4HFHA

The glic pentameric ligand-gated ion channel (wild-type) complexed to bromoform
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfhA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfhA01
3P50A 3WTHA 4ZK1A 5J5IA 4DBMA 3C84A 3WTMA 4HFCA 3RI5A 5HEUA 2Y56A 5AFHA 4ZZCA 1OEDC 3LSVA 3TLUA 5AFLA 4LMKA 2BR7A 2YN6A 4Z90A 2XZ5A 1UW6A 2BYRA 3TLVA 2WNCA 2M6IA 5AFKA 4ZZBA 3ZDGA 4HFDA 3WTJA 4NPPA 3UU8A 2BYNA 2X00A 4UM3A 3WTIA 1OEDE 4TNVA 2XQ7A 4COFA 2BG9E 4TWHA 2XYSA 4ILBA 2XQ5A 3C79A 5CO5A 3U8LA 4UXUA 2Y58A 4NZBA 2YOEA 3TLSA 3PEOA 3RQWA 5AINA 2XQ4A 4HFHA 3GUAA 5J5FA 5HEGA 4HFIA 4BQTA 5AFNA 3IGQA 2BJ0A 4UM1A 4EZ1A 3UUBA 3TLWA 4UM3S 5J5GA 2YMDA 4QH5A 4QABA 3U8MA 2LLYA 2XNTA 2BG9C 2XQ8A 2XNVA 2BYQA 2XQAA 4QH4A 3P4WA 2UZ6A 4LMLA 3UU3A 4IL4A 2QC1B 4AFTA 4ZJTA 3RQUA 3ZDHA 5HEOA 2Y54A 4HFEA 3PMZA 4XK9A 4HQPA 3SH1A 5CFBA 4AFHA 5BW2A 4ZR6A 4TNWA 2X00D 3ZKRA 5HEJA 2W8GA 2VL0A 5HCJA 5L4EA 5AFMA 5KZUA 1UV6A 1UX2A 2C9TA 5JMEA 2BYSA 4B5DA 3TLTA 3JAEA 2KSRA 3JADA 5BRXA 3UQ7A 2XQ9A 3UU6A 4UM3P 4WV9A 3EHZA 4A98A 4ZK4A 5HEHA 2YKSA 1OEDA 4X5TA 2BG9A 4PIRA 2WNLA 2BYPA 3WTNA 2PGZA 3SQ6A 2YMEA 4UY2A 2LM2A 2WNJA 2ZJVA 3RHWA 3U8NA 4QH1A 4IL9A 5BP0A 3U8JA 3RIFA 3UU5A 5LG3A 2Y57A 4Z91A 4ILAA 4QAAA 3UU4A 4ZJSA 2LKHA 2WN9A 3WTOA 3WTLA 5L47A 2XNUA 2WZYA 2ZJUA 4BFQA 5J5HA 5KE4A 5FJVA 5IUXA 3EAMA 4HFBA 4ZRUA 3EI0A 4LMJA 2M6BA 5LXBA 2BR8A 5AFMB 2XQ3A 2MAWA 2LKGA 3SIOA 4A97A 3U8KA 3JAFA 4AFGA 4TWFA 3UQ4A 4ILCA 2W8FA 5TVCA 2XYTA 4QACA 3SQ9A 2XZ6A 4ALXA 5L4HA 4XHEA 4FRRA 2Y7YA 1OEDB 5AFJA 4TWDA 4F8HA 2BG9B 1I9BA 5HCMA 3T4MA 3WTKA 4D01A 3WIPA 2XQ6A 2PH9A 3RIAA 4IREA 5SYOA 5J0ZA
chains in the Genus database with same CATH superfamily
2L3LA 4XZCA 2Y48B 3C84A 1UX4A 3FBZA 2Y56A 3M3ZB 2XSBA 2YN6A 1ZKEA 3UFGA 3K3NA 4NPPA 5C2TA 1OEDE 2UU9T 4DR4T 2JMKA 4P0AA 3RQWA 3HKCE 1FMVA 4JI8T 3P4RA 5L2LA 4BQTA 1HX1B 3ZT6A 1UCUA 3ZMZB 3ONLC 5ETWA 2HPLA 2V5CA 2RA1A 4FJOA 3H3AA 5HEOA 2V7LA 4JLEA 2VASA 4IIJE 3UTKA 1MIVA 5H6RB 4LF8T 2UXXB 4TNWA 3PUQA 2N9DA 1N34T 2KSRA 4YTMA 3ZN1B 2C0SA 3CPZA 5HEHA 1H7CA 4JYAT 2ZM6T 2Q9QD 2WS3A 4KUMB 2CEAA 2VVNA 2MYSA 2V5DA 3QNUA 5LG4A 1J5WA 1OXZA 4KBMB 3HKDE 5FY0A 1SUMB 5KMGP 2WZYA 4EGWA 2K9AA 2ODVA 1ZP0A 2R6GF 5LP6E 4A97A 3LBXB 3P7IA 2XPKA 2ZM8A 3E0ZA 4ZXLA 1D1CA 3OYXA 1M7KA 4V1Av 5C8YE 3WTKA 5FXXA 1UURA 2WWUA 4H9QC 3I0QA 1W0BA 3V5UA 1YD8G 1U4QA 5LJMA 3VRBA 3KBTA 4ZEYA 3HI2A 4JUYA 2XM2A 5JVDE 2XQYA 4DBQA 1HNXT 4DR6T 4WYVA 3AEFA 2XAHB 2X68A 3OTOT 3FZFB 3ZMUB 4UVCB 3TLWA 3NRYA 2XNTA 2YDSA 4DR2T 3SRZA 2PBIA 3UU3A 2HN1A 4ILUA 2EHOC 3A7MA 4CI3B 5IYZE 3KVBA 1ZV4X 2VL0A 2FBWA 3TKLB 5FKYA 2BZBA 2ODUA 1FEWA 1YXRA 2H89A 1AJ3A 2CPTA 1UK5A 4GIWA 3N2KE 5JTGA 2LEHA 5J1GA 4ZJSA 3WTLA 4HFVA 2XNUA 4O4LE 2WSSV 1HFAA 4TN7B 2NWBA 5FP3A 4PJNA 3NVOA 1MMGA 2QGSA 4AFGA 4U33A 3SQ9A 5LGUB 4ALXA 1B7TA 4H9SE 3AEDA 3T1YT 2E8IA 4D01A 4OYJA 3PDYA 3EABA 4UEMA 3WTHA 5EZYE 5LA6E 2JQQA 1J1JA 3RC8A 4L9IA 3RYFE 2XUEA 3PTRB 1MNEA 2WCAA 4EXTA 3KINB 1T98A 3ZN0B 3AE8A 5DQVA 3LG7A 4UM3A 2UXBT 1N33T 2NW7A 2PTFA 4U7IA 2E9XD 1IZNB 4AQGA 1Z0PA 3ZEFB 4TV9E 3N5LA 1HF8A 1O3XA 4LF9T 5DQWA 3I9WA 2DCFA 4DV5T 1MMAA 4UIGA 4WBOA 1KEYA 4JEHB 5AFMA 3TLTA 5LJNA 3UU6A 2KLQA 3JCFA 4KI0F 3ZSTA 2CXFA 2E5LT 4AKRB 2LHNA 2CBIA 2OA5A 2C5JA 3LDQB 5ABHA 4DO0A 2J47A 2ZJUA 5KDMC 3I9YA 2YDRA 3RF1A 1VOMA 2HH7A 1V9DA 2BR8A 2H88A 2ZMAA 4EZ4A 1XMOT 2IMLA 3AA1B 3ZYLA 3CK6A 1SA0E 4B3RT 3E08A 3RLFF 1T7SA 5CA1E 1OEDB 5AFJA 5FMNA 4IREA 2L8KA 5JDLA 3C4WA 2Q9QC 4DVDA 3RC3A 4YJ2E 2VQFT 2B76A 5L3DB 4YJ3E 2JIWA 3LK3B 4TUYE 2K24A 4YY3T 1D0YA 2XM1A 3RPUA 3GUAA 2WDRA 5JH7E 5AQFB 2V26A 4BJNA 1BR2A 4U2ZA 2E5VA 4ZOLE 2IUBA 5LHGB 2QC1B 4ZS3A 5EK3A 1US7B 3GA8A 4YSZA 4EV6A 4HFEA 4ZR6A 2BBHA 4OFZA 2H7VC 2I59A 2KWHA 5JDNA 3N9OA 4PJLA 2E9XB 2IW5B 4X5TA 4HKAA 3AE5A 4AKGA 2DWGA 3NWIA 5JDGA 5E0OA 3AECA 3CIRA 3WTOA 3WAJA 4TV8E 3BQLA 2M6BA 3KVAA 3GWHA 2G0UA 3V5SA 3CVRA 4QHOA 1HCIA 2CHOA 1YKEB 5BR8T 2WP9A 1S94A 1QLBA 1E2AA 1WLXA 4F8HA 5HCMA 2VURA 5LMUT 2KNDA 3K8PC 4X20E 1UUSA 2CXLA 4UVBB 4I50E 3CKDA 3WTMA 5JR9A 3PJAA 1OEDC 1FIOA 4EAHA 4JI5T 4ANJA 3WTJA 2BYNA 4IE6A 1D1BA 2JQ9A 1KF6A 5CO5A 4E7SA 3HA4A 4JI4T 3CX8B 3RIUC 2M67A 4L5GA 2BG9C 2QA7A 1I6ZA 2UZ6A 2VWAA 2UUCT 3T1HT 3WAKA 3MJXA 2E2AA 2GK9A 4ZI3D 1UV6A 5HWYA 3AE2A 4H9PC 2JQKA 4IDZA 1D0ZA 3P4QA 2JJ9A 4IE5A 3WTNA 2X51A 3IEEA 4X65T 2V6YA 4X1IE 4WBNE 3UU4A 2LKHA 2KINB 3LK2B 5LGTB 2X0YA 3EI0A 1ZOYA 5H6QB 1XNQT 5TVCA 2XAQB 2W8FA 2NTXA 2IAKA 2QVAA 3AEBA 5L3EB 1I9BA 1Y01A 3IHRA 2XQ6A 4DBMA 4EYUA 3HR0A 4DV4T 2KZ7B 5ABFB 3GN5B 3FZLB 4ZZCA 3TLUA 5AFLA 4LMKA 4JI0T 3ZYMA 3RX6A 3LJCA 3LFMA 4G2AA 3UU8A 4TWHA 3U8LA 4ILBA 3UT5E 4U7YA 5KXJA 4QXHB 4JI3T 5HYAA 3ANWB 2IC9A 4B3ST 1GQEA 5DABA 5AQGB 5AQJB 4QABA 3DTOA 5AQSB 5FY7A 3JC6D 3RYCE 4MALA 4H9OC 2Y54A 3N9NA 4UF0A 2WWVA 5HEJA 3MKDA 3C51A 3OBVE 3OVUA 5KZUA 2RPAA 3AE3A 4LF7T 4O8SA 2CM0A 3N2OA 2HHHT 4PNIA 2LOSA 2WZHA 2ES0A 1ZEEA 3MA9A 3N2GE 3RH3A 4P1NA 4JI1T 5AFUL 3EVYA 2HPJA 2K48A 2WY2A 3U8NA 2WQYA 4AQFA 2EHOA 3C98B 4YSYA 3FZKB 4ILAA 4TZ4C 4X1YE 3AEGA 3UUMA 2JMHA 4PK4A 1VCTA 5JDFA 3L3PA 5AQKB 3PJAJ 3U8KA 5CB4E 4ILCA 4JEUB 2X9XA 1N36T 2LT3A 4TWDA 3T4MA 4LF4T 2VK9A 1N32T 4AIUA 4HFCA 3MACA 5AQQB 1HNWT 5F8PA 3ESLA 4YXDA 4QX7B 2WNCA 2PJQA 5AFKA 3AE1A 3MXZA 3AAIA 2QRXA 2WB5A 3C79A 2VKOA 4ZS2A 2QYWA 3KV5A 2W00A 4HFHA 4HFIA 4YFSA 4LFCT 4GOUA 2W67A 2XNVA 4P09A 2JPFA 2X0HA 1WCRA 3Q5XA 2CBJA 2CWYA 1IAPA 3K3OA 4YSXA 5FY1A 2NP9A 4AFHA 2WM9A 4CQIA 4M1PA 2C9TA 1HR0T 2MPKA 3PURA 5BRXA 3MZKB 3UFEA 3ZCIA 3SQ6A 2VL8A 3PUVF 4ZI2D 5LYJE 1UGOA 4UY2A 1LVFA 3EDUA 2ZLYA 5AQPB 4IDNA 1T8BA 5FNVE 2JRKA 2YDQA 4XAXB 4IE7A 2WDVA 3PUYF 2D5UA 5BMVE 2WZIA 3BQIA 5M4YA 2D2SA 5FXVA 4GYSA 4IT4A 2OLTA 2YU1A 3FXDB 2Y7YA 4ZI3C 3OJAA 4ASKA 1IBLT 4DV2T 4QWNB 3FZMB 2LSYA 2N1GA 3VU7H 3DP7A 5JRCA 4KP3C 4G63A 3SOLA 2BR7A 3AB3B 3FXEB 1BR0A 1YKHB 5L3CB 4P0BA 4QXBB 3P8CD 4CXWA 1G73A 4COFA 2MBGA 2IHR1 4IE4A 4U31A 4NUUA 2HN2A 3TLSA 4WW0A 3N9LA 4YT0A 4EZ1A 2PFVA 4AI6A 2NW9A 2Q9QA 1JNRA 1FMWA 2BVLA 4U74A 4K0KT 4IL4A 1T72A 4HE8A 2LSJA 5CFBA 2P9BA 4YTPA 4B3TT 1YW0A 1UX2A 5JMEA 3Q2MA 3JADA 4PW8A 2VQET 3S4UA 3OKQA 4O4JE 4TX5A 3O4XE 2J62A 4OK0A 3AXJA 4K0UA 3SWHA 2Y57A 4JI7T 1XDOA 3L09A 4QAAA 5IWAT 4AKHA 4WZXA 1U5PA 1W0AA 3IA3A 1IBMT 4HEAA 5AFMB 3QB5K 2L9QA 4HWDA 2D0UA 2WBLA 3ZT5A 4PAGA 5GONE 4LFAT 3PUWF 4EEBA 2PH9A 5TAOA 3F31A 2BKNA 3P50A 4LFBT 4ZK1A 5FXWA 3A5XA 5AQRB 4NXNT 3PV0F 4PFOA 1UW6A 4HWHA 2W4XA 2V8SV 3P4PA 2XQ7A 3UULA 2XQ5A 2AE9A 3CMLA 3NRXA 2C5KT 2AXDS 5J5FA 3Q5EA 4PJMA 4QH5A 3KV6A 3G06A 5AQLB 3AVRA 3NZQA 4UR9A 3D0TA 4IE0A 1HTJF 4ZJTA 4JI6T 5JREA 3VR9A 2KT9A 5J2UE 2X00D 3QB5A 1LKXA 2UUBT 5L4EA 3RKOA 2WU5A 3FZHB 5FL0A 1XWMA 2A2FX 3RYHE 4O4IE 2BG9A 3ETVA 2XJ7A 5LBQB 4DV1T 3U8JA 4GYRA 4I0UA 3CX6B 4AKLA 2KWIB 5KE4A 1HS7A 5IUXA 5HAXA 2J1DG 4F6RC 4EYYR 2FJDA 3JAFA 4ISTA 2WMOA 2XYTA 3KDSE 4I4TE 3O1HA 3RIAA 4I43B 2N2NA 4X66T 4NUVA 4IHJE 1MIWA 3ZMVB 2CMRA 2W62A 4GK0E 4ZZBA 3ZDGA 4DR1T 1WYBA 3J7Yq 4LF5T 5AQTB 3KV4A 2BKPA 5HEGA 4U3CA 3HKEE 2LSKA 4WNKA 2V7JA 5JR9B 2BYQA 2NTYA 4PK5A 4QX8B 3ZYKA 2BDEA 2JQHA 4GKKT 4CN1A 4HWFA 3N9MA 2BYSA 1LRZA 1YQ4A 2X9WA 4DMWA 2XQ9A 1QUUA 3KBUA 5IHYA 5JDQA 3PU8A 2PGZA 1MMDA 5HXCA 2V1DB 4IL9A 2XHEB 4AXPA 2BKOA 3F2EA 2EHOD 1SE7A 2XTLA 1WRDA 1I94T 3BK9A 4PJJA 4LF6T 4YHJA 1J5ET 2CWOA 1NEKA 3UQ4A 4NIQA 5LNKA 2UUAT 1KNZA 3R6NA 4DUZT 3SS1A 1WFDA 2V6YB 2E9XC 2LRKA 3EUHA 5AQIB 2CE7A 2XAJB 3R84B 3Q9DA 3VKHA 1W9RA 4H63H 2MTQA 3OYZA 2IIUA 4O2AE 4HTEA 5LXTE 3AEEA 5LHHB 3AA6B 3CX7B 4CXXA 4UM1A 3UUBA 4YTNA 5LHIB 4BA9A 1KNRA 2FUPA 2CXDA 1JNZA 4OYKA 2FJBA 4UXNB 3AAAB 3MK7C 4PK6A 3PMZA 4JV5T 2BBJA 4XBFB 1XNRT 1IJ5A 5C3JA 1D1AA 3KFWX 3QUJA 4CN4A 2A72A 4JI2T 3VKGA 3VRAA 1M62A 2YEVC 4DBRA 1X9BA 4FI5A 5HWXA 4MBQA 4IDQA 2WDQA 2ZJVA 2V6XA 3ANWA 5LMNT 5L3GB 3ZJ2A 2WN9A 2VKJA 4O4HE 5J5HA 2ZM2A 4UF0B 4I55E 2KXPB 5EK2A 4AKIA 2A3DA 3AA7B 1L0VA 4IDPA 2Y8DA 4MFRA 4UELA 2UXCT 3QK6A 3B5MA 5J2TE 3ABVA 2K5BB 2EHOB 3RI5A 3LSVA 4Z90A 2W0GA 2MOZA 3NKZA 4X64T 3WTIA 4TNVA 2BG9E 1Z8UA 1XDPA 4NZBA 5AINA 4B6XA 2DL1A 3K3QC 1E1HB 4UM3S 2YMDA 1MIYA 3U8MA 1KFYA 2BS3A 2C5IT 3ZC1A 4DV7T 3C50A 5FXZA 1SHZC 5CA0E 3RRWA 4LMLA 3O1IA 4U72A 3SH1A 5KX5E 3NZPA 5HCJA 3AAEB 3DJBA 3T8OA 3SFEA 3RRCA 2LM9A 3L39A 3LBXA 3UQ7A 2WU2A 4DIDB 3EHZA 4A98A 2KMFA 3N9QA 2WNLA 1CUNA 2ACZA 3M65A 3UU5A 1BR4A 4J2CA 3FBLA 5LCYA 2DNXA 1UX5A 3IF8B 3EAMA 4CXYA 2V7MA 2UXNB 3W15B 1NWMX 2XQ3A 4TWFA 5EK4A 2YK0A 3NBXX 2PG8A 4ISSA 3FB2A 3OPCA 1XMQT 4L0RA 3C64A 1LVKA 1KNPA 4IDOA 4HN9A 3X1DA 3I1AA 3HKBE 1S35A 2XZ5A 2M6IA 1ZHCA 2XAFB 4AQFC 3F57A 1BR1A 2XYSA 2NR4A 2Y58A 4EZHA 1MMNA 3AE7A 2A9UA 2W61A 5AFNA 4QKNA 5LOVE 5JRCB 2XQ8A 4ERRA 4UV8B 3I0OA 3RQUA 4UV9B 3ZDHA 3PUGA 2VVSA 2BVMA 4HQPA 5BW2A 2ACXA 2UXDT 2V7KA 1NENA 2CRBA 2YU2A 3J9X1 4OX9T 1HG2A 1YQ3A 2XASB 4WV9A 2X9HA 2YKSA 1G8XA 2LSGA 2Q9QB 4YLHA 3RHWA 2WMNA 3C4XA 5LB7B 2F4VT 1W09A 5AQNB 4Z91A 4A56A 2DHRA 4QXCB 4A5XA 5FJVA 4HFBA 4LMJA 3CQGB 2NW8A 3SIOA 4OHFA 5F3JA 2X0LB 2FJEA 5L4HA 4DV0T 1D0XA 2V7IA 4CZZB 3AXJB 5SYOA 2LHRA 5HXRA 3RGLA 4U2YA 5HEUA 3JC6C 3K1SA 2BYRA 2LSIA 5AQMB 4NXMT 3PU3A 3GMIA 3EDVA 5HXHA 3U78A 4ADZA 4AQYT 4UXUA 2SPCA 2YOEA 5LBMA 5FYMA 2XQ4A 4KHPT 4HWCA 4KMCA 2XAGB 3AEAA 5J5GA 2LLYA 4HGAA 4KX6A 2I6HA 2RP4A 2XQAA 3P4WA 5JQGE 1FJGT 4DV6T 2WAUA 4X62T 3WI3A 4DNDA 4Z8XA 2X9YA 4H9RC 4B5DA 1CHUA 3CWZB 4DMVA 4E7ZA 1XZYA 1OEDA 3PUXF 1HX8A 2BYPA 2YMEA 2WNJA 4ZHQE 5L3FB 3P4SA 3PUAA 2D9DA 3FHNA 5LG3A 4UVAB 5AQHB 4BFQA 5DJQC 2LJLA 5AQOB 1IJ6A 3UUNA 1MNDA 2LE8A 2LKGA 3RIUA 4H9NC 3ZT7A 4PFPA 3B57A 2K3WA 2XZ6A 5CGMA 4XHEA 1NAFA 4FRRA 2BG9B 5AQVB 1OWAA 3AA0B 2XZEA 1EZ3A 3U3IA 2W66A 2BS4A 3ZSSA 5AFHA 4DR7T 3Q5DA 4ZI7E 2IC6A 5F5WA 3TLVA 4GKJT 1IBKT 3ZJ1A 2CLYB 4HFDA 2NOXA 2J4GA 5HXSA 3HL6A 3RYIE 4H63V 4EB6E 2E9XA 3ZC0A 3L8RA 5FVLA 3ZLIA 1X79A 4O2BE 4EOZB 4ZI2C 2LRLA 1HG5A 3CQCB 1R8IA 2BS2A 5AQUB 4C90A 3SFDA 1E7PA 4AFTA 4MLKA 5FVKA 3BQKA 5FL1A 3ZKRA 2W8GA 2X66A 4Q25A 1Y64B 5ABEA 1WR6A 4ZK4A 3O1JA 2H7OA 5LGNB 2LOPA 2LM2A 5BP0A 3ONJA 3RKGA 5HXEA 2XY8B 2DWKA 2IDOB 3N9PA 2XSAA 2VKDA 3ONXA 4EEDA 2MAWA 3ZMTB 3A8YC 3IBPA 3AVSA 3LK42 4KHZF 3PE0A 3VHLA 2W2UA 4DUYT 4CI2B 3VR8A 4DR5T 5L3BB 2X67A 5J5IA 2I0MA 4DR3T 1HNZT 5ABGA 4DV3T 4BJMA 5ADXL 1QSDA 3KV9A 2OV9A 3H37A 5LXBA 5JDHA 2CA5A 2X00A 3PEOA 3ZMSB 4CN6A 3ZPOA 3IGQA 2BJ0A 2CLYC 5CJ5A 3O9XA 2YINA 3UUXB 3ZCJA 1VCSA 3AE9A 3E22E 1KK7A 4QH4A 1VRBA 4N78D 3AE6A 2ZM0A 3Q5WA 4B3MT 4XK9A 1DU2A 3QOFA 2VKHA 3AE4A 4EIWA 4CI1B 2Z6EA 2VB6A 2H3RA 2CCQA 3JAEA 5A1LA 3H3MA 3CQXC 4UM3P 4IGUA 3ETUA 3PUSA 2W63A 4PIRA 3C4ZA 4GK5E 4JBWF 2CHNA 4QH1A 2DI4A 3RIFA 5JDMA 4X1KE 5ABFA 2DLRA 2FJAA 3GN5A 4HWIB 3B13A 3QC9A 5JR9C 5L47A 1WR0A 4ZRUA 4C91A 2B1EA 2Y6XA 2D0TA 1WYCA 4YHHT 4AISA 4QACA 3PUZF 4MHCA 3WIPA 4BAYB 5J0ZA
chains in the Genus database with same CATH topology
3P50A 3WTHA 4ZK1A 5J5IA 4DBMA 3C84A 3WTMA 4HFCA 3RI5A 5HEUA 2Y56A 5AFHA 4ZZCA 1OEDC 3LSVA 3TLUA 5AFLA 4LMKA 2BR7A 2YN6A 4Z90A 2XZ5A 1UW6A 2BYRA 3TLVA 2WNCA 2M6IA 5AFKA 4ZZBA 3ZDGA 4HFDA 3WTJA 4NPPA 3UU8A 2BYNA 2X00A 4UM3A 3WTIA 1OEDE 4TNVA 2XQ7A 4COFA 2BG9E 4TWHA 2XYSA 4ILBA 2XQ5A 3C79A 5CO5A 3U8LA 4UXUA 2Y58A 4NZBA 2YOEA 3TLSA 3PEOA 3RQWA 5AINA 2XQ4A 4HFHA 3GUAA 5J5FA 5HEGA 4HFIA 4BQTA 5AFNA 3IGQA 2BJ0A 4UM1A 4EZ1A 3UUBA 3TLWA 4UM3S 5J5GA 2YMDA 4QH5A 4QABA 3U8MA 2LLYA 2XNTA 2BG9C 2XQ8A 2XNVA 2BYQA 2XQAA 4QH4A 3P4WA 2UZ6A 4LMLA 3UU3A 4IL4A 2QC1B 4AFTA 4ZJTA 3RQUA 3ZDHA 5HEOA 2Y54A 4HFEA 3PMZA 4XK9A 4HQPA 3SH1A 5CFBA 4AFHA 5BW2A 4ZR6A 4TNWA 2X00D 3ZKRA 5HEJA 2W8GA 2VL0A 5HCJA 5L4EA 5AFMA 5KZUA 1UV6A 1UX2A 2C9TA 5JMEA 2BYSA 4B5DA 3TLTA 3JAEA 2KSRA 3JADA 5BRXA 3UQ7A 2XQ9A 3UU6A 4UM3P 4WV9A 3EHZA 4A98A 4ZK4A 5HEHA 2YKSA 1OEDA 4X5TA 2BG9A 4PIRA 2WNLA 2BYPA 3WTNA 2PGZA 3SQ6A 2YMEA 4UY2A 2LM2A 2WNJA 2ZJVA 3RHWA 3U8NA 4QH1A 4IL9A 5BP0A 3U8JA 3RIFA 3UU5A 5LG3A 2Y57A 4Z91A 4ILAA 4QAAA 3UU4A 4ZJSA 2LKHA 2WN9A 3WTOA 3WTLA 5L47A 2XNUA 2WZYA 2ZJUA 4BFQA 5J5HA 5KE4A 5FJVA 5IUXA 3EAMA 4HFBA 4ZRUA 3EI0A 4LMJA 2M6BA 5LXBA 2BR8A 5AFMB 2XQ3A 2MAWA 2LKGA 3SIOA 4A97A 3U8KA 3JAFA 4AFGA 4TWFA 3UQ4A 4ILCA 2W8FA 5TVCA 2XYTA 4QACA 3SQ9A 2XZ6A 4ALXA 5L4HA 4XHEA 4FRRA 2Y7YA 1OEDB 5AFJA 4TWDA 4F8HA 2BG9B 1I9BA 5HCMA 3T4MA 3WTKA 4D01A 3WIPA 2XQ6A 2PH9A 3RIAA 4IREA 5SYOA 5J0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P50 A;  3WTH A;  4ZK1 A;  5J5I A;  4DBM A;  3C84 A;  3WTM A;  4HFC A;  3RI5 A;  5HEU A;  2Y56 A;  5AFH A;  4ZZC A;  1OED C;  3LSV A;  3TLU A;  5AFL A;  4LMK A;  2BR7 A;  2YN6 A;  4Z90 A;  2XZ5 A;  1UW6 A;  2BYR A;  3TLV A;  2WNC A;  2M6I A;  5AFK A;  4ZZB A;  3ZDG A;  4HFD A;  3WTJ A;  4NPP A;  3UU8 A;  2BYN A;  2X00 A;  4UM3 A;  3WTI A;  1OED E;  4TNV A;  2XQ7 A;  4COF A;  2BG9 E;  4TWH A;  2XYS A;  4ILB A;  2XQ5 A;  3C79 A;  5CO5 A;  3U8L A;  4UXU A;  2Y58 A;  4NZB A;  2YOE A;  3TLS A;  3PEO A;  3RQW A;  5AIN A;  2XQ4 A;  4HFH A;  3GUA A;  5J5F A;  5HEG A;  4HFI A;  4BQT A;  5AFN A;  3IGQ A;  2BJ0 A;  4UM1 A;  4EZ1 A;  3UUB A;  3TLW A;  4UM3 S;  5J5G A;  2YMD A;  4QH5 A;  4QAB A;  3U8M A;  2LLY A;  2XNT A;  2BG9 C;  2XQ8 A;  2XNV A;  2BYQ A;  2XQA A;  4QH4 A;  3P4W A;  2UZ6 A;  4LML A;  3UU3 A;  4IL4 A;  2QC1 B;  4AFT A;  4ZJT A;  3RQU A;  3ZDH A;  5HEO A;  2Y54 A;  4HFE A;  3PMZ A;  4XK9 A;  4HQP A;  3SH1 A;  5CFB A;  4AFH A;  5BW2 A;  4ZR6 A;  4TNW A;  2X00 D;  3ZKR A;  5HEJ A;  2W8G A;  2VL0 A;  5HCJ A;  5L4E A;  5AFM A;  5KZU A;  1UV6 A;  1UX2 A;  2C9T A;  5JME A;  2BYS A;  4B5D A;  3TLT A;  3JAE A;  2KSR A;  3JAD A;  5BRX A;  3UQ7 A;  2XQ9 A;  3UU6 A;  4UM3 P;  4WV9 A;  3EHZ A;  4A98 A;  4ZK4 A;  5HEH A;  2YKS A;  1OED A;  4X5T A;  2BG9 A;  4PIR A;  2WNL A;  2BYP A;  3WTN A;  2PGZ A;  3SQ6 A;  2YME A;  4UY2 A;  2LM2 A;  2WNJ A;  2ZJV A;  3RHW A;  3U8N A;  4QH1 A;  4IL9 A;  5BP0 A;  3U8J A;  3RIF A;  3UU5 A;  5LG3 A;  2Y57 A;  4Z91 A;  4ILA A;  4QAA A;  3UU4 A;  4ZJS A;  2LKH A;  2WN9 A;  3WTO A;  3WTL A;  5L47 A;  2XNU A;  2WZY A;  2ZJU A;  4BFQ A;  5J5H A;  5KE4 A;  5FJV A;  5IUX A;  3EAM A;  4HFB A;  4ZRU A;  3EI0 A;  4LMJ A;  2M6B A;  5LXB A;  2BR8 A;  5AFM B;  2XQ3 A;  2MAW A;  2LKG A;  3SIO A;  4A97 A;  3U8K A;  3JAF A;  4AFG A;  4TWF A;  3UQ4 A;  4ILC A;  2W8F A;  5TVC A;  2XYT A;  4QAC A;  3SQ9 A;  2XZ6 A;  4ALX A;  5L4H A;  4XHE A;  4FRR A;  2Y7Y A;  1OED B;  5AFJ A;  4TWD A;  4F8H A;  2BG9 B;  1I9B A;  5HCM A;  3T4M A;  3WTK A;  4D01 A;  3WIP A;  2XQ6 A;  2PH9 A;  3RIA A;  4IRE A;  5SYO A;  5J0Z A; 
#chains in the Genus database with same CATH topology
 2L3L A;  4XZC A;  2Y48 B;  3C84 A;  1UX4 A;  3FBZ A;  2Y56 A;  3M3Z B;  2XSB A;  2YN6 A;  1ZKE A;  3UFG A;  3K3N A;  4NPP A;  5C2T A;  1OED E;  2UU9 T;  4DR4 T;  2JMK A;  4P0A A;  3RQW A;  3HKC E;  1FMV A;  4JI8 T;  3P4R A;  5L2L A;  4BQT A;  1HX1 B;  3ZT6 A;  1UCU A;  3ZMZ B;  3ONL C;  5ETW A;  2HPL A;  2V5C A;  2RA1 A;  4FJO A;  3H3A A;  5HEO A;  2V7L A;  4JLE A;  2VAS A;  4IIJ E;  3UTK A;  1MIV A;  5H6R B;  4LF8 T;  2UXX B;  4TNW A;  3PUQ A;  2N9D A;  1N34 T;  2KSR A;  4YTM A;  3ZN1 B;  2C0S A;  3CPZ A;  5HEH A;  1H7C A;  4JYA T;  2ZM6 T;  2Q9Q D;  2WS3 A;  4KUM B;  2CEA A;  2VVN A;  2MYS A;  2V5D A;  3QNU A;  5LG4 A;  1J5W A;  1OXZ A;  4KBM B;  3HKD E;  5FY0 A;  1SUM B;  5KMG P;  2WZY A;  4EGW A;  2K9A A;  2ODV A;  1ZP0 A;  2R6G F;  5LP6 E;  4A97 A;  3LBX B;  3P7I A;  2XPK A;  2ZM8 A;  3E0Z A;  4ZXL A;  1D1C A;  3OYX A;  1M7K A;  4V1A v;  5C8Y E;  3WTK A;  5FXX A;  1UUR A;  2WWU A;  4H9Q C;  3I0Q A;  1W0B A;  3V5U A;  1YD8 G;  1U4Q A;  5LJM A;  3VRB A;  3KBT A;  4ZEY A;  3HI2 A;  4JUY A;  2XM2 A;  5JVD E;  2XQY A;  4DBQ A;  1HNX T;  4DR6 T;  4WYV A;  3AEF A;  2XAH B;  2X68 A;  3OTO T;  3FZF B;  3ZMU B;  4UVC B;  3TLW A;  3NRY A;  2XNT A;  2YDS A;  4DR2 T;  3SRZ A;  2PBI A;  3UU3 A;  2HN1 A;  4ILU A;  2EHO C;  3A7M A;  4CI3 B;  5IYZ E;  3KVB A;  1ZV4 X;  2VL0 A;  2FBW A;  3TKL B;  5FKY A;  2BZB A;  2ODU A;  1FEW A;  1YXR A;  2H89 A;  1AJ3 A;  2CPT A;  1UK5 A;  4GIW A;  3N2K E;  5JTG A;  2LEH A;  5J1G A;  4ZJS A;  3WTL A;  4HFV A;  2XNU A;  4O4L E;  2WSS V;  1HFA A;  4TN7 B;  2NWB A;  5FP3 A;  4PJN A;  3NVO A;  1MMG A;  2QGS A;  4AFG A;  4U33 A;  3SQ9 A;  5LGU B;  4ALX A;  1B7T A;  4H9S E;  3AED A;  3T1Y T;  2E8I A;  4D01 A;  4OYJ A;  3PDY A;  3EAB A;  4UEM A;  3WTH A;  5EZY E;  5LA6 E;  2JQQ A;  1J1J A;  3RC8 A;  4L9I A;  3RYF E;  2XUE A;  3PTR B;  1MNE A;  2WCA A;  4EXT A;  3KIN B;  1T98 A;  3ZN0 B;  3AE8 A;  5DQV A;  3LG7 A;  4UM3 A;  2UXB T;  1N33 T;  2NW7 A;  2PTF A;  4U7I A;  2E9X D;  1IZN B;  4AQG A;  1Z0P A;  3ZEF B;  4TV9 E;  3N5L A;  1HF8 A;  1O3X A;  4LF9 T;  5DQW A;  3I9W A;  2DCF A;  4DV5 T;  1MMA A;  4UIG A;  4WBO A;  1KEY A;  4JEH B;  5AFM A;  3TLT A;  5LJN A;  3UU6 A;  2KLQ A;  3JCF A;  4KI0 F;  3ZST A;  2CXF A;  2E5L T;  4AKR B;  2LHN A;  2CBI A;  2OA5 A;  2C5J A;  3LDQ B;  5ABH A;  4DO0 A;  2J47 A;  2ZJU A;  5KDM C;  3I9Y A;  2YDR A;  3RF1 A;  1VOM A;  2HH7 A;  1V9D A;  2BR8 A;  2H88 A;  2ZMA A;  4EZ4 A;  1XMO T;  2IML A;  3AA1 B;  3ZYL A;  3CK6 A;  1SA0 E;  4B3R T;  3E08 A;  3RLF F;  1T7S A;  5CA1 E;  1OED B;  5AFJ A;  5FMN A;  4IRE A;  2L8K A;  5JDL A;  3C4W A;  2Q9Q C;  4DVD A;  3RC3 A;  4YJ2 E;  2VQF T;  2B76 A;  5L3D B;  4YJ3 E;  2JIW A;  3LK3 B;  4TUY E;  2K24 A;  4YY3 T;  1D0Y A;  2XM1 A;  3RPU A;  3GUA A;  2WDR A;  5JH7 E;  5AQF B;  2V26 A;  4BJN A;  1BR2 A;  4U2Z A;  2E5V A;  4ZOL E;  2IUB A;  5LHG B;  2QC1 B;  4ZS3 A;  5EK3 A;  1US7 B;  3GA8 A;  4YSZ A;  4EV6 A;  4HFE A;  4ZR6 A;  2BBH A;  4OFZ A;  2H7V C;  2I59 A;  2KWH A;  5JDN A;  3N9O A;  4PJL A;  2E9X B;  2IW5 B;  4X5T A;  4HKA A;  3AE5 A;  4AKG A;  2DWG A;  3NWI A;  5JDG A;  5E0O A;  3AEC A;  3CIR A;  3WTO A;  3WAJ A;  4TV8 E;  3BQL A;  2M6B A;  3KVA A;  3GWH A;  2G0U A;  3V5S A;  3CVR A;  4QHO A;  1HCI A;  2CHO A;  1YKE B;  5BR8 T;  2WP9 A;  1S94 A;  1QLB A;  1E2A A;  1WLX A;  4F8H A;  5HCM A;  2VUR A;  5LMU T;  2KND A;  3K8P C;  4X20 E;  1UUS A;  2CXL A;  4UVB B;  4I50 E;  3CKD A;  3WTM A;  5JR9 A;  3PJA A;  1OED C;  1FIO A;  4EAH A;  4JI5 T;  4ANJ A;  3WTJ A;  2BYN A;  4IE6 A;  1D1B A;  2JQ9 A;  1KF6 A;  5CO5 A;  4E7S A;  3HA4 A;  4JI4 T;  3CX8 B;  3RIU C;  2M67 A;  4L5G A;  2BG9 C;  2QA7 A;  1I6Z A;  2UZ6 A;  2VWA A;  2UUC T;  3T1H T;  3WAK A;  3MJX A;  2E2A A;  2GK9 A;  4ZI3 D;  1UV6 A;  5HWY A;  3AE2 A;  4H9P C;  2JQK A;  4IDZ A;  1D0Z A;  3P4Q A;  2JJ9 A;  4IE5 A;  3WTN A;  2X51 A;  3IEE A;  4X65 T;  2V6Y A;  4X1I E;  4WBN E;  3UU4 A;  2LKH A;  2KIN B;  3LK2 B;  5LGT B;  2X0Y A;  3EI0 A;  1ZOY A;  5H6Q B;  1XNQ T;  5TVC A;  2XAQ B;  2W8F A;  2NTX A;  2IAK A;  2QVA A;  3AEB A;  5L3E B;  1I9B A;  1Y01 A;  3IHR A;  2XQ6 A;  4DBM A;  4EYU A;  3HR0 A;  4DV4 T;  2KZ7 B;  5ABF B;  3GN5 B;  3FZL B;  4ZZC A;  3TLU A;  5AFL A;  4LMK A;  4JI0 T;  3ZYM A;  3RX6 A;  3LJC A;  3LFM A;  4G2A A;  3UU8 A;  4TWH A;  3U8L A;  4ILB A;  3UT5 E;  4U7Y A;  5KXJ A;  4QXH B;  4JI3 T;  5HYA A;  3ANW B;  2IC9 A;  4B3S T;  1GQE A;  5DAB A;  5AQG B;  5AQJ B;  4QAB A;  3DTO A;  5AQS B;  5FY7 A;  3JC6 D;  3RYC E;  4MAL A;  4H9O C;  2Y54 A;  3N9N A;  4UF0 A;  2WWV A;  5HEJ A;  3MKD A;  3C51 A;  3OBV E;  3OVU A;  5KZU A;  2RPA A;  3AE3 A;  4LF7 T;  4O8S A;  2CM0 A;  3N2O A;  2HHH T;  4PNI A;  2LOS A;  2WZH A;  2ES0 A;  1ZEE A;  3MA9 A;  3N2G E;  3RH3 A;  4P1N A;  4JI1 T;  5AFU L;  3EVY A;  2HPJ A;  2K48 A;  2WY2 A;  3U8N A;  2WQY A;  4AQF A;  2EHO A;  3C98 B;  4YSY A;  3FZK B;  4ILA A;  4TZ4 C;  4X1Y E;  3AEG A;  3UUM A;  2JMH A;  4PK4 A;  1VCT A;  5JDF A;  3L3P A;  5AQK B;  3PJA J;  3U8K A;  5CB4 E;  4ILC A;  4JEU B;  2X9X A;  1N36 T;  2LT3 A;  4TWD A;  3T4M A;  4LF4 T;  2VK9 A;  1N32 T;  4AIU A;  4HFC A;  3MAC A;  5AQQ B;  1HNW T;  5F8P A;  3ESL A;  4YXD A;  4QX7 B;  2WNC A;  2PJQ A;  5AFK A;  3AE1 A;  3MXZ A;  3AAI A;  2QRX A;  2WB5 A;  3C79 A;  2VKO A;  4ZS2 A;  2QYW A;  3KV5 A;  2W00 A;  4HFH A;  4HFI A;  4YFS A;  4LFC T;  4GOU A;  2W67 A;  2XNV A;  4P09 A;  2JPF A;  2X0H A;  1WCR A;  3Q5X A;  2CBJ A;  2CWY A;  1IAP A;  3K3O A;  4YSX A;  5FY1 A;  2NP9 A;  4AFH A;  2WM9 A;  4CQI A;  4M1P A;  2C9T A;  1HR0 T;  2MPK A;  3PUR A;  5BRX A;  3MZK B;  3UFE A;  3ZCI A;  3SQ6 A;  2VL8 A;  3PUV F;  4ZI2 D;  5LYJ E;  1UGO A;  4UY2 A;  1LVF A;  3EDU A;  2ZLY A;  5AQP B;  4IDN A;  1T8B A;  5FNV E;  2JRK A;  2YDQ A;  4XAX B;  4IE7 A;  2WDV A;  3PUY F;  2D5U A;  5BMV E;  2WZI A;  3BQI A;  5M4Y A;  2D2S A;  5FXV A;  4GYS A;  4IT4 A;  2OLT A;  2YU1 A;  3FXD B;  2Y7Y A;  4ZI3 C;  3OJA A;  4ASK A;  1IBL T;  4DV2 T;  4QWN B;  3FZM B;  2LSY A;  2N1G A;  3VU7 H;  3DP7 A;  5JRC A;  4KP3 C;  4G63 A;  3SOL A;  2BR7 A;  3AB3 B;  3FXE B;  1BR0 A;  1YKH B;  5L3C B;  4P0B A;  4QXB B;  3P8C D;  4CXW A;  1G73 A;  4COF A;  2MBG A;  2IHR 1;  4IE4 A;  4U31 A;  4NUU A;  2HN2 A;  3TLS A;  4WW0 A;  3N9L A;  4YT0 A;  4EZ1 A;  2PFV A;  4AI6 A;  2NW9 A;  2Q9Q A;  1JNR A;  1FMW A;  2BVL A;  4U74 A;  4K0K T;  4IL4 A;  1T72 A;  4HE8 A;  2LSJ A;  5CFB A;  2P9B A;  4YTP A;  4B3T T;  1YW0 A;  1UX2 A;  5JME A;  3Q2M A;  3JAD A;  4PW8 A;  2VQE T;  3S4U A;  3OKQ A;  4O4J E;  4TX5 A;  3O4X E;  2J62 A;  4OK0 A;  3AXJ A;  4K0U A;  3SWH A;  2Y57 A;  4JI7 T;  1XDO A;  3L09 A;  4QAA A;  5IWA T;  4AKH A;  4WZX A;  1U5P A;  1W0A A;  3IA3 A;  1IBM T;  4HEA A;  5AFM B;  3QB5 K;  2L9Q A;  4HWD A;  2D0U A;  2WBL A;  3ZT5 A;  4PAG A;  5GON E;  4LFA T;  3PUW F;  4EEB A;  2PH9 A;  5TAO A;  3F31 A;  2BKN A;  3P50 A;  4LFB T;  4ZK1 A;  5FXW A;  3A5X A;  5AQR B;  4NXN T;  3PV0 F;  4PFO A;  1UW6 A;  4HWH A;  2W4X A;  2V8S V;  3P4P A;  2XQ7 A;  3UUL A;  2XQ5 A;  2AE9 A;  3CML A;  3NRX A;  2C5K T;  2AXD S;  5J5F A;  3Q5E A;  4PJM A;  4QH5 A;  3KV6 A;  3G06 A;  5AQL B;  3AVR A;  3NZQ A;  4UR9 A;  3D0T A;  4IE0 A;  1HTJ F;  4ZJT A;  4JI6 T;  5JRE A;  3VR9 A;  2KT9 A;  5J2U E;  2X00 D;  3QB5 A;  1LKX A;  2UUB T;  5L4E A;  3RKO A;  2WU5 A;  3FZH B;  5FL0 A;  1XWM A;  2A2F X;  3RYH E;  4O4I E;  2BG9 A;  3ETV A;  2XJ7 A;  5LBQ B;  4DV1 T;  3U8J A;  4GYR A;  4I0U A;  3CX6 B;  4AKL A;  2KWI B;  5KE4 A;  1HS7 A;  5IUX A;  5HAX A;  2J1D G;  4F6R C;  4EYY R;  2FJD A;  3JAF A;  4IST A;  2WMO A;  2XYT A;  3KDS E;  4I4T E;  3O1H A;  3RIA A;  4I43 B;  2N2N A;  4X66 T;  4NUV A;  4IHJ E;  1MIW A;  3ZMV B;  2CMR A;  2W62 A;  4GK0 E;  4ZZB A;  3ZDG A;  4DR1 T;  1WYB A;  3J7Y q;  4LF5 T;  5AQT B;  3KV4 A;  2BKP A;  5HEG A;  4U3C A;  3HKE E;  2LSK A;  4WNK A;  2V7J A;  5JR9 B;  2BYQ A;  2NTY A;  4PK5 A;  4QX8 B;  3ZYK A;  2BDE A;  2JQH A;  4GKK T;  4CN1 A;  4HWF A;  3N9M A;  2BYS A;  1LRZ A;  1YQ4 A;  2X9W A;  4DMW A;  2XQ9 A;  1QUU A;  3KBU A;  5IHY A;  5JDQ A;  3PU8 A;  2PGZ A;  1MMD A;  5HXC A;  2V1D B;  4IL9 A;  2XHE B;  4AXP A;  2BKO A;  3F2E A;  2EHO D;  1SE7 A;  2XTL A;  1WRD A;  1I94 T;  3BK9 A;  4PJJ A;  4LF6 T;  4YHJ A;  1J5E T;  2CWO A;  1NEK A;  3UQ4 A;  4NIQ A;  5LNK A;  2UUA T;  1KNZ A;  3R6N A;  4DUZ T;  3SS1 A;  1WFD A;  2V6Y B;  2E9X C;  2LRK A;  3EUH A;  5AQI B;  2CE7 A;  2XAJ B;  3R84 B;  3Q9D A;  3VKH A;  1W9R A;  4H63 H;  2MTQ A;  3OYZ A;  2IIU A;  4O2A E;  4HTE A;  5LXT E;  3AEE A;  5LHH B;  3AA6 B;  3CX7 B;  4CXX A;  4UM1 A;  3UUB A;  4YTN A;  5LHI B;  4BA9 A;  1KNR A;  2FUP A;  2CXD A;  1JNZ A;  4OYK A;  2FJB A;  4UXN B;  3AAA B;  3MK7 C;  4PK6 A;  3PMZ A;  4JV5 T;  2BBJ A;  4XBF B;  1XNR T;  1IJ5 A;  5C3J A;  1D1A A;  3KFW X;  3QUJ A;  4CN4 A;  2A72 A;  4JI2 T;  3VKG A;  3VRA A;  1M62 A;  2YEV C;  4DBR A;  1X9B A;  4FI5 A;  5HWX A;  4MBQ A;  4IDQ A;  2WDQ A;  2ZJV A;  2V6X A;  3ANW A;  5LMN T;  5L3G B;  3ZJ2 A;  2WN9 A;  2VKJ A;  4O4H E;  5J5H A;  2ZM2 A;  4UF0 B;  4I55 E;  2KXP B;  5EK2 A;  4AKI A;  2A3D A;  3AA7 B;  1L0V A;  4IDP A;  2Y8D A;  4MFR A;  4UEL A;  2UXC T;  3QK6 A;  3B5M A;  5J2T E;  3ABV A;  2K5B B;  2EHO B;  3RI5 A;  3LSV A;  4Z90 A;  2W0G A;  2MOZ A;  3NKZ A;  4X64 T;  3WTI A;  4TNV A;  2BG9 E;  1Z8U A;  1XDP A;  4NZB A;  5AIN A;  4B6X A;  2DL1 A;  3K3Q C;  1E1H B;  4UM3 S;  2YMD A;  1MIY A;  3U8M A;  1KFY A;  2BS3 A;  2C5I T;  3ZC1 A;  4DV7 T;  3C50 A;  5FXZ A;  1SHZ C;  5CA0 E;  3RRW A;  4LML A;  3O1I A;  4U72 A;  3SH1 A;  5KX5 E;  3NZP A;  5HCJ A;  3AAE B;  3DJB A;  3T8O A;  3SFE A;  3RRC A;  2LM9 A;  3L39 A;  3LBX A;  3UQ7 A;  2WU2 A;  4DID B;  3EHZ A;  4A98 A;  2KMF A;  3N9Q A;  2WNL A;  1CUN A;  2ACZ A;  3M65 A;  3UU5 A;  1BR4 A;  4J2C A;  3FBL A;  5LCY A;  2DNX A;  1UX5 A;  3IF8 B;  3EAM A;  4CXY A;  2V7M A;  2UXN B;  3W15 B;  1NWM X;  2XQ3 A;  4TWF A;  5EK4 A;  2YK0 A;  3NBX X;  2PG8 A;  4ISS A;  3FB2 A;  3OPC A;  1XMQ T;  4L0R A;  3C64 A;  1LVK A;  1KNP A;  4IDO A;  4HN9 A;  3X1D A;  3I1A A;  3HKB E;  1S35 A;  2XZ5 A;  2M6I A;  1ZHC A;  2XAF B;  4AQF C;  3F57 A;  1BR1 A;  2XYS A;  2NR4 A;  2Y58 A;  4EZH A;  1MMN A;  3AE7 A;  2A9U A;  2W61 A;  5AFN A;  4QKN A;  5LOV E;  5JRC B;  2XQ8 A;  4ERR A;  4UV8 B;  3I0O A;  3RQU A;  4UV9 B;  3ZDH A;  3PUG A;  2VVS A;  2BVM A;  4HQP A;  5BW2 A;  2ACX A;  2UXD T;  2V7K A;  1NEN A;  2CRB A;  2YU2 A;  3J9X 1;  4OX9 T;  1HG2 A;  1YQ3 A;  2XAS B;  4WV9 A;  2X9H A;  2YKS A;  1G8X A;  2LSG A;  2Q9Q B;  4YLH A;  3RHW A;  2WMN A;  3C4X A;  5LB7 B;  2F4V T;  1W09 A;  5AQN B;  4Z91 A;  4A56 A;  2DHR A;  4QXC B;  4A5X A;  5FJV A;  4HFB A;  4LMJ A;  3CQG B;  2NW8 A;  3SIO A;  4OHF A;  5F3J A;  2X0L B;  2FJE A;  5L4H A;  4DV0 T;  1D0X A;  2V7I A;  4CZZ B;  3AXJ B;  5SYO A;  2LHR A;  5HXR A;  3RGL A;  4U2Y A;  5HEU A;  3JC6 C;  3K1S A;  2BYR A;  2LSI A;  5AQM B;  4NXM T;  3PU3 A;  3GMI A;  3EDV A;  5HXH A;  3U78 A;  4ADZ A;  4AQY T;  4UXU A;  2SPC A;  2YOE A;  5LBM A;  5FYM A;  2XQ4 A;  4KHP T;  4HWC A;  4KMC A;  2XAG B;  3AEA A;  5J5G A;  2LLY A;  4HGA A;  4KX6 A;  2I6H A;  2RP4 A;  2XQA A;  3P4W A;  5JQG E;  1FJG T;  4DV6 T;  2WAU A;  4X62 T;  3WI3 A;  4DND A;  4Z8X A;  2X9Y A;  4H9R C;  4B5D A;  1CHU A;  3CWZ B;  4DMV A;  4E7Z A;  1XZY A;  1OED A;  3PUX F;  1HX8 A;  2BYP A;  2YME A;  2WNJ A;  4ZHQ E;  5L3F B;  3P4S A;  3PUA A;  2D9D A;  3FHN A;  5LG3 A;  4UVA B;  5AQH B;  4BFQ A;  5DJQ C;  2LJL A;  5AQO B;  1IJ6 A;  3UUN A;  1MND A;  2LE8 A;  2LKG A;  3RIU A;  4H9N C;  3ZT7 A;  4PFP A;  3B57 A;  2K3W A;  2XZ6 A;  5CGM A;  4XHE A;  1NAF A;  4FRR A;  2BG9 B;  5AQV B;  1OWA A;  3AA0 B;  2XZE A;  1EZ3 A;  3U3I A;  2W66 A;  2BS4 A;  3ZSS A;  5AFH A;  4DR7 T;  3Q5D A;  4ZI7 E;  2IC6 A;  5F5W A;  3TLV A;  4GKJ T;  1IBK T;  3ZJ1 A;  2CLY B;  4HFD A;  2NOX A;  2J4G A;  5HXS A;  3HL6 A;  3RYI E;  4H63 V;  4EB6 E;  2E9X A;  3ZC0 A;  3L8R A;  5FVL A;  3ZLI A;  1X79 A;  4O2B E;  4EOZ B;  4ZI2 C;  2LRL A;  1HG5 A;  3CQC B;  1R8I A;  2BS2 A;  5AQU B;  4C90 A;  3SFD A;  1E7P A;  4AFT A;  4MLK A;  5FVK A;  3BQK A;  5FL1 A;  3ZKR A;  2W8G A;  2X66 A;  4Q25 A;  1Y64 B;  5ABE A;  1WR6 A;  4ZK4 A;  3O1J A;  2H7O A;  5LGN B;  2LOP A;  2LM2 A;  5BP0 A;  3ONJ A;  3RKG A;  5HXE A;  2XY8 B;  2DWK A;  2IDO B;  3N9P A;  2XSA A;  2VKD A;  3ONX A;  4EED A;  2MAW A;  3ZMT B;  3A8Y C;  3IBP A;  3AVS A;  3LK4 2;  4KHZ F;  3PE0 A;  3VHL A;  2W2U A;  4DUY T;  4CI2 B;  3VR8 A;  4DR5 T;  5L3B B;  2X67 A;  5J5I A;  2I0M A;  4DR3 T;  1HNZ T;  5ABG A;  4DV3 T;  4BJM A;  5ADX L;  1QSD A;  3KV9 A;  2OV9 A;  3H37 A;  5LXB A;  5JDH A;  2CA5 A;  2X00 A;  3PEO A;  3ZMS B;  4CN6 A;  3ZPO A;  3IGQ A;  2BJ0 A;  2CLY C;  5CJ5 A;  3O9X A;  2YIN A;  3UUX B;  3ZCJ A;  1VCS A;  3AE9 A;  3E22 E;  1KK7 A;  4QH4 A;  1VRB A;  4N78 D;  3AE6 A;  2ZM0 A;  3Q5W A;  4B3M T;  4XK9 A;  1DU2 A;  3QOF A;  2VKH A;  3AE4 A;  4EIW A;  4CI1 B;  2Z6E A;  2VB6 A;  2H3R A;  2CCQ A;  3JAE A;  5A1L A;  3H3M A;  3CQX C;  4UM3 P;  4IGU A;  3ETU A;  3PUS A;  2W63 A;  4PIR A;  3C4Z A;  4GK5 E;  4JBW F;  2CHN A;  4QH1 A;  2DI4 A;  3RIF A;  5JDM A;  4X1K E;  5ABF A;  2DLR A;  2FJA A;  3GN5 A;  4HWI B;  3B13 A;  3QC9 A;  5JR9 C;  5L47 A;  1WR0 A;  4ZRU A;  4C91 A;  2B1E A;  2Y6X A;  2D0T A;  1WYC A;  4YHH T;  4AIS A;  4QAC A;  3PUZ F;  4MHC A;  3WIP A;  4BAY B;  5J0Z A; 
#chains in the Genus database with same CATH homology
 3P50 A;  3WTH A;  4ZK1 A;  5J5I A;  4DBM A;  3C84 A;  3WTM A;  4HFC A;  3RI5 A;  5HEU A;  2Y56 A;  5AFH A;  4ZZC A;  1OED C;  3LSV A;  3TLU A;  5AFL A;  4LMK A;  2BR7 A;  2YN6 A;  4Z90 A;  2XZ5 A;  1UW6 A;  2BYR A;  3TLV A;  2WNC A;  2M6I A;  5AFK A;  4ZZB A;  3ZDG A;  4HFD A;  3WTJ A;  4NPP A;  3UU8 A;  2BYN A;  2X00 A;  4UM3 A;  3WTI A;  1OED E;  4TNV A;  2XQ7 A;  4COF A;  2BG9 E;  4TWH A;  2XYS A;  4ILB A;  2XQ5 A;  3C79 A;  5CO5 A;  3U8L A;  4UXU A;  2Y58 A;  4NZB A;  2YOE A;  3TLS A;  3PEO A;  3RQW A;  5AIN A;  2XQ4 A;  4HFH A;  3GUA A;  5J5F A;  5HEG A;  4HFI A;  4BQT A;  5AFN A;  3IGQ A;  2BJ0 A;  4UM1 A;  4EZ1 A;  3UUB A;  3TLW A;  4UM3 S;  5J5G A;  2YMD A;  4QH5 A;  4QAB A;  3U8M A;  2LLY A;  2XNT A;  2BG9 C;  2XQ8 A;  2XNV A;  2BYQ A;  2XQA A;  4QH4 A;  3P4W A;  2UZ6 A;  4LML A;  3UU3 A;  4IL4 A;  2QC1 B;  4AFT A;  4ZJT A;  3RQU A;  3ZDH A;  5HEO A;  2Y54 A;  4HFE A;  3PMZ A;  4XK9 A;  4HQP A;  3SH1 A;  5CFB A;  4AFH A;  5BW2 A;  4ZR6 A;  4TNW A;  2X00 D;  3ZKR A;  5HEJ A;  2W8G A;  2VL0 A;  5HCJ A;  5L4E A;  5AFM A;  5KZU A;  1UV6 A;  1UX2 A;  2C9T A;  5JME A;  2BYS A;  4B5D A;  3TLT A;  3JAE A;  2KSR A;  3JAD A;  5BRX A;  3UQ7 A;  2XQ9 A;  3UU6 A;  4UM3 P;  4WV9 A;  3EHZ A;  4A98 A;  4ZK4 A;  5HEH A;  2YKS A;  1OED A;  4X5T A;  2BG9 A;  4PIR A;  2WNL A;  2BYP A;  3WTN A;  2PGZ A;  3SQ6 A;  2YME A;  4UY2 A;  2LM2 A;  2WNJ A;  2ZJV A;  3RHW A;  3U8N A;  4QH1 A;  4IL9 A;  5BP0 A;  3U8J A;  3RIF A;  3UU5 A;  5LG3 A;  2Y57 A;  4Z91 A;  4ILA A;  4QAA A;  3UU4 A;  4ZJS A;  2LKH A;  2WN9 A;  3WTO A;  3WTL A;  5L47 A;  2XNU A;  2WZY A;  2ZJU A;  4BFQ A;  5J5H A;  5KE4 A;  5FJV A;  5IUX A;  3EAM A;  4HFB A;  4ZRU A;  3EI0 A;  4LMJ A;  2M6B A;  5LXB A;  2BR8 A;  5AFM B;  2XQ3 A;  2MAW A;  2LKG A;  3SIO A;  4A97 A;  3U8K A;  3JAF A;  4AFG A;  4TWF A;  3UQ4 A;  4ILC A;  2W8F A;  5TVC A;  2XYT A;  4QAC A;  3SQ9 A;  2XZ6 A;  4ALX A;  5L4H A;  4XHE A;  4FRR A;  2Y7Y A;  1OED B;  5AFJ A;  4TWD A;  4F8H A;  2BG9 B;  1I9B A;  5HCM A;  3T4M A;  3WTK A;  4D01 A;  3WIP A;  2XQ6 A;  2PH9 A;  3RIA A;  4IRE A;  5SYO A;  5J0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...