3IGQA

Crystal structure of the extracellular domain of a bacterial pentameric ligand-gated ion channel
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
190
structure length
176
Chain Sequence
MVSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPLESKLDYQLRISRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
publication title Crystal structure of the extracellular domain of a bacterial ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 35
structure length 176
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3igqA00
2UZ6A 2YKSA 2BR8A 4ZRUA 4IL4A 4HFEA 3WTMA 4ZJTA 2XQ6A 4FRRA 4QH1A 3JAFA 3UUBA 4UM3S 4TWHA 4DBMA 2BG9E 4TWFA 4ILCA 2YMEA 3EHZA 5AFMB 4UM3P 5AFMA 4QAAA 5SYOA 3UQ4A 4TNWA 5AFHA 4X5TA 5AFLA 3WTNA 3RI5A 2XQ8A 4TWDA 3TLVA 3ZDHA 4ZK1A 5FJVA 5L4HA 2BYRA 4ZK4A 3RHWA 4WV9A 3TLWA 5IUXA 2W8GA 4HFIA 2ZJUA 4ILAA 4HQPA 3RIAA 4A97A 3JADA 4IL9A 5KE4A 2XQ9A 2Y54A 4ILBA 5CFBA 3P50A 4ZZCA 3UU6A 2BG9C 2XQAA 5LG3A 1UV6A 4LMLA 3RQUA 3EAMA 4HFCA 4D01A 4AFHA 3TLSA 5L4EA 2Y56A 3C84A 4IREA 5TVCA 5J5FA 2X00D 2W8FA 3JAEA 4B5DA 2BG9B 5J0ZA 2XNUA 2Y7YA 2Y58A 3TLTA 2BG9A 3SQ9A 3WTKA 4TNVA 4ZR6A 3UU4A 2ZJVA 4BQTA 5JMEA 2WNJA 5AINA 5HEUA 3SQ6A 5HEGA 5BRXA 4HFDA 3WTHA 4A98A 4EZ1A 5J5HA 4PIRA 2VL0A 4Z90A 4AFGA 2YOEA 4ZZBA 2QC1B 4BFQA 4QH4A 5AFNA 1UW6A 3ZKRA 5AFKA 5CO5A 4LMKA 3SH1A 2XQ7A 4AFTA 2C9TA 2PGZA 4Z91A 3WTIA 4F8HA 3T4MA 3EI0A 5L47A 4QH5A 3UU5A 2X00A 2PH9A 4ZJSA 2BR7A 3IGQA 2XNTA 4HFHA 4UXUA 3C79A 2BYQA 5KZUA 4XK9A 3U8LA 3TLUA 3SIOA 3PEOA 4ALXA 2XQ3A 2XZ5A 3U8JA 5BW2A 2BYNA 3LSVA 4QACA 4NZBA 3WTJA 5HEJA 5HEOA 4HFBA 5J5GA 3U8NA 5AFJA 1UX2A 2YN6A 2XQ5A 5HEHA 2WZYA 2Y57A 5HCJA 2YMDA 3UU3A 3UU8A 3WIPA 2XYSA 1I9BA 5LXBA 4NPPA 4UM3A 3WTLA 3UQ7A 2XYTA 3U8MA 2BJ0A 2WN9A 4UM1A 2XNVA 4XHEA 5HCMA 3ZDGA 3P4WA 2XQ4A 3U8KA 2WNLA 3WTOA 2XZ6A 2BYPA 4LMJA 5BP0A 2BYSA 3RQWA 5J5IA 3GUAA 3PMZA 4COFA 4QABA 3RIFA 2WNCA 4UY2A
chains in the Genus database with same CATH superfamily
2UZ6A 2YKSA 2BR8A 4ZRUA 4IL4A 4HFEA 3WTMA 4ZJTA 2XQ6A 4FRRA 4QH1A 3JAFA 3UUBA 4UM3S 4TWHA 4DBMA 2BG9E 4TWFA 4ILCA 2YMEA 3EHZA 5AFMB 4UM3P 5AFMA 4QAAA 5SYOA 3UQ4A 4TNWA 5AFHA 4X5TA 5AFLA 3WTNA 3RI5A 2XQ8A 4TWDA 3TLVA 3ZDHA 4ZK1A 5FJVA 5L4HA 2BYRA 4ZK4A 3RHWA 4WV9A 3TLWA 5IUXA 2W8GA 4HFIA 2ZJUA 4ILAA 4HQPA 3RIAA 4A97A 3JADA 4IL9A 5KE4A 2XQ9A 2Y54A 4ILBA 5CFBA 3P50A 4ZZCA 3UU6A 2BG9C 2XQAA 5LG3A 1UV6A 4LMLA 3RQUA 3EAMA 4HFCA 4D01A 4AFHA 3TLSA 5L4EA 2Y56A 3C84A 4IREA 5TVCA 5J5FA 2X00D 2W8FA 3JAEA 4B5DA 2BG9B 5J0ZA 2XNUA 2Y7YA 2Y58A 3TLTA 2BG9A 3SQ9A 3WTKA 4TNVA 4ZR6A 3UU4A 2ZJVA 4BQTA 5JMEA 2WNJA 5AINA 5HEUA 3SQ6A 5HEGA 5BRXA 4HFDA 3WTHA 4A98A 4EZ1A 5J5HA 4PIRA 2VL0A 4Z90A 4AFGA 2YOEA 4ZZBA 2QC1B 4BFQA 4QH4A 5AFNA 1UW6A 3ZKRA 5AFKA 5CO5A 4LMKA 3SH1A 2XQ7A 4AFTA 2C9TA 2PGZA 4Z91A 3WTIA 4F8HA 3T4MA 3EI0A 5L47A 4QH5A 3UU5A 2X00A 2PH9A 4ZJSA 2BR7A 3IGQA 2XNTA 4HFHA 4UXUA 3C79A 2BYQA 5KZUA 4XK9A 3U8LA 3TLUA 3SIOA 3PEOA 4ALXA 2XQ3A 2XZ5A 3U8JA 5BW2A 2BYNA 3LSVA 4QACA 4NZBA 3WTJA 5HEJA 5HEOA 4HFBA 5J5GA 3U8NA 5AFJA 1UX2A 2YN6A 2XQ5A 5HEHA 2WZYA 2Y57A 5HCJA 2YMDA 3UU3A 3UU8A 3WIPA 2XYSA 1I9BA 5LXBA 4NPPA 4UM3A 3WTLA 3UQ7A 2XYTA 3U8MA 2BJ0A 2WN9A 4UM1A 2XNVA 4XHEA 5HCMA 3ZDGA 3P4WA 2XQ4A 3U8KA 2WNLA 3WTOA 2XZ6A 2BYPA 4LMJA 5BP0A 2BYSA 3RQWA 5J5IA 3GUAA 3PMZA 4COFA 4QABA 3RIFA 2WNCA 4UY2A
chains in the Genus database with same CATH topology
2UZ6A 2YKSA 2BR8A 4ZRUA 4IL4A 4HFEA 3WTMA 4ZJTA 2XQ6A 4FRRA 4QH1A 3JAFA 3UUBA 4UM3S 4TWHA 4DBMA 2BG9E 4TWFA 4ILCA 2YMEA 3EHZA 5AFMB 4UM3P 5AFMA 4QAAA 5SYOA 3UQ4A 4TNWA 5AFHA 4X5TA 5AFLA 3WTNA 3RI5A 2XQ8A 4TWDA 3TLVA 3ZDHA 4ZK1A 5FJVA 5L4HA 2BYRA 4ZK4A 3RHWA 4WV9A 3TLWA 5IUXA 2W8GA 4HFIA 2ZJUA 4ILAA 4HQPA 3RIAA 4A97A 3JADA 4IL9A 5KE4A 2XQ9A 2Y54A 4ILBA 5CFBA 3P50A 4ZZCA 3UU6A 2BG9C 2XQAA 5LG3A 1UV6A 4LMLA 3RQUA 3EAMA 4HFCA 4D01A 4AFHA 3TLSA 5L4EA 2Y56A 3C84A 4IREA 5TVCA 5J5FA 2X00D 2W8FA 3JAEA 4B5DA 2BG9B 5J0ZA 2XNUA 2Y7YA 2Y58A 3TLTA 2BG9A 3SQ9A 3WTKA 4TNVA 4ZR6A 3UU4A 2ZJVA 4BQTA 5JMEA 2WNJA 5AINA 5HEUA 3SQ6A 5HEGA 5BRXA 4HFDA 3WTHA 4A98A 4EZ1A 5J5HA 4PIRA 2VL0A 4Z90A 4AFGA 2YOEA 4ZZBA 2QC1B 4BFQA 4QH4A 5AFNA 1UW6A 3ZKRA 5AFKA 5CO5A 4LMKA 3SH1A 2XQ7A 4AFTA 2C9TA 2PGZA 4Z91A 3WTIA 4F8HA 3T4MA 3EI0A 5L47A 4QH5A 3UU5A 2X00A 2PH9A 4ZJSA 2BR7A 3IGQA 2XNTA 4HFHA 4UXUA 3C79A 2BYQA 5KZUA 4XK9A 3U8LA 3TLUA 3SIOA 3PEOA 4ALXA 2XQ3A 2XZ5A 3U8JA 5BW2A 2BYNA 3LSVA 4QACA 4NZBA 3WTJA 5HEJA 5HEOA 4HFBA 5J5GA 3U8NA 5AFJA 1UX2A 2YN6A 2XQ5A 5HEHA 2WZYA 2Y57A 5HCJA 2YMDA 3UU3A 3UU8A 3WIPA 2XYSA 1I9BA 5LXBA 4NPPA 4UM3A 3WTLA 3UQ7A 2XYTA 3U8MA 2BJ0A 2WN9A 4UM1A 2XNVA 4XHEA 5HCMA 3ZDGA 3P4WA 2XQ4A 3U8KA 2WNLA 3WTOA 2XZ6A 2BYPA 4LMJA 5BP0A 2BYSA 3RQWA 5J5IA 3GUAA 3PMZA 4COFA 4QABA 3RIFA 2WNCA 4UY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZ6 A;  2YKS A;  2BR8 A;  4ZRU A;  4IL4 A;  4HFE A;  3WTM A;  4ZJT A;  2XQ6 A;  4FRR A;  4QH1 A;  3JAF A;  3UUB A;  4UM3 S;  4TWH A;  4DBM A;  2BG9 E;  4TWF A;  4ILC A;  2YME A;  3EHZ A;  5AFM B;  4UM3 P;  5AFM A;  4QAA A;  5SYO A;  3UQ4 A;  4TNW A;  5AFH A;  4X5T A;  5AFL A;  3WTN A;  3RI5 A;  2XQ8 A;  4TWD A;  3TLV A;  3ZDH A;  4ZK1 A;  5FJV A;  5L4H A;  2BYR A;  4ZK4 A;  3RHW A;  4WV9 A;  3TLW A;  5IUX A;  2W8G A;  4HFI A;  2ZJU A;  4ILA A;  4HQP A;  3RIA A;  4A97 A;  3JAD A;  4IL9 A;  5KE4 A;  2XQ9 A;  2Y54 A;  4ILB A;  5CFB A;  3P50 A;  4ZZC A;  3UU6 A;  2BG9 C;  2XQA A;  5LG3 A;  1UV6 A;  4LML A;  3RQU A;  3EAM A;  4HFC A;  4D01 A;  4AFH A;  3TLS A;  5L4E A;  2Y56 A;  3C84 A;  4IRE A;  5TVC A;  5J5F A;  2X00 D;  2W8F A;  3JAE A;  4B5D A;  2BG9 B;  5J0Z A;  2XNU A;  2Y7Y A;  2Y58 A;  3TLT A;  2BG9 A;  3SQ9 A;  3WTK A;  4TNV A;  4ZR6 A;  3UU4 A;  2ZJV A;  4BQT A;  5JME A;  2WNJ A;  5AIN A;  5HEU A;  3SQ6 A;  5HEG A;  5BRX A;  4HFD A;  3WTH A;  4A98 A;  4EZ1 A;  5J5H A;  4PIR A;  2VL0 A;  4Z90 A;  4AFG A;  2YOE A;  4ZZB A;  2QC1 B;  4BFQ A;  4QH4 A;  5AFN A;  1UW6 A;  3ZKR A;  5AFK A;  5CO5 A;  4LMK A;  3SH1 A;  2XQ7 A;  4AFT A;  2C9T A;  2PGZ A;  4Z91 A;  3WTI A;  4F8H A;  3T4M A;  3EI0 A;  5L47 A;  4QH5 A;  3UU5 A;  2X00 A;  2PH9 A;  4ZJS A;  2BR7 A;  3IGQ A;  2XNT A;  4HFH A;  4UXU A;  3C79 A;  2BYQ A;  5KZU A;  4XK9 A;  3U8L A;  3TLU A;  3SIO A;  3PEO A;  4ALX A;  2XQ3 A;  2XZ5 A;  3U8J A;  5BW2 A;  2BYN A;  3LSV A;  4QAC A;  4NZB A;  3WTJ A;  5HEJ A;  5HEO A;  4HFB A;  5J5G A;  3U8N A;  5AFJ A;  1UX2 A;  2YN6 A;  2XQ5 A;  5HEH A;  2WZY A;  2Y57 A;  5HCJ A;  2YMD A;  3UU3 A;  3UU8 A;  3WIP A;  2XYS A;  1I9B A;  5LXB A;  4NPP A;  4UM3 A;  3WTL A;  3UQ7 A;  2XYT A;  3U8M A;  2BJ0 A;  2WN9 A;  4UM1 A;  2XNV A;  4XHE A;  5HCM A;  3ZDG A;  3P4W A;  2XQ4 A;  3U8K A;  2WNL A;  3WTO A;  2XZ6 A;  2BYP A;  4LMJ A;  5BP0 A;  2BYS A;  3RQW A;  5J5I A;  3GUA A;  3PMZ A;  4COF A;  4QAB A;  3RIF A;  2WNC A;  4UY2 A; 
#chains in the Genus database with same CATH topology
 2UZ6 A;  2YKS A;  2BR8 A;  4ZRU A;  4IL4 A;  4HFE A;  3WTM A;  4ZJT A;  2XQ6 A;  4FRR A;  4QH1 A;  3JAF A;  3UUB A;  4UM3 S;  4TWH A;  4DBM A;  2BG9 E;  4TWF A;  4ILC A;  2YME A;  3EHZ A;  5AFM B;  4UM3 P;  5AFM A;  4QAA A;  5SYO A;  3UQ4 A;  4TNW A;  5AFH A;  4X5T A;  5AFL A;  3WTN A;  3RI5 A;  2XQ8 A;  4TWD A;  3TLV A;  3ZDH A;  4ZK1 A;  5FJV A;  5L4H A;  2BYR A;  4ZK4 A;  3RHW A;  4WV9 A;  3TLW A;  5IUX A;  2W8G A;  4HFI A;  2ZJU A;  4ILA A;  4HQP A;  3RIA A;  4A97 A;  3JAD A;  4IL9 A;  5KE4 A;  2XQ9 A;  2Y54 A;  4ILB A;  5CFB A;  3P50 A;  4ZZC A;  3UU6 A;  2BG9 C;  2XQA A;  5LG3 A;  1UV6 A;  4LML A;  3RQU A;  3EAM A;  4HFC A;  4D01 A;  4AFH A;  3TLS A;  5L4E A;  2Y56 A;  3C84 A;  4IRE A;  5TVC A;  5J5F A;  2X00 D;  2W8F A;  3JAE A;  4B5D A;  2BG9 B;  5J0Z A;  2XNU A;  2Y7Y A;  2Y58 A;  3TLT A;  2BG9 A;  3SQ9 A;  3WTK A;  4TNV A;  4ZR6 A;  3UU4 A;  2ZJV A;  4BQT A;  5JME A;  2WNJ A;  5AIN A;  5HEU A;  3SQ6 A;  5HEG A;  5BRX A;  4HFD A;  3WTH A;  4A98 A;  4EZ1 A;  5J5H A;  4PIR A;  2VL0 A;  4Z90 A;  4AFG A;  2YOE A;  4ZZB A;  2QC1 B;  4BFQ A;  4QH4 A;  5AFN A;  1UW6 A;  3ZKR A;  5AFK A;  5CO5 A;  4LMK A;  3SH1 A;  2XQ7 A;  4AFT A;  2C9T A;  2PGZ A;  4Z91 A;  3WTI A;  4F8H A;  3T4M A;  3EI0 A;  5L47 A;  4QH5 A;  3UU5 A;  2X00 A;  2PH9 A;  4ZJS A;  2BR7 A;  3IGQ A;  2XNT A;  4HFH A;  4UXU A;  3C79 A;  2BYQ A;  5KZU A;  4XK9 A;  3U8L A;  3TLU A;  3SIO A;  3PEO A;  4ALX A;  2XQ3 A;  2XZ5 A;  3U8J A;  5BW2 A;  2BYN A;  3LSV A;  4QAC A;  4NZB A;  3WTJ A;  5HEJ A;  5HEO A;  4HFB A;  5J5G A;  3U8N A;  5AFJ A;  1UX2 A;  2YN6 A;  2XQ5 A;  5HEH A;  2WZY A;  2Y57 A;  5HCJ A;  2YMD A;  3UU3 A;  3UU8 A;  3WIP A;  2XYS A;  1I9B A;  5LXB A;  4NPP A;  4UM3 A;  3WTL A;  3UQ7 A;  2XYT A;  3U8M A;  2BJ0 A;  2WN9 A;  4UM1 A;  2XNV A;  4XHE A;  5HCM A;  3ZDG A;  3P4W A;  2XQ4 A;  3U8K A;  2WNL A;  3WTO A;  2XZ6 A;  2BYP A;  4LMJ A;  5BP0 A;  2BYS A;  3RQW A;  5J5I A;  3GUA A;  3PMZ A;  4COF A;  4QAB A;  3RIF A;  2WNC A;  4UY2 A; 
#chains in the Genus database with same CATH homology
 2UZ6 A;  2YKS A;  2BR8 A;  4ZRU A;  4IL4 A;  4HFE A;  3WTM A;  4ZJT A;  2XQ6 A;  4FRR A;  4QH1 A;  3JAF A;  3UUB A;  4UM3 S;  4TWH A;  4DBM A;  2BG9 E;  4TWF A;  4ILC A;  2YME A;  3EHZ A;  5AFM B;  4UM3 P;  5AFM A;  4QAA A;  5SYO A;  3UQ4 A;  4TNW A;  5AFH A;  4X5T A;  5AFL A;  3WTN A;  3RI5 A;  2XQ8 A;  4TWD A;  3TLV A;  3ZDH A;  4ZK1 A;  5FJV A;  5L4H A;  2BYR A;  4ZK4 A;  3RHW A;  4WV9 A;  3TLW A;  5IUX A;  2W8G A;  4HFI A;  2ZJU A;  4ILA A;  4HQP A;  3RIA A;  4A97 A;  3JAD A;  4IL9 A;  5KE4 A;  2XQ9 A;  2Y54 A;  4ILB A;  5CFB A;  3P50 A;  4ZZC A;  3UU6 A;  2BG9 C;  2XQA A;  5LG3 A;  1UV6 A;  4LML A;  3RQU A;  3EAM A;  4HFC A;  4D01 A;  4AFH A;  3TLS A;  5L4E A;  2Y56 A;  3C84 A;  4IRE A;  5TVC A;  5J5F A;  2X00 D;  2W8F A;  3JAE A;  4B5D A;  2BG9 B;  5J0Z A;  2XNU A;  2Y7Y A;  2Y58 A;  3TLT A;  2BG9 A;  3SQ9 A;  3WTK A;  4TNV A;  4ZR6 A;  3UU4 A;  2ZJV A;  4BQT A;  5JME A;  2WNJ A;  5AIN A;  5HEU A;  3SQ6 A;  5HEG A;  5BRX A;  4HFD A;  3WTH A;  4A98 A;  4EZ1 A;  5J5H A;  4PIR A;  2VL0 A;  4Z90 A;  4AFG A;  2YOE A;  4ZZB A;  2QC1 B;  4BFQ A;  4QH4 A;  5AFN A;  1UW6 A;  3ZKR A;  5AFK A;  5CO5 A;  4LMK A;  3SH1 A;  2XQ7 A;  4AFT A;  2C9T A;  2PGZ A;  4Z91 A;  3WTI A;  4F8H A;  3T4M A;  3EI0 A;  5L47 A;  4QH5 A;  3UU5 A;  2X00 A;  2PH9 A;  4ZJS A;  2BR7 A;  3IGQ A;  2XNT A;  4HFH A;  4UXU A;  3C79 A;  2BYQ A;  5KZU A;  4XK9 A;  3U8L A;  3TLU A;  3SIO A;  3PEO A;  4ALX A;  2XQ3 A;  2XZ5 A;  3U8J A;  5BW2 A;  2BYN A;  3LSV A;  4QAC A;  4NZB A;  3WTJ A;  5HEJ A;  5HEO A;  4HFB A;  5J5G A;  3U8N A;  5AFJ A;  1UX2 A;  2YN6 A;  2XQ5 A;  5HEH A;  2WZY A;  2Y57 A;  5HCJ A;  2YMD A;  3UU3 A;  3UU8 A;  3WIP A;  2XYS A;  1I9B A;  5LXB A;  4NPP A;  4UM3 A;  3WTL A;  3UQ7 A;  2XYT A;  3U8M A;  2BJ0 A;  2WN9 A;  4UM1 A;  2XNV A;  4XHE A;  5HCM A;  3ZDG A;  3P4W A;  2XQ4 A;  3U8K A;  2WNL A;  3WTO A;  2XZ6 A;  2BYP A;  4LMJ A;  5BP0 A;  2BYS A;  3RQW A;  5J5I A;  3GUA A;  3PMZ A;  4COF A;  4QAB A;  3RIF A;  2WNC A;  4UY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...