2YMDA

Crystal structure of a mutant binding protein (5htbp-achbp) in complex with serotonin (5-hydroxytryptamine)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
b'QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYWEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYESTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCALTFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERRAGNGFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural Basis of Ligand Recognition in 5-Ht(3) Receptors.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 48
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2ymdA00
4TWFA 2Y58A 3EAMA 2BG9B 5HEOA 3C79A 2BJ0A 2BYNA 2WNJA 5BW2A 4A97A 5KE4A 2XQ7A 4IREA 4ALXA 4ZK4A 4AFGA 2VL0A 3UU4A 2PH9A 2WNLA 5AFNA 4F8HA 4ILBA 2XNTA 3WTKA 4QH5A 4Z90A 4ILCA 5CFBA 4TNWA 2W8FA 5L4EA 4PIRA 3GUAA 5J5HA 3WIPA 3JADA 4UY2A 3WTJA 3C84A 4UXUA 4BFQA 2XQ9A 4ZZBA 2XQAA 5LXBA 3T4MA 2BG9C 4QABA 3RIAA 2YOEA 5CO5A 3UQ4A 2X00A 4QACA 3U8NA 4AFHA 2YN6A 3SQ9A 1UV6A 5AFJA 2YKSA 2XQ5A 3JAEA 5J5GA 3RHWA 4WV9A 5J0ZA 3RI5A 3U8JA 2XYSA 4A98A 2W8GA 5JMEA 2Y56A 3IGQA 2PGZA 5SYOA 3SQ6A 3UU6A 3SIOA 4TWDA 3U8LA 2XNVA 3ZDGA 2WZYA 3RIFA 5AFKA 2BYQA 4ZRUA 3EHZA 4ZR6A 4HFCA 4TWHA 4LMJA 4HQPA 4ZJSA 3UUBA 4QAAA 3UQ7A 5HCMA 3TLUA 3WTLA 3U8MA 4X5TA 2WNCA 2WN9A 4LMLA 3U8KA 2ZJVA 4ZJTA 4TNVA 4AFTA 3UU5A 3TLWA 5J5IA 5BRXA 2YMDA 4FRRA 5AFHA 5HEHA 5AFMA 3TLTA 2ZJUA 5J5FA 3SH1A 3TLVA 1UX2A 5HEUA 4UM3A 3UU3A 3RQUA 3EI0A 2BR7A 4Z91A 4B5DA 4DBMA 5IUXA 3LSVA 4BQTA 4ZK1A 2XQ4A 2YMEA 2Y54A 4IL4A 3WTNA 4HFEA 2XNUA 2Y7YA 3ZKRA 1UW6A 4UM1A 3WTHA 4UM3P 3P50A 3P4WA 2BYRA 5AFMB 4IL9A 4EZ1A 3WTMA 3PMZA 5LG3A 4HFBA 4HFIA 4UM3S 2BR8A 4HFHA 5AINA 2XQ8A 3WTOA 4ZZCA 2C9TA 2XZ6A 4HFDA 5L47A 5HEJA 2QC1B 5KZUA 2X00D 4XHEA 2XQ3A 4NZBA 3WTIA 4XK9A 5HEGA 3RQWA 4QH4A 4COFA 4D01A 3TLSA 1I9BA 2BG9A 2BYSA 5TVCA 2UZ6A 4NPPA 3ZDHA 2BG9E 2Y57A 2XZ5A 5HCJA 5AFLA 4QH1A 2XQ6A 3PEOA 5BP0A 2XYTA 3UU8A 4ILAA 5FJVA 3JAFA 5L4HA 2BYPA 4LMKA
chains in the Genus database with same CATH superfamily
4TWFA 2Y58A 3EAMA 2BG9B 5HEOA 3C79A 2BJ0A 2BYNA 2WNJA 5BW2A 4A97A 5KE4A 2XQ7A 4IREA 4ALXA 4ZK4A 4AFGA 2VL0A 3UU4A 2PH9A 2WNLA 5AFNA 4F8HA 4ILBA 2XNTA 3WTKA 4QH5A 4Z90A 4ILCA 5CFBA 4TNWA 2W8FA 5L4EA 4PIRA 3GUAA 5J5HA 3WIPA 3JADA 4UY2A 3WTJA 3C84A 4UXUA 4BFQA 2XQ9A 4ZZBA 2XQAA 5LXBA 3T4MA 2BG9C 4QABA 3RIAA 2YOEA 5CO5A 3UQ4A 2X00A 4QACA 3U8NA 4AFHA 2YN6A 3SQ9A 1UV6A 5AFJA 2YKSA 2XQ5A 3JAEA 5J5GA 3RHWA 4WV9A 5J0ZA 3RI5A 3U8JA 2XYSA 4A98A 2W8GA 5JMEA 2Y56A 3IGQA 2PGZA 5SYOA 3SQ6A 3UU6A 3SIOA 4TWDA 3U8LA 2XNVA 3ZDGA 2WZYA 3RIFA 5AFKA 2BYQA 4ZRUA 3EHZA 4ZR6A 4HFCA 4TWHA 4LMJA 4HQPA 4ZJSA 3UUBA 4QAAA 3UQ7A 5HCMA 3TLUA 3WTLA 3U8MA 4X5TA 2WNCA 2WN9A 4LMLA 3U8KA 2ZJVA 4ZJTA 4TNVA 4AFTA 3UU5A 3TLWA 5J5IA 5BRXA 2YMDA 4FRRA 5AFHA 5HEHA 5AFMA 3TLTA 2ZJUA 5J5FA 3SH1A 3TLVA 1UX2A 5HEUA 4UM3A 3UU3A 3RQUA 3EI0A 2BR7A 4Z91A 4B5DA 4DBMA 5IUXA 3LSVA 4BQTA 4ZK1A 2XQ4A 2YMEA 2Y54A 4IL4A 3WTNA 4HFEA 2XNUA 2Y7YA 3ZKRA 1UW6A 4UM1A 3WTHA 4UM3P 3P50A 3P4WA 2BYRA 5AFMB 4IL9A 4EZ1A 3WTMA 3PMZA 5LG3A 4HFBA 4HFIA 4UM3S 2BR8A 4HFHA 5AINA 2XQ8A 3WTOA 4ZZCA 2C9TA 2XZ6A 4HFDA 5L47A 5HEJA 2QC1B 5KZUA 2X00D 4XHEA 2XQ3A 4NZBA 3WTIA 4XK9A 5HEGA 3RQWA 4QH4A 4COFA 4D01A 3TLSA 1I9BA 2BG9A 2BYSA 5TVCA 2UZ6A 4NPPA 3ZDHA 2BG9E 2Y57A 2XZ5A 5HCJA 5AFLA 4QH1A 2XQ6A 3PEOA 5BP0A 2XYTA 3UU8A 4ILAA 5FJVA 3JAFA 5L4HA 2BYPA 4LMKA
chains in the Genus database with same CATH topology
4TWFA 2Y58A 3EAMA 2BG9B 5HEOA 3C79A 2BJ0A 2BYNA 2WNJA 5BW2A 4A97A 5KE4A 2XQ7A 4IREA 4ALXA 4ZK4A 4AFGA 2VL0A 3UU4A 2PH9A 2WNLA 5AFNA 4F8HA 4ILBA 2XNTA 3WTKA 4QH5A 4Z90A 4ILCA 5CFBA 4TNWA 2W8FA 5L4EA 4PIRA 3GUAA 5J5HA 3WIPA 3JADA 4UY2A 3WTJA 3C84A 4UXUA 4BFQA 2XQ9A 4ZZBA 2XQAA 5LXBA 3T4MA 2BG9C 4QABA 3RIAA 2YOEA 5CO5A 3UQ4A 2X00A 4QACA 3U8NA 4AFHA 2YN6A 3SQ9A 1UV6A 5AFJA 2YKSA 2XQ5A 3JAEA 5J5GA 3RHWA 4WV9A 5J0ZA 3RI5A 3U8JA 2XYSA 4A98A 2W8GA 5JMEA 2Y56A 3IGQA 2PGZA 5SYOA 3SQ6A 3UU6A 3SIOA 4TWDA 3U8LA 2XNVA 3ZDGA 2WZYA 3RIFA 5AFKA 2BYQA 4ZRUA 3EHZA 4ZR6A 4HFCA 4TWHA 4LMJA 4HQPA 4ZJSA 3UUBA 4QAAA 3UQ7A 5HCMA 3TLUA 3WTLA 3U8MA 4X5TA 2WNCA 2WN9A 4LMLA 3U8KA 2ZJVA 4ZJTA 4TNVA 4AFTA 3UU5A 3TLWA 5J5IA 5BRXA 2YMDA 4FRRA 5AFHA 5HEHA 5AFMA 3TLTA 2ZJUA 5J5FA 3SH1A 3TLVA 1UX2A 5HEUA 4UM3A 3UU3A 3RQUA 3EI0A 2BR7A 4Z91A 4B5DA 4DBMA 5IUXA 3LSVA 4BQTA 4ZK1A 2XQ4A 2YMEA 2Y54A 4IL4A 3WTNA 4HFEA 2XNUA 2Y7YA 3ZKRA 1UW6A 4UM1A 3WTHA 4UM3P 3P50A 3P4WA 2BYRA 5AFMB 4IL9A 4EZ1A 3WTMA 3PMZA 5LG3A 4HFBA 4HFIA 4UM3S 2BR8A 4HFHA 5AINA 2XQ8A 3WTOA 4ZZCA 2C9TA 2XZ6A 4HFDA 5L47A 5HEJA 2QC1B 5KZUA 2X00D 4XHEA 2XQ3A 4NZBA 3WTIA 4XK9A 5HEGA 3RQWA 4QH4A 4COFA 4D01A 3TLSA 1I9BA 2BG9A 2BYSA 5TVCA 2UZ6A 4NPPA 3ZDHA 2BG9E 2Y57A 2XZ5A 5HCJA 5AFLA 4QH1A 2XQ6A 3PEOA 5BP0A 2XYTA 3UU8A 4ILAA 5FJVA 3JAFA 5L4HA 2BYPA 4LMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TWF A;  2Y58 A;  3EAM A;  2BG9 B;  5HEO A;  3C79 A;  2BJ0 A;  2BYN A;  2WNJ A;  5BW2 A;  4A97 A;  5KE4 A;  2XQ7 A;  4IRE A;  4ALX A;  4ZK4 A;  4AFG A;  2VL0 A;  3UU4 A;  2PH9 A;  2WNL A;  5AFN A;  4F8H A;  4ILB A;  2XNT A;  3WTK A;  4QH5 A;  4Z90 A;  4ILC A;  5CFB A;  4TNW A;  2W8F A;  5L4E A;  4PIR A;  3GUA A;  5J5H A;  3WIP A;  3JAD A;  4UY2 A;  3WTJ A;  3C84 A;  4UXU A;  4BFQ A;  2XQ9 A;  4ZZB A;  2XQA A;  5LXB A;  3T4M A;  2BG9 C;  4QAB A;  3RIA A;  2YOE A;  5CO5 A;  3UQ4 A;  2X00 A;  4QAC A;  3U8N A;  4AFH A;  2YN6 A;  3SQ9 A;  1UV6 A;  5AFJ A;  2YKS A;  2XQ5 A;  3JAE A;  5J5G A;  3RHW A;  4WV9 A;  5J0Z A;  3RI5 A;  3U8J A;  2XYS A;  4A98 A;  2W8G A;  5JME A;  2Y56 A;  3IGQ A;  2PGZ A;  5SYO A;  3SQ6 A;  3UU6 A;  3SIO A;  4TWD A;  3U8L A;  2XNV A;  3ZDG A;  2WZY A;  3RIF A;  5AFK A;  2BYQ A;  4ZRU A;  3EHZ A;  4ZR6 A;  4HFC A;  4TWH A;  4LMJ A;  4HQP A;  4ZJS A;  3UUB A;  4QAA A;  3UQ7 A;  5HCM A;  3TLU A;  3WTL A;  3U8M A;  4X5T A;  2WNC A;  2WN9 A;  4LML A;  3U8K A;  2ZJV A;  4ZJT A;  4TNV A;  4AFT A;  3UU5 A;  3TLW A;  5J5I A;  5BRX A;  2YMD A;  4FRR A;  5AFH A;  5HEH A;  5AFM A;  3TLT A;  2ZJU A;  5J5F A;  3SH1 A;  3TLV A;  1UX2 A;  5HEU A;  4UM3 A;  3UU3 A;  3RQU A;  3EI0 A;  2BR7 A;  4Z91 A;  4B5D A;  4DBM A;  5IUX A;  3LSV A;  4BQT A;  4ZK1 A;  2XQ4 A;  2YME A;  2Y54 A;  4IL4 A;  3WTN A;  4HFE A;  2XNU A;  2Y7Y A;  3ZKR A;  1UW6 A;  4UM1 A;  3WTH A;  4UM3 P;  3P50 A;  3P4W A;  2BYR A;  5AFM B;  4IL9 A;  4EZ1 A;  3WTM A;  3PMZ A;  5LG3 A;  4HFB A;  4HFI A;  4UM3 S;  2BR8 A;  4HFH A;  5AIN A;  2XQ8 A;  3WTO A;  4ZZC A;  2C9T A;  2XZ6 A;  4HFD A;  5L47 A;  5HEJ A;  2QC1 B;  5KZU A;  2X00 D;  4XHE A;  2XQ3 A;  4NZB A;  3WTI A;  4XK9 A;  5HEG A;  3RQW A;  4QH4 A;  4COF A;  4D01 A;  3TLS A;  1I9B A;  2BG9 A;  2BYS A;  5TVC A;  2UZ6 A;  4NPP A;  3ZDH A;  2BG9 E;  2Y57 A;  2XZ5 A;  5HCJ A;  5AFL A;  4QH1 A;  2XQ6 A;  3PEO A;  5BP0 A;  2XYT A;  3UU8 A;  4ILA A;  5FJV A;  3JAF A;  5L4H A;  2BYP A;  4LMK A; 
#chains in the Genus database with same CATH topology
 4TWF A;  2Y58 A;  3EAM A;  2BG9 B;  5HEO A;  3C79 A;  2BJ0 A;  2BYN A;  2WNJ A;  5BW2 A;  4A97 A;  5KE4 A;  2XQ7 A;  4IRE A;  4ALX A;  4ZK4 A;  4AFG A;  2VL0 A;  3UU4 A;  2PH9 A;  2WNL A;  5AFN A;  4F8H A;  4ILB A;  2XNT A;  3WTK A;  4QH5 A;  4Z90 A;  4ILC A;  5CFB A;  4TNW A;  2W8F A;  5L4E A;  4PIR A;  3GUA A;  5J5H A;  3WIP A;  3JAD A;  4UY2 A;  3WTJ A;  3C84 A;  4UXU A;  4BFQ A;  2XQ9 A;  4ZZB A;  2XQA A;  5LXB A;  3T4M A;  2BG9 C;  4QAB A;  3RIA A;  2YOE A;  5CO5 A;  3UQ4 A;  2X00 A;  4QAC A;  3U8N A;  4AFH A;  2YN6 A;  3SQ9 A;  1UV6 A;  5AFJ A;  2YKS A;  2XQ5 A;  3JAE A;  5J5G A;  3RHW A;  4WV9 A;  5J0Z A;  3RI5 A;  3U8J A;  2XYS A;  4A98 A;  2W8G A;  5JME A;  2Y56 A;  3IGQ A;  2PGZ A;  5SYO A;  3SQ6 A;  3UU6 A;  3SIO A;  4TWD A;  3U8L A;  2XNV A;  3ZDG A;  2WZY A;  3RIF A;  5AFK A;  2BYQ A;  4ZRU A;  3EHZ A;  4ZR6 A;  4HFC A;  4TWH A;  4LMJ A;  4HQP A;  4ZJS A;  3UUB A;  4QAA A;  3UQ7 A;  5HCM A;  3TLU A;  3WTL A;  3U8M A;  4X5T A;  2WNC A;  2WN9 A;  4LML A;  3U8K A;  2ZJV A;  4ZJT A;  4TNV A;  4AFT A;  3UU5 A;  3TLW A;  5J5I A;  5BRX A;  2YMD A;  4FRR A;  5AFH A;  5HEH A;  5AFM A;  3TLT A;  2ZJU A;  5J5F A;  3SH1 A;  3TLV A;  1UX2 A;  5HEU A;  4UM3 A;  3UU3 A;  3RQU A;  3EI0 A;  2BR7 A;  4Z91 A;  4B5D A;  4DBM A;  5IUX A;  3LSV A;  4BQT A;  4ZK1 A;  2XQ4 A;  2YME A;  2Y54 A;  4IL4 A;  3WTN A;  4HFE A;  2XNU A;  2Y7Y A;  3ZKR A;  1UW6 A;  4UM1 A;  3WTH A;  4UM3 P;  3P50 A;  3P4W A;  2BYR A;  5AFM B;  4IL9 A;  4EZ1 A;  3WTM A;  3PMZ A;  5LG3 A;  4HFB A;  4HFI A;  4UM3 S;  2BR8 A;  4HFH A;  5AIN A;  2XQ8 A;  3WTO A;  4ZZC A;  2C9T A;  2XZ6 A;  4HFD A;  5L47 A;  5HEJ A;  2QC1 B;  5KZU A;  2X00 D;  4XHE A;  2XQ3 A;  4NZB A;  3WTI A;  4XK9 A;  5HEG A;  3RQW A;  4QH4 A;  4COF A;  4D01 A;  3TLS A;  1I9B A;  2BG9 A;  2BYS A;  5TVC A;  2UZ6 A;  4NPP A;  3ZDH A;  2BG9 E;  2Y57 A;  2XZ5 A;  5HCJ A;  5AFL A;  4QH1 A;  2XQ6 A;  3PEO A;  5BP0 A;  2XYT A;  3UU8 A;  4ILA A;  5FJV A;  3JAF A;  5L4H A;  2BYP A;  4LMK A; 
#chains in the Genus database with same CATH homology
 4TWF A;  2Y58 A;  3EAM A;  2BG9 B;  5HEO A;  3C79 A;  2BJ0 A;  2BYN A;  2WNJ A;  5BW2 A;  4A97 A;  5KE4 A;  2XQ7 A;  4IRE A;  4ALX A;  4ZK4 A;  4AFG A;  2VL0 A;  3UU4 A;  2PH9 A;  2WNL A;  5AFN A;  4F8H A;  4ILB A;  2XNT A;  3WTK A;  4QH5 A;  4Z90 A;  4ILC A;  5CFB A;  4TNW A;  2W8F A;  5L4E A;  4PIR A;  3GUA A;  5J5H A;  3WIP A;  3JAD A;  4UY2 A;  3WTJ A;  3C84 A;  4UXU A;  4BFQ A;  2XQ9 A;  4ZZB A;  2XQA A;  5LXB A;  3T4M A;  2BG9 C;  4QAB A;  3RIA A;  2YOE A;  5CO5 A;  3UQ4 A;  2X00 A;  4QAC A;  3U8N A;  4AFH A;  2YN6 A;  3SQ9 A;  1UV6 A;  5AFJ A;  2YKS A;  2XQ5 A;  3JAE A;  5J5G A;  3RHW A;  4WV9 A;  5J0Z A;  3RI5 A;  3U8J A;  2XYS A;  4A98 A;  2W8G A;  5JME A;  2Y56 A;  3IGQ A;  2PGZ A;  5SYO A;  3SQ6 A;  3UU6 A;  3SIO A;  4TWD A;  3U8L A;  2XNV A;  3ZDG A;  2WZY A;  3RIF A;  5AFK A;  2BYQ A;  4ZRU A;  3EHZ A;  4ZR6 A;  4HFC A;  4TWH A;  4LMJ A;  4HQP A;  4ZJS A;  3UUB A;  4QAA A;  3UQ7 A;  5HCM A;  3TLU A;  3WTL A;  3U8M A;  4X5T A;  2WNC A;  2WN9 A;  4LML A;  3U8K A;  2ZJV A;  4ZJT A;  4TNV A;  4AFT A;  3UU5 A;  3TLW A;  5J5I A;  5BRX A;  2YMD A;  4FRR A;  5AFH A;  5HEH A;  5AFM A;  3TLT A;  2ZJU A;  5J5F A;  3SH1 A;  3TLV A;  1UX2 A;  5HEU A;  4UM3 A;  3UU3 A;  3RQU A;  3EI0 A;  2BR7 A;  4Z91 A;  4B5D A;  4DBM A;  5IUX A;  3LSV A;  4BQT A;  4ZK1 A;  2XQ4 A;  2YME A;  2Y54 A;  4IL4 A;  3WTN A;  4HFE A;  2XNU A;  2Y7Y A;  3ZKR A;  1UW6 A;  4UM1 A;  3WTH A;  4UM3 P;  3P50 A;  3P4W A;  2BYR A;  5AFM B;  4IL9 A;  4EZ1 A;  3WTM A;  3PMZ A;  5LG3 A;  4HFB A;  4HFI A;  4UM3 S;  2BR8 A;  4HFH A;  5AIN A;  2XQ8 A;  3WTO A;  4ZZC A;  2C9T A;  2XZ6 A;  4HFD A;  5L47 A;  5HEJ A;  2QC1 B;  5KZU A;  2X00 D;  4XHE A;  2XQ3 A;  4NZB A;  3WTI A;  4XK9 A;  5HEG A;  3RQW A;  4QH4 A;  4COF A;  4D01 A;  3TLS A;  1I9B A;  2BG9 A;  2BYS A;  5TVC A;  2UZ6 A;  4NPP A;  3ZDH A;  2BG9 E;  2Y57 A;  2XZ5 A;  5HCJ A;  5AFL A;  4QH1 A;  2XQ6 A;  3PEO A;  5BP0 A;  2XYT A;  3UU8 A;  4ILA A;  5FJV A;  3JAF A;  5L4H A;  2BYP A;  4LMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...