3IGQA

Crystal structure of the extracellular domain of a bacterial pentameric ligand-gated ion channel
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
190
structure length
176
Chain Sequence
MVSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPLESKLDYQLRISRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title Crystal structure of the extracellular domain of a bacterial ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 35
structure length 176
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3igqA00
3ZDHA 2XQ9A 3UU5A 2WNLA 4ZRUA 3P4WA 3UU8A 2Y56A 5HEGA 5SYOA 3WTOA 2XQ8A 2BG9C 2C9TA 3RQUA 4EZ1A 5BP0A 3LSVA 2WN9A 5LG3A 2BYPA 5HEJA 4ZJTA 3ZDGA 5AFLA 5JMEA 3TLSA 4UXUA 5J5GA 2QC1B 2ZJUA 3WTLA 3WTIA 4HFEA 4UM3P 5TVCA 2XQAA 3IGQA 1I9BA 4AFTA 4TWFA 4Z91A 3UUBA 4ZZBA 4QAAA 3JAEA 3TLVA 4WV9A 3TLUA 2X00D 4BFQA 5L47A 4PIRA 2Y57A 3PEOA 2XYTA 4HQPA 4UY2A 3RHWA 4B5DA 4NPPA 2BR7A 3P50A 4ILAA 4HFHA 2WNJA 3U8MA 4UM3S 5AINA 3RQWA 5BW2A 5CO5A 2XZ6A 3U8JA 1UW6A 4AFHA 2BR8A 5AFNA 5HCJA 1UX2A 2WZYA 4HFCA 2W8FA 4D01A 2PH9A 2XQ7A 5L4HA 4DBMA 4ZK1A 5IUXA 4ZJSA 2YKSA 4LMJA 3SQ9A 3UQ7A 5J0ZA 3RIFA 1UV6A 4ALXA 5J5FA 2BYRA 5LXBA 2XQ3A 2BG9E 3RIAA 4AFGA 2PGZA 5KE4A 5HCMA 4QH4A 2Y54A 2YMEA 4LMKA 3WTMA 3WTKA 3WTJA 4NZBA 4A98A 5HEOA 3TLTA 2BG9B 4XHEA 5BRXA 5L4EA 3SQ6A 4X5TA 4HFIA 4Z90A 3UQ4A 4TNWA 3UU4A 4XK9A 2YOEA 2WNCA 5HEHA 4UM3A 3SH1A 2BJ0A 3UU6A 5HEUA 5FJVA 3WIPA 4QABA 4UM1A 4BQTA 2VL0A 4F8HA 4IREA 4TWHA 3SIOA 5KZUA 2W8GA 3JAFA 3JADA 2Y58A 4FRRA 4HFDA 4IL9A 4LMLA 2ZJVA 4A97A 5AFKA 2Y7YA 3WTNA 2XNVA 2BG9A 3T4MA 2BYQA 3U8LA 2XYSA 3EAMA 3EHZA 5AFHA 5J5HA 3C84A 2XQ6A 4HFBA 4COFA 4TNVA 2X00A 2XQ4A 4QACA 4ILBA 2BYSA 3U8KA 3ZKRA 4ILCA 4ZZCA 3GUAA 3U8NA 2YMDA 2YN6A 3WTHA 2XNUA 3C79A 3EI0A 3PMZA 4ZR6A 3UU3A 4QH1A 4TWDA 3TLWA 4ZK4A 2UZ6A 5J5IA 2BYNA 2XZ5A 3RI5A 5AFMB 2XNTA 5CFBA 5AFMA 4QH5A 5AFJA 2XQ5A 4IL4A
chains in the Genus database with same CATH superfamily
3ZDHA 2XQ9A 3UU5A 2WNLA 4ZRUA 3P4WA 3UU8A 2Y56A 5HEGA 5SYOA 3WTOA 2XQ8A 2BG9C 2C9TA 3RQUA 4EZ1A 5BP0A 3LSVA 2WN9A 5LG3A 2BYPA 5HEJA 4ZJTA 3ZDGA 5AFLA 5JMEA 3TLSA 4UXUA 5J5GA 2QC1B 2ZJUA 3WTLA 3WTIA 4HFEA 4UM3P 5TVCA 2XQAA 3IGQA 1I9BA 4AFTA 4TWFA 4Z91A 3UUBA 4ZZBA 4QAAA 3JAEA 3TLVA 4WV9A 3TLUA 2X00D 4BFQA 5L47A 4PIRA 2Y57A 3PEOA 2XYTA 4HQPA 4UY2A 3RHWA 4B5DA 4NPPA 2BR7A 3P50A 4ILAA 4HFHA 2WNJA 3U8MA 4UM3S 5AINA 3RQWA 5BW2A 5CO5A 2XZ6A 3U8JA 1UW6A 4AFHA 2BR8A 5AFNA 5HCJA 1UX2A 2WZYA 4HFCA 2W8FA 4D01A 2PH9A 2XQ7A 5L4HA 4DBMA 4ZK1A 5IUXA 4ZJSA 2YKSA 4LMJA 3SQ9A 3UQ7A 5J0ZA 3RIFA 1UV6A 4ALXA 5J5FA 2BYRA 5LXBA 2XQ3A 2BG9E 3RIAA 4AFGA 2PGZA 5KE4A 5HCMA 4QH4A 2Y54A 2YMEA 4LMKA 3WTMA 3WTKA 3WTJA 4NZBA 4A98A 5HEOA 3TLTA 2BG9B 4XHEA 5BRXA 5L4EA 3SQ6A 4X5TA 4HFIA 4Z90A 3UQ4A 4TNWA 3UU4A 4XK9A 2YOEA 2WNCA 5HEHA 4UM3A 3SH1A 2BJ0A 3UU6A 5HEUA 5FJVA 3WIPA 4QABA 4UM1A 4BQTA 2VL0A 4F8HA 4IREA 4TWHA 3SIOA 5KZUA 2W8GA 3JAFA 3JADA 2Y58A 4FRRA 4HFDA 4IL9A 4LMLA 2ZJVA 4A97A 5AFKA 2Y7YA 3WTNA 2XNVA 2BG9A 3T4MA 2BYQA 3U8LA 2XYSA 3EAMA 3EHZA 5AFHA 5J5HA 3C84A 2XQ6A 4HFBA 4COFA 4TNVA 2X00A 2XQ4A 4QACA 4ILBA 2BYSA 3U8KA 3ZKRA 4ILCA 4ZZCA 3GUAA 3U8NA 2YMDA 2YN6A 3WTHA 2XNUA 3C79A 3EI0A 3PMZA 4ZR6A 3UU3A 4QH1A 4TWDA 3TLWA 4ZK4A 2UZ6A 5J5IA 2BYNA 2XZ5A 3RI5A 5AFMB 2XNTA 5CFBA 5AFMA 4QH5A 5AFJA 2XQ5A 4IL4A
chains in the Genus database with same CATH topology
3ZDHA 2XQ9A 3UU5A 2WNLA 4ZRUA 3P4WA 3UU8A 2Y56A 5HEGA 5SYOA 3WTOA 2XQ8A 2BG9C 2C9TA 3RQUA 4EZ1A 5BP0A 3LSVA 2WN9A 5LG3A 2BYPA 5HEJA 4ZJTA 3ZDGA 5AFLA 5JMEA 3TLSA 4UXUA 5J5GA 2QC1B 2ZJUA 3WTLA 3WTIA 4HFEA 4UM3P 5TVCA 2XQAA 3IGQA 1I9BA 4AFTA 4TWFA 4Z91A 3UUBA 4ZZBA 4QAAA 3JAEA 3TLVA 4WV9A 3TLUA 2X00D 4BFQA 5L47A 4PIRA 2Y57A 3PEOA 2XYTA 4HQPA 4UY2A 3RHWA 4B5DA 4NPPA 2BR7A 3P50A 4ILAA 4HFHA 2WNJA 3U8MA 4UM3S 5AINA 3RQWA 5BW2A 5CO5A 2XZ6A 3U8JA 1UW6A 4AFHA 2BR8A 5AFNA 5HCJA 1UX2A 2WZYA 4HFCA 2W8FA 4D01A 2PH9A 2XQ7A 5L4HA 4DBMA 4ZK1A 5IUXA 4ZJSA 2YKSA 4LMJA 3SQ9A 3UQ7A 5J0ZA 3RIFA 1UV6A 4ALXA 5J5FA 2BYRA 5LXBA 2XQ3A 2BG9E 3RIAA 4AFGA 2PGZA 5KE4A 5HCMA 4QH4A 2Y54A 2YMEA 4LMKA 3WTMA 3WTKA 3WTJA 4NZBA 4A98A 5HEOA 3TLTA 2BG9B 4XHEA 5BRXA 5L4EA 3SQ6A 4X5TA 4HFIA 4Z90A 3UQ4A 4TNWA 3UU4A 4XK9A 2YOEA 2WNCA 5HEHA 4UM3A 3SH1A 2BJ0A 3UU6A 5HEUA 5FJVA 3WIPA 4QABA 4UM1A 4BQTA 2VL0A 4F8HA 4IREA 4TWHA 3SIOA 5KZUA 2W8GA 3JAFA 3JADA 2Y58A 4FRRA 4HFDA 4IL9A 4LMLA 2ZJVA 4A97A 5AFKA 2Y7YA 3WTNA 2XNVA 2BG9A 3T4MA 2BYQA 3U8LA 2XYSA 3EAMA 3EHZA 5AFHA 5J5HA 3C84A 2XQ6A 4HFBA 4COFA 4TNVA 2X00A 2XQ4A 4QACA 4ILBA 2BYSA 3U8KA 3ZKRA 4ILCA 4ZZCA 3GUAA 3U8NA 2YMDA 2YN6A 3WTHA 2XNUA 3C79A 3EI0A 3PMZA 4ZR6A 3UU3A 4QH1A 4TWDA 3TLWA 4ZK4A 2UZ6A 5J5IA 2BYNA 2XZ5A 3RI5A 5AFMB 2XNTA 5CFBA 5AFMA 4QH5A 5AFJA 2XQ5A 4IL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDH A;  2XQ9 A;  3UU5 A;  2WNL A;  4ZRU A;  3P4W A;  3UU8 A;  2Y56 A;  5HEG A;  5SYO A;  3WTO A;  2XQ8 A;  2BG9 C;  2C9T A;  3RQU A;  4EZ1 A;  5BP0 A;  3LSV A;  2WN9 A;  5LG3 A;  2BYP A;  5HEJ A;  4ZJT A;  3ZDG A;  5AFL A;  5JME A;  3TLS A;  4UXU A;  5J5G A;  2QC1 B;  2ZJU A;  3WTL A;  3WTI A;  4HFE A;  4UM3 P;  5TVC A;  2XQA A;  3IGQ A;  1I9B A;  4AFT A;  4TWF A;  4Z91 A;  3UUB A;  4ZZB A;  4QAA A;  3JAE A;  3TLV A;  4WV9 A;  3TLU A;  2X00 D;  4BFQ A;  5L47 A;  4PIR A;  2Y57 A;  3PEO A;  2XYT A;  4HQP A;  4UY2 A;  3RHW A;  4B5D A;  4NPP A;  2BR7 A;  3P50 A;  4ILA A;  4HFH A;  2WNJ A;  3U8M A;  4UM3 S;  5AIN A;  3RQW A;  5BW2 A;  5CO5 A;  2XZ6 A;  3U8J A;  1UW6 A;  4AFH A;  2BR8 A;  5AFN A;  5HCJ A;  1UX2 A;  2WZY A;  4HFC A;  2W8F A;  4D01 A;  2PH9 A;  2XQ7 A;  5L4H A;  4DBM A;  4ZK1 A;  5IUX A;  4ZJS A;  2YKS A;  4LMJ A;  3SQ9 A;  3UQ7 A;  5J0Z A;  3RIF A;  1UV6 A;  4ALX A;  5J5F A;  2BYR A;  5LXB A;  2XQ3 A;  2BG9 E;  3RIA A;  4AFG A;  2PGZ A;  5KE4 A;  5HCM A;  4QH4 A;  2Y54 A;  2YME A;  4LMK A;  3WTM A;  3WTK A;  3WTJ A;  4NZB A;  4A98 A;  5HEO A;  3TLT A;  2BG9 B;  4XHE A;  5BRX A;  5L4E A;  3SQ6 A;  4X5T A;  4HFI A;  4Z90 A;  3UQ4 A;  4TNW A;  3UU4 A;  4XK9 A;  2YOE A;  2WNC A;  5HEH A;  4UM3 A;  3SH1 A;  2BJ0 A;  3UU6 A;  5HEU A;  5FJV A;  3WIP A;  4QAB A;  4UM1 A;  4BQT A;  2VL0 A;  4F8H A;  4IRE A;  4TWH A;  3SIO A;  5KZU A;  2W8G A;  3JAF A;  3JAD A;  2Y58 A;  4FRR A;  4HFD A;  4IL9 A;  4LML A;  2ZJV A;  4A97 A;  5AFK A;  2Y7Y A;  3WTN A;  2XNV A;  2BG9 A;  3T4M A;  2BYQ A;  3U8L A;  2XYS A;  3EAM A;  3EHZ A;  5AFH A;  5J5H A;  3C84 A;  2XQ6 A;  4HFB A;  4COF A;  4TNV A;  2X00 A;  2XQ4 A;  4QAC A;  4ILB A;  2BYS A;  3U8K A;  3ZKR A;  4ILC A;  4ZZC A;  3GUA A;  3U8N A;  2YMD A;  2YN6 A;  3WTH A;  2XNU A;  3C79 A;  3EI0 A;  3PMZ A;  4ZR6 A;  3UU3 A;  4QH1 A;  4TWD A;  3TLW A;  4ZK4 A;  2UZ6 A;  5J5I A;  2BYN A;  2XZ5 A;  3RI5 A;  5AFM B;  2XNT A;  5CFB A;  5AFM A;  4QH5 A;  5AFJ A;  2XQ5 A;  4IL4 A; 
#chains in the Genus database with same CATH topology
 3ZDH A;  2XQ9 A;  3UU5 A;  2WNL A;  4ZRU A;  3P4W A;  3UU8 A;  2Y56 A;  5HEG A;  5SYO A;  3WTO A;  2XQ8 A;  2BG9 C;  2C9T A;  3RQU A;  4EZ1 A;  5BP0 A;  3LSV A;  2WN9 A;  5LG3 A;  2BYP A;  5HEJ A;  4ZJT A;  3ZDG A;  5AFL A;  5JME A;  3TLS A;  4UXU A;  5J5G A;  2QC1 B;  2ZJU A;  3WTL A;  3WTI A;  4HFE A;  4UM3 P;  5TVC A;  2XQA A;  3IGQ A;  1I9B A;  4AFT A;  4TWF A;  4Z91 A;  3UUB A;  4ZZB A;  4QAA A;  3JAE A;  3TLV A;  4WV9 A;  3TLU A;  2X00 D;  4BFQ A;  5L47 A;  4PIR A;  2Y57 A;  3PEO A;  2XYT A;  4HQP A;  4UY2 A;  3RHW A;  4B5D A;  4NPP A;  2BR7 A;  3P50 A;  4ILA A;  4HFH A;  2WNJ A;  3U8M A;  4UM3 S;  5AIN A;  3RQW A;  5BW2 A;  5CO5 A;  2XZ6 A;  3U8J A;  1UW6 A;  4AFH A;  2BR8 A;  5AFN A;  5HCJ A;  1UX2 A;  2WZY A;  4HFC A;  2W8F A;  4D01 A;  2PH9 A;  2XQ7 A;  5L4H A;  4DBM A;  4ZK1 A;  5IUX A;  4ZJS A;  2YKS A;  4LMJ A;  3SQ9 A;  3UQ7 A;  5J0Z A;  3RIF A;  1UV6 A;  4ALX A;  5J5F A;  2BYR A;  5LXB A;  2XQ3 A;  2BG9 E;  3RIA A;  4AFG A;  2PGZ A;  5KE4 A;  5HCM A;  4QH4 A;  2Y54 A;  2YME A;  4LMK A;  3WTM A;  3WTK A;  3WTJ A;  4NZB A;  4A98 A;  5HEO A;  3TLT A;  2BG9 B;  4XHE A;  5BRX A;  5L4E A;  3SQ6 A;  4X5T A;  4HFI A;  4Z90 A;  3UQ4 A;  4TNW A;  3UU4 A;  4XK9 A;  2YOE A;  2WNC A;  5HEH A;  4UM3 A;  3SH1 A;  2BJ0 A;  3UU6 A;  5HEU A;  5FJV A;  3WIP A;  4QAB A;  4UM1 A;  4BQT A;  2VL0 A;  4F8H A;  4IRE A;  4TWH A;  3SIO A;  5KZU A;  2W8G A;  3JAF A;  3JAD A;  2Y58 A;  4FRR A;  4HFD A;  4IL9 A;  4LML A;  2ZJV A;  4A97 A;  5AFK A;  2Y7Y A;  3WTN A;  2XNV A;  2BG9 A;  3T4M A;  2BYQ A;  3U8L A;  2XYS A;  3EAM A;  3EHZ A;  5AFH A;  5J5H A;  3C84 A;  2XQ6 A;  4HFB A;  4COF A;  4TNV A;  2X00 A;  2XQ4 A;  4QAC A;  4ILB A;  2BYS A;  3U8K A;  3ZKR A;  4ILC A;  4ZZC A;  3GUA A;  3U8N A;  2YMD A;  2YN6 A;  3WTH A;  2XNU A;  3C79 A;  3EI0 A;  3PMZ A;  4ZR6 A;  3UU3 A;  4QH1 A;  4TWD A;  3TLW A;  4ZK4 A;  2UZ6 A;  5J5I A;  2BYN A;  2XZ5 A;  3RI5 A;  5AFM B;  2XNT A;  5CFB A;  5AFM A;  4QH5 A;  5AFJ A;  2XQ5 A;  4IL4 A; 
#chains in the Genus database with same CATH homology
 3ZDH A;  2XQ9 A;  3UU5 A;  2WNL A;  4ZRU A;  3P4W A;  3UU8 A;  2Y56 A;  5HEG A;  5SYO A;  3WTO A;  2XQ8 A;  2BG9 C;  2C9T A;  3RQU A;  4EZ1 A;  5BP0 A;  3LSV A;  2WN9 A;  5LG3 A;  2BYP A;  5HEJ A;  4ZJT A;  3ZDG A;  5AFL A;  5JME A;  3TLS A;  4UXU A;  5J5G A;  2QC1 B;  2ZJU A;  3WTL A;  3WTI A;  4HFE A;  4UM3 P;  5TVC A;  2XQA A;  3IGQ A;  1I9B A;  4AFT A;  4TWF A;  4Z91 A;  3UUB A;  4ZZB A;  4QAA A;  3JAE A;  3TLV A;  4WV9 A;  3TLU A;  2X00 D;  4BFQ A;  5L47 A;  4PIR A;  2Y57 A;  3PEO A;  2XYT A;  4HQP A;  4UY2 A;  3RHW A;  4B5D A;  4NPP A;  2BR7 A;  3P50 A;  4ILA A;  4HFH A;  2WNJ A;  3U8M A;  4UM3 S;  5AIN A;  3RQW A;  5BW2 A;  5CO5 A;  2XZ6 A;  3U8J A;  1UW6 A;  4AFH A;  2BR8 A;  5AFN A;  5HCJ A;  1UX2 A;  2WZY A;  4HFC A;  2W8F A;  4D01 A;  2PH9 A;  2XQ7 A;  5L4H A;  4DBM A;  4ZK1 A;  5IUX A;  4ZJS A;  2YKS A;  4LMJ A;  3SQ9 A;  3UQ7 A;  5J0Z A;  3RIF A;  1UV6 A;  4ALX A;  5J5F A;  2BYR A;  5LXB A;  2XQ3 A;  2BG9 E;  3RIA A;  4AFG A;  2PGZ A;  5KE4 A;  5HCM A;  4QH4 A;  2Y54 A;  2YME A;  4LMK A;  3WTM A;  3WTK A;  3WTJ A;  4NZB A;  4A98 A;  5HEO A;  3TLT A;  2BG9 B;  4XHE A;  5BRX A;  5L4E A;  3SQ6 A;  4X5T A;  4HFI A;  4Z90 A;  3UQ4 A;  4TNW A;  3UU4 A;  4XK9 A;  2YOE A;  2WNC A;  5HEH A;  4UM3 A;  3SH1 A;  2BJ0 A;  3UU6 A;  5HEU A;  5FJV A;  3WIP A;  4QAB A;  4UM1 A;  4BQT A;  2VL0 A;  4F8H A;  4IRE A;  4TWH A;  3SIO A;  5KZU A;  2W8G A;  3JAF A;  3JAD A;  2Y58 A;  4FRR A;  4HFD A;  4IL9 A;  4LML A;  2ZJV A;  4A97 A;  5AFK A;  2Y7Y A;  3WTN A;  2XNV A;  2BG9 A;  3T4M A;  2BYQ A;  3U8L A;  2XYS A;  3EAM A;  3EHZ A;  5AFH A;  5J5H A;  3C84 A;  2XQ6 A;  4HFB A;  4COF A;  4TNV A;  2X00 A;  2XQ4 A;  4QAC A;  4ILB A;  2BYS A;  3U8K A;  3ZKR A;  4ILC A;  4ZZC A;  3GUA A;  3U8N A;  2YMD A;  2YN6 A;  3WTH A;  2XNU A;  3C79 A;  3EI0 A;  3PMZ A;  4ZR6 A;  3UU3 A;  4QH1 A;  4TWD A;  3TLW A;  4ZK4 A;  2UZ6 A;  5J5I A;  2BYN A;  2XZ5 A;  3RI5 A;  5AFM B;  2XNT A;  5CFB A;  5AFM A;  4QH5 A;  5AFJ A;  2XQ5 A;  4IL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...