AIU A;  1BR2 A;  3ABV A;  2KXP B;  5HXS A;  2DHR A;  5AFU L;  2EHO D;  5AQI B;  3ZT6 A;  3Q9D A;  2BYQ A;  5M4Y A;  3GWH A;  4PJN A;  2QGS A;  4QH5 A;  3QB5 A;  2N1G A;  3QC9 A;  2VKJ A;  4PJJ A;  2HH7 A;  2V26 A;  2E9X C;  4NPP A;  4HWC A;  3ZT5 A;  2VWA A;  4AQY T;  3ZCI A;  2WMN A;  1XWM A;  2G0U A;  1BR4 A;  5FMN A;  4KP3 C;  3J9X 1;  4LFB T;  5J2U E;  5KX5 E;  3SQ9 A;  4QXB B;  5HXE A;  3FZK B;  3U3I A;  5AIN A;  3EVY A;  2ZJV A;  3HI2 A;  2JMK A;  4A56 A;  5ABH A;  1OED A;  4DV5 T;  4F8H A;  4A98 A;  4DR6 T;  4NXN T;  2QVA A;  2JIW A;  2NTY A;  2HPL A;  2WU2 A;  1LVK A;  4QWN B;  4ADZ A;  1UV6 A;  5J1G A;  1D0X A;  2Y56 A;  5AFN A;  4TWD A;  2XQA A;  4LML A;  3I0O A;  2C5K T;  3C64 A;  5F3J A;  2IML A;  4CXY A;  3AA1 B;  1D1A A;  4JEU B;  2WDQ A;  2WCA A;  4ILC A;  4BFQ A;  3AA0 B;  2CXD A;  3OPC A;  2M6B A;  5HCJ A;  3ZMV B;  2XQ5 A;  4I50 E;  3PUW F;  2CHO A;  3EDV A;  3M65 A;  3R84 B;  4QAC A;  2YN6 A;  3AA7 B;  3N5L A;  5L3B B;  4LF9 T;  2I6H A;  4Z91 A;  5JDL A;  3UUB A;  3F31 A;  2ZMA A;  2KSR A;  1FIO A;  3UU4 A;  4JUY A;  1YKH B;  3AEE A;  5FKY A;  2Y54 A;  5L2L A;  4YSY A;  5FY1 A;  2D9D A;  3RHW A;  3AAA B;  5LBM A;  2PBI A;  2XAS B;  4UEL A;  4B3R T;  1NEN A;  3FHN A;  2KLQ A;  3VHL A;  3I0Q A;  4TNV A;  1OED C;  4CZZ B;  2LRK A;  4H9N C;  3ZN1 B;  2XAG B;  4TNW A;  5AQO B;  4ZJT A;  5FL1 A;  3P4W A;  3RC8 A;  5CFB A;  4MAL A;  1D1C A;  2X67 A;  1KNZ A;  1YXR A;  2Z6E A;  3GN5 B;  4ILB A;  3ZEF B;  2LSY A;  4X1I E;  5AQM B;  2VKO A;  4IDP A;  4YT0 A;  3SQ6 A;  4H9R C;  2CM0 A;  2VVN A;  1HFA A;  5F5W A;  3CVR A;  3L09 A;  5JQG E;  2E5L T;  2XZ5 A;  4DBM A; 
#chains in the Genus database with same CATH homology
 5AFM A;  5KE4 A;  5L4E A;  2BYQ A;  5AFM B;  3U8K A;  3UQ4 A;  4FRR A;  4QAA A;  3WTL A;  5CO5 A;  3SH1 A;  3PEO A;  4AFG A;  5FJV A;  4ILC A;  2C9T A;  3C84 A;  4BFQ A;  4UM3 S;  2BYS A;  2W8F A;  3PMZ A;  3U8N A;  4HFB A;  4HFH A;  4ZRU A;  2XYT A;  4QH5 A;  3RI5 A;  2WZY A;  2XQ7 A;  2M6B A;  2QC1 B;  2BR7 A;  5HCJ A;  3EI0 A;  2XQ5 A;  3U8L A;  5LG3 A;  4LMK A;  5HEH A;  3ZDH A;  1UX2 A;  3EHZ A;  2XNU A;  5BW2 A;  4QH4 A;  5J0Z A;  4NPP A;  4BQT A;  4B5D A;  4UXU A;  3WTK A;  4QAC A;  2YOE A;  2YN6 A;  3U8M A;  2W8G A;  4XK9 A;  2YMD A;  3WTJ A;  5BRX A;  2BG9 C;  4XHE A;  4Z91 A;  4A97 A;  3UQ7 A;  2BG9 A;  2LLY A;  2UZ6 A;  2BG9 B;  5BP0 A;  3JAE A;  4AFT A;  3UUB A;  2LKH A;  3JAD A;  2X00 A;  3RIA A;  3UU6 A;  2BYN A;  4AFH A;  2KSR A;  2Y7Y A;  4Z90 A;  2XNT A;  5L4H A;  3C79 A;  2PGZ A;  3UU4 A;  2VL0 A;  4UM3 P;  3WTI A;  3SQ9 A;  4UY2 A;  3RQW A;  2ZJU A;  2XQ6 A;  4ZR6 A;  3U8J A;  5HEO A;  2Y54 A;  4ZK1 A;  4UM3 A;  3WTH A;  2PH9 A;  4ZJS A;  3RQU A;  4TWH A;  3RHW A;  2XNV A;  1OED E;  3LSV A;  4IL9 A;  2XYS A;  3UU8 A;  2YME A;  5AIN A;  5AFK A;  4ILA A;  2ZJV A;  3GUA A;  3JAF A;  5J5F A;  3TLV A;  4IL4 A;  2LKG A;  4QAB A;  3RIF A;  3T4M A;  2XQ4 A;  3TLS A;  4TWF A;  3WTO A;  5SYO A;  2BYP A;  4TNV A;  1OED C;  5J5I A;  5JME A;  4ZK4 A;  3TLU A;  5J5H A;  1OED A;  2BYR A;  1I9B A;  4F8H A;  4A98 A;  4TNW A;  3SIO A;  3ZDG A;  3WTM A;  4LMJ A;  2XQ8 A;  4HFE A;  4ZJT A;  4PIR A;  5AFH A;  3UU3 A;  2BR8 A;  5AFJ A;  3EAM A;  3P4W A;  3WIP A;  3UU5 A;  4ZZB A;  2Y57 A;  2LM2 A;  4D01 A;  3WTN A;  5CFB A;  2Y58 A;  5L47 A;  2WNJ A;  4HFD A;  2X00 D;  2WN9 A;  4EZ1 A;  2MAW A;  5IUX A;  4ILB A;  1UV6 A;  1UW6 A;  4HFI A;  3P50 A;  2XQ9 A;  3TLT A;  4HFC A;  4COF A;  3TLW A;  4ALX A;  4WV9 A;  5TVC A;  3ZKR A;  2BG9 E;  5HEG A;  5HCM A;  5HEJ A;  2YKS A;  2Y56 A;  3SQ6 A;  5AFL A;  4TWD A;  5AFN A;  2XQA A;  5LXB A;  2XQ3 A;  4LML A;  2WNL A;  4IRE A;  4HQP A;  1OED B;  5HEU A;  4QH1 A;  4UM1 A;  4X5T A;  2BJ0 A;  5KZU A;  2WNC A;  4NZB A;  2XZ6 A;  5J5G A;  2XZ5 A;  4ZZC A;  2M6I A;  4DBM A;  3IGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...