4LMKA

Glic liganded-closed-channel conformation, mutant y27'a
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPAMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Gating of the proton-gated ion channel from Gloeobacter violaceus at pH 4 as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 90
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4lmkA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4lmkA01
3PEOA 2XZ6A 2XQ3A 3EI0A 4A97A 3EAMA 4ALXA 3C84A 4XHEA 1UX2A 4UM3A 3ZDGA 4AFHA 2XNVA 2Y54A 2Y56A 4HQPA 4Z90A 4BQTA 4ZZBA 2PGZA 1I9BA 5HCJA 2W8FA 4FRRA 4UY2A 3U8KA 5AFHA 4X5TA 5J5GA 3WTJA 4UM3S 5KE4A 4ILAA 2X00D 4QAAA 4TWDA 4ZK4A 3SQ9A 4B5DA 4LMJA 4TWHA 5AFMB 2LLYA 3SIOA 5AFKA 2LM2A 4IL4A 4BFQA 1OEDA 5TVCA 5L4HA 2BG9A 2M6IA 4LMLA 3UU4A 4IL9A 4F8HA 2KSRA 4UM1A 3RIAA 3UU5A 4PIRA 4AFTA 2YKSA 2W8GA 5SYOA 4UXUA 3LSVA 4TWFA 2XNTA 4TNVA 3RIFA 3P50A 5HEGA 3UU3A 2ZJUA 2C9TA 3JADA 4HFEA 4COFA 4HFDA 2BR7A 2Y58A 4WV9A 2BYQA 3TLUA 5J5HA 3RQWA 4HFIA 4IREA 2UZ6A 4QABA 5BP0A 3TLVA 2X00A 5LG3A 4NZBA 2PH9A 2XNUA 5CFBA 4QH4A 2YMEA 4ZJSA 4AFGA 5CO5A 2LKGA 3UU8A 3TLWA 2BG9B 5KZUA 4QH1A 4HFHA 2XQAA 2BYRA 3U8MA 3WTMA 3WTNA 5FJVA 3JAFA 3JAEA 5L4EA 4ZJTA 3TLSA 2XQ6A 4HFCA 2YMDA 4HFBA 2XYTA 3U8JA 3UQ7A 2WN9A 3UQ4A 2XYSA 3GUAA 4ZRUA 5J0ZA 3WTKA 3PMZA 2Y7YA 3U8LA 2MAWA 3RQUA 4ILBA 5L47A 3WTIA 3SH1A 5AFMA 2XQ4A 2BYSA 2QC1B 5AFLA 3TLTA 4ZZCA 2XQ5A 2WNCA 3SQ6A 4ZK1A 3P4WA 4TNWA 5HEOA 5JMEA 1OEDB 2ZJVA 3WTLA 5HCMA 1UV6A 5BW2A 5HEJA 4LMKA 3UU6A 3RI5A 2WNJA 2XQ7A 3WIPA 4XK9A 5LXBA 3EHZA 3WTOA 5AINA 2BYNA 2XQ9A 2BYPA 3C79A 4NPPA 5AFJA 5J5IA 2BR8A 3ZDHA 5BRXA 3RHWA 4ZR6A 1UW6A 4Z91A 2Y57A 4A98A 2LKHA 2XZ5A 3T4MA 4DBMA 5AFNA 4ILCA 2M6BA 5HEUA 2WNLA 2WZYA 1OEDC 2XQ8A 4QACA 2BG9C 2YN6A 3ZKRA 4D01A 2VL0A 5J5FA 4QH5A 5IUXA 3IGQA 4UM3P 3U8NA 3UUBA 3WTHA 4EZ1A 2YOEA 5HEHA 1OEDE 2BJ0A 2BG9E
chains in the Genus database with same CATH superfamily
3K8PC 3Q5DA 3RC3A 4I4TE 2JRKA 4IE0A 5AQOB 5AFUL 5LHGB 5AQSB 2V26A 3MXZA 5JDFA 4CQIA 5HXSA 4MHCA 3E08A 4TWDA 4ZK4A 5AFMB 5LA6E 2XZEA 3SIOA 1CUNA 5C3JA 5JDQA 3PUAA 2BS2A 3VR8A 3AE4A 5JTGA 5HEGA 3NZPA 4K0KT 2V7IA 3RH3A 3UUXB 4AIUA 2NOXA 2C5IT 4UV8B 2L9QA 3Q2MA 1SE7A 1W09A 2W67A 3CQGB 2LT3A 4X65T 4GOUA 3WTMA 2D9DA 2XYSA 4KMCA 2N1GA 4X1IE 1EZ3A 3H3AA 2Y7YA 2MAWA 4ADZA 1ZEEA 5FY7A 4A5XA 4HN9A 5CB4E 4HKAA 3VKGA 1WYCA 4X20E 3RPUA 4AQYT 3Q9DA 4JLEA 1Z0PA 5BR8T 4GYSA 4TZ4C 5HEOA 4PK6A 1MNDA 3B5MA 3C4WA 2CHOA 5JVDE 4LF4T 4X62T 2QVAA 3MA9A 2B1EA 4X64T 4Z91A 4UV9B 4HGAA 4AQFC 3ZT6A 3KV4A 2IUBA 3FZMB 1JNZA 4UM3P 2D0UA 4N78D 2YOEA 2XZ6A 1S35A 5L3GB 3EI0A 2N2NA 3N9MA 4P0AA 4UY2A 4DV0T 4NXNT 1XZYA 4NXMT 4ILUA 2X00D 4HWDA 5F5WA 3E0ZA 5FP3A 5E0OA 1KK7A 4IL4A 2V7MA 3HKDE 4UM1A 1D0YA 2WZHA 4GKJT 5LCYA 2WBLA 2LE8A 1FMVA 2H7VC 3KBTA 3LSVA 4TWFA 1MIVA 1ZHCA 5LBQB 4QXHB 2K9AA 3UU3A 3AAEB 2ZM6T 4DMVA 4DR1T 1BR0A 3O1JA 3PUSA 3TLWA 4HFHA 3B13A 4QHOA 3U8MA 5FJVA 2M67A 1UX5A 2NP9A 4HFCA 5AQHB 2E9XC 1U5PA 2QGSA 2LSGA 2E9XA 4FJOA 4LFAT 4X66T 2XPKA 4JYAT 3HKBE 5DQWA 4NUUA 1Y64B 4ZZCA 1VCTA 5JR9A 4MFRA 5JH7E 4FI5A 4UIGA 2A9UA 2UXXB 2YDSA 5JMEA 4JI1T 4JI7T 5BW2A 3RI5A 2NR4A 4UEMA 4EIWA 3I9WA 3GN5A 2KLQA 5LXBA 2MPKA 4G63A 1I6ZA 3ANWA 4NPPA 5J5IA 3OJAA 1ZP0A 2WMNA 4DBMA 2M6BA 2PTFA 3QC9A 4WNKA 1YW0A 3CPZA 5DABA 3GWHA 4YY3T 5HEHA 2BG9E 1IJ6A 5AQGB 3H37A 2CRBA 2WWUA 1UUSA 2A3DA 3WTJA 3F31A 3KVAA 3RKOA 3MKDA 1D0ZA 4TWHA 2BVLA 3UU4A 4LMLA 2VKOA 2D2SA 3UU5A 2ACXA 2WSSV 5JREA 4L9IA 3GMIA 3AE1A 1UX4A 3PUXF 5FVLA 3ZYKA 4YJ2E 4HFEA 2BYQA 2V7KA 1Y01A 3NBXX 5H6QB 4O4HE 3AA1B 1E1HB 3A7MA 4ZEYA 2FJBA 2XASB 5FY1A 5AFMA 4YHHT 2MYSA 4LF8T 2CLYB 4U3CA 5AFLA 4DR6T 3RRWA 2D0TA 3IEEA 2XAQB 1OEDB 5HCMA 5HEJA 2QA7A 5FXZA 2XUEA 4IE4A 5ABEA 2V1DB 1KFYA 3SS1A 2L8KA 5BRXA 4DR4T 4ZR6A 2KWIB 5AQTB 3SOLA 1YXRA 2WY2A 1FEWA 4BAYB 3OBVE 4UF0A 3AAIA 3QOFA 3RRCA 4QH5A 4B3MT 2CXLA 2YINA 3O4XE 2YDRA 3DP7A 2Y6XA 1UX2A 3ZSTA 3ZDGA 1J1JA 4HQPA 3LK3B 2I6HA 3U8KA 2BS3A 5AFHA 4JUYA 2VQFT 4M1PA 4DV1T 4YTPA 2JQHA 4LFBT 2Z6EA 5TVCA 5L4HA 2UXCT 5DJQC 3RYFE 4YSYA 4AFTA 3SWHA 1QUUA 3I0OA 4DR5T 4P1NA 5KMGP 3BQKA 1HFAA 3PUQA 2CBJA 1YKHB 2FUPA 2CWOA 4DV2T 2X00A 2JJ9A 2ZMAA 5TAOA 4QXBB 4OX9T 4JEHB 4X1KE 4H9QC 5FY0A 2UU9T 3DJBA 5J0ZA 3PMZA 3LBXB 3T1HT 4EOZB 4J2CA 1HNZT 1MMDA 3V5SA 4TN7B 1VCSA 3CX7B 2XSBA 3AECA 3CMLA 3HR0A 1LKXA 4JEUB 3ZC0A 4DBRA 4P0BA 4IDNA 4AKHA 3ONLC 3QUJA 2VKDA 2XZ5A 5LGUB 3O1HA 3FHNA 2MTQA 2NW8A 2YMDA 2IIUA 2WB5A 2DCFA 2OV9A 4O4JE 2XTLA 1OXZA 4QXCB 2Y54A 3PUGA 1LRZA 4HWIB 4I43B 3K1SA 3ZT5A 4QAAA 4WBOA 1D1AA 4PJMA 4UELA 4JI3T 3OYZA 4AISA 2WU5A 4CZZB 1W9RA 3T1YT 4B3RT 2YKSA 3AA7B 2C5KT 3VKHA 3AE7A 3GA8A 3JADA 2JMKA 3C98B 1Z8UA 3TLVA 4EZ4A 1HF8A 4CXYA 3WTNA 2FJEA 5AQVB 3UT5E 2DNXA 3U8JA 2I0MA 4KP3C 2JQKA 2KZ7B 2LSYA 4U2YA 3SH1A 3KDSE 4I55E 5L3EB 3VU7H 2BS4A 3AE2A 3AEGA 1VRBA 1HR0T 2DL1A 1SUMB 1WR0A 4ERRA 4XZCA 4EYYR 3ZDHA 1IAPA 3PURA 1WR6A 4U74A 1S94A 4GKKT 1UURA 2WZYA 5JRCB 4D01A 3ZLIA 5ABGA 4ISTA 5J2UE 2RA1A 4KUMB 2V7LA 2AXDS 4YHJA 2XNVA 4I50E 4JI6T 2CLYC 2W2UA 5J5GA 4OYKA 1W0AA 3ZEFB 1OEDA 2KSRA 2V6YB 1DU2A 3ZMSB 3UUNA 1M62A 2FJAA 3AB3B 4CI1B 4WW0A 2IDOB 4EGWA 2XJ7A 3QB5K 4DV5T 1YQ4A 1ZV4X 4YFSA 1T8BA 4AFGA 3V5UA 1KNPA 2BYRA 4YTNA 2CBIA 3RX6A 2P9BA 5BMVE 2XYTA 4KHZF 3FB2A 2YDQA 3AE8A 3LK2B 4TUYE 2XQ4A 4CN4A 3VRBA 2H88A 5LHIB 2WNJA 2UXDT 5HWXA 3N9LA 2IAKA 5CA0E 5FVKA 5HEUA 1WRDA 4JV5T 4YLHA 2OLTA 1QSDA 2W00A 2G0UA 4DBQA 1GQEA 2E2AA 2YK0A 4IDQA 1FMWA 4IE6A 5HAXA 3LBXA 4EAHA 1NAFA 4DV7T 1I9BA 2W8FA 3NVOA 4QKNA 3CX8B 1HTJF 4LMJA 2VASA 2LSKA 3KVBA 5AFKA 3AEDA 1FIOA 5LMNT 4AQFA 3RIAA 4ZI2C 2EHOC 3EABA 1FJGT 5IYZE 5SYOA 3N2OA 2UXNB 4A56A 3RIFA 5FXVA 4DIDB 3UFEA 5JDHA 1CHUA 1W0BA 5LG3A 3FZHB 2QYWA 4UR9A 5EZYE 2BG9B 5HWYA 1AJ3A 2Q9QB 5F8PA 4HE8A 5LB7B 5FXXA 4MLKA 4DV3T 4H9RC 3VRAA 2W0GA 3ZYMA 4OHFA 4O4LE 5ABFA 2UUBT 3I1AA 2Q9QD 4TNWA 3HKCE 2C5JA 3LK42 4KBMB 2C0SA 4EYUA 3RLFF 3ZC1A 1ZKEA 2K48A 5AFJA 4CXWA 2ODVA 2FJDA 3AE3A 2HN1A 4QACA 2H89A 4PW8A 1HCIA 2VL0A 2V8SV 3F2EA 4EB6E 4A97A 5CA1E 1U4QA 2WP9A 4GIWA 1HX8A 3KV6A 3PJAA 3L8RA 4CI2B 1HG5A 4TV8E 5FNVE 3QB5A 4IL9A 4U33A 1N32T 1XWMA 3AEFA 3RIUC 5CJ5A 4YT0A 2JQ9A 5J2TE 3AEEA 2W8GA 3Q5EA 4WV9A 2MBGA 2X67A 4WZXA 4HFIA 5AQPB 4U2ZA 4CN1A 4H9PC 2LKGA 2CEAA 3JAEA 5L4EA 4AXPA 4MALA 1XNQT 3P4PA 3UQ7A 5LP6E 2CM0A 2IMLA 1D1CA 2GK9A 4OK0A 5HXRA 2UXBT 2X9XA 3FXEB 4B6XA 4ZXLA 3UU6A 2KT9A 3C4XA 2Y48B 3LDQB 2WNLA 2WDVA 2A72A 2YN6A 2F4VT 5LNKA 4IDPA 4K0UA 2XQ3A 5JQGE 4XHEA 5AQIB 4V1Av 4YSXA 2VKJA 4UM3S 2ZM2A 2W4XA 3N9NA 5C8YE 2LLYA 2V7JA 2HH7A 3VR9A 4DR3T 3PUWF 2YU2A 3P4SA 2W66A 1HG2A 3J9X1 4AKGA 3NRYA 2VVNA 4UXUA 1XMQT 4JBWF 5KDMC 4TNVA 2CXFA 2LHNA 4BJNA 2PH9A 4DNDA 5LHHB 2VKHA 3WAJA 2XQAA 4IE7A 4HEAA 1YQ3A 3SRZA 4LF9T 4ZI3C 2VVSA 4IDZA 3WTIA 1HNWT 3KBUA 5IWAT 4ZK1A 5AQMB 4BJMA 1HS7A 3IBPA 4EEDA 5FKYA 2K3WA 3Q5XA 3EHZA 2LSIA 3AAAB 2UUCT 2BYPA 3C79A 3ZYLA 2VL8A 2LKHA 2BG9C 5LXTE 5J5FA 1M7KA 4YTMA 2Q9QC 3IGQA 4AQGA 1OEDE 2Q9QA 3PEOA 4PJNA 4KI0F 3FZLB 3PUYF 1L0VA 1KEYA 4GK5E 2ZM0A 2K5BB 2XAJB 2JMHA 2ES0A 2EHOB 2IC9A 2J1DG 4DUYT 2IW5B 5EK2A 3UFGA 2BDEA 2XHEB 4JI4T 1XDPA 2VWAA 4ZI2D 2B76A 2WMOA 3FBLA 2EHOD 3OKQA 4EZHA 2V5DA 3P50A 4DVDA 3ETVA 5IHYA 2JPFA 3UUMA 4ASKA 4QABA 3KFWX 4NUVA 3L3PA 3AE9A 5KX5E 3ETUA 5EK4A 2IC6A 2VQET 3C50A 5AQUB 3DTOA 1OWAA 2HHHT 4HWCA 3UQ4A 4KHPT 4ZRUA 3QK6A 1N36T 5LMUT 3CK6A 4YJ3E 2WAUA 4P09A 3P4QA 4ZS3A 3NKZA 2XQ5A 3N5LA 3ZCJA 3J7Yq 2XAGB 5C2TA 5ADXL 2XQ7A 5L3CB 3WIPA 3C64A 3P8CD 5AINA 4H9SE 2BR8A 5A1LA 3RHWA 4U7IA 2J47A 4ILCA 4QX8B 1I94T 2V6XA 5LJNA 3OTOT 5IUXA 3U8NA 5JR9B 3ZJ1A 3ZMZB 4ANJA 4BQTA 3GN5B 4IGUA 4FRRA 4X5TA 2BZBA 2KINB 2N9DA 5DQVA 3ZT7A 1MIWA 3SQ9A 4ZOLE 4WYVA 4U7YA 2JIWA 3LFMA 3SFDA 2NWBA 4O4IE 2NW9A 3AVRA 5KXJA 1T7SA 5LBMA 2PJQA 1R8IA 3EDVA 3R84B 5FMNA 3OYXA 1NENA 2ZJUA 3K3OA 4HFDA 2OA5A 4PFOA 5J5HA 5J1GA 2UZ6A 4IREA 4WBNE 3WAKA 4NZBA 3NWIA 5CFBA 4UXNB 4B3ST 3UU8A 4PJJA 1E2AA 4UVAB 1WLXA 3L09A 2WN9A 3GUAA 3WTKA 1H7CA 1WYBA 3PV0F 3ZMVB 3HI2A 4H63V 4ILBA 5L47A 1NEKA 3UULA 2RP4A 1XMOT 3N2GE 5HXEA 3S4UA 2CCQA 5AQNB 1T98A 1YKEB 5M4YA 5JDGA 3SQ6A 3R6NA 4IIJE 2SPCA 3AA6B 3QNUA 4TX5A 4AKRB 3WTOA 4ISSA 1QLBA 3PU3A 2Y57A 2X0HA 2WU2A 5FYMA 3LG7A 4ZS2A 2YU1A 2AE9A 1X9BA 3N9PA 5GONE 4EZ1A 2A2FX 4PAGA 3EAMA 4AFHA 2Y56A 3IHRA 4Z90A 1D0XA 1VOMA 3O9XA 1B7TA 1MMNA 1MNEA 2L3LA 2PG8A 2LM2A 4UF0B 5LGTB 2X68A 5JDMA 3LJCA 2M6IA 3MACA 3AEBA 4PFPA 2LEHA 2WDQA 1BR1A 2ACZA 4F6RC 3HL6A 3HKEE 3KV9A 2XNTA 5JDLA 4COFA 2DWGA 3ESLA 2W63A 5L3DB 3PU8A 2E5LT 2X9WA 4QH4A 2HPLA 3PUZF 4ZJSA 3ZMUB 5CO5A 4QH1A 2DWKA 2WWVA 4DUZT 3ZMTB 4LFCT 4DV6T 1J5ET 1XNRT 2EHOA 3U78A 2W62A 1MIYA 3K3QC 4ZI3D 4JI5T 3AXJB 4U72A 3AE5A 2NTXA 3ZCIA 2X66A 3K3NA 2VURA 2X0LB 1HX1B 4XAXB 1UV6A 5HXHA 4KX6A 2BBHA 1KNZA 4A98A 3AE6A 5LYJE 5AFNA 3JCFA 3PUVF 1LVFA 3JC6C 3L39A 3C84A 3G06A 4LF7T 4UM3A 3N9OA 2BKPA 3D0TA 2PGZA 2PFVA 3T8OA 2R6GF 1LVKA 2KNDA 1G73A 2LRLA 4E7ZA 4CN6A 4DR7T 5LJMA 2WQYA 2LJLA 5L2LA 4O2BE 3AA0B 2WCAA 1N33T 3CVRA 3ZPOA 3EDUA 4H9NC 4OYJA 1IBKT 2YEVC 3MZKB 3CKDA 5JR9C 3RQWA 3M65A 4L5GA 2YMEA 4Z8XA 1J5WA 5KZUA 3C4ZA 4AKLA 3TLSA 4ZJTA 3RIUA 5AQQB 4HFBA 5L3BB 2X51A 3FZKB 2H7OA 2WDRA 5JRCA 1XDOA 2BYSA 2QC1B 4EEBA 3ZSSA 3TLTA 2XM1A 1YD8G 1V9DA 3VHLA 4ZHQE 3WTLA 4IE5A 2CXDA 2H3RA 1IBMT 2CE7A 4LMKA 3O1IA 2X0YA 4DMWA 2I59A 2J62A 1IBLT 2D5UA 2JQQA 2WM9A 3EVYA 2XQ8A 3FBZA 3M3ZB 2V6YA 3WTHA 2LRKA 3A8YC 4CI3B 4ALXA 3OPCA 3WI3A 4U31A 3U3IA 4ZZBA 2X9HA 2DI4A 4ZI7E 4MBQA 5HYAA 5KE4A 3BK9A 4B5DA 2XY8B 2ODUA 4C91A 5AQJB 1IZNB 4L0RA 3HA4A 2MOZA 2V5CA 3I0QA 3RYCE 2WS3A 3CQCB 4QX7B 3RYIE 5H6RB 3IF8B 1UK5A 2CMRA 3TKLB 2NTYA 3FXDB 3C51A 3AEAA 1N34T 3KINB 4AKIA 4HTEA 1KF6A 5JDNA 4EXTA 2VK9A 3MK7C 3PDYA 2KMFA 3X1DA 5FL0A 2WZIA 4E7SA 4UVBB 3PJAJ 4NIQA 2LM9A 2BKOA 4UVCB 1UW6A 5AQFB 3T4MA 2XAHB 4X1YE 3P4RA 3IA3A 3PE0A 4XBFB 1O3XA 5AQLB 3RC8A 1MMGA 1SA0E 3CWZB 1IJ5A 3KV5A 5F3JA 2IHR1 3AXJA 4HWFA 3RKGA 4PK5A 2XAFB 2XQYA 3A5XA 3PTRB 1WFDA 2ZM8A 3N9QA 2KXPB 5LOVE 2BG9A 1WCRA 4F8HA 2UUAT 5CGMA 5EK3A 5FXWA 1X79A 2PBIA 1D1BA 4H9OC 1SHZC 3BQLA 4TV9E 1BR4A 3CQXC 3ABVA 2BVMA 4HWHA 3EUHA 3RGLA 4CXXA 3JAFA 4DO0A 3B57A 4JI0T 3ZJ2A 2RPAA 4LF6T 3BQIA 4YXDA 2LOPA 5AQRB 2WNCA 1T72A 3P4WA 2DHRA 2LHRA 4LF5T 2ZLYA 3CX6B 1KNRA 3AVSA 4IT4A 2J4GA 3W15B 4GK0E 3N2KE 2BBJA 2XM2A 4BA9A 2E8IA 4PNIA 2Y8DA 2LOSA 5AQKB 2XSAA 3JC6D 5ABFB 1UCUA 3H3MA 2CHNA 4GYRA 2LSJA 4JI2T 3CIRA 3NZQA 5HXCA 3ZN1B 2E5VA 3OVUA 5HCJA 4AI6A 4JI8T 1E7PA 4ILAA 2FBWA 2E9XB 2KWHA 1MMAA 1NWMX 4BFQA 1HNXT 3E22E 5ETWA 2QRXA 4G2AA 4PIRA 3Q5WA 3MJXA 4IDOA 5L3FB 5FL1A 4I0UA 1UGOA 2E9XD 4Q25A 4OFZA 3ONXA 4IHJE 2C9TA 2Y58A 2BR7A 3ANWB 3TLUA 5BP0A 1JNRA 2XNUA 4HFVA 4B3TT 3UTKA 4H63H 5ABHA 1US7B 1ZOYA 2XQ6A 3U8LA 1BR2A 3RQUA 4QWNB 2DLRA 2BKNA 2VB6A 3RF1A 3ZN0B 4O2AE 2HPJA 3SFEA 4DV4T 3F57A 2CPTA 3FZFB 2ZJVA 2CWYA 2K24A 4XK9A 2BYNA 2XQ9A 4PJLA 5LG4A 4PK4A 2X9YA 3NRXA 4C90A 4DR2T 1OEDC 4YSZA 3ZKRA 2CA5A 4O8SA 3P7IA 3ONJA 3RYHE 2HN2A 3I9YA 2NW7A 3UUBA 2W61A 4EV6A 5LGNB 2BJ0A 1G8XA
chains in the Genus database with same CATH topology
3PEOA 2XZ6A 2XQ3A 3EI0A 4A97A 3EAMA 4ALXA 3C84A 4XHEA 1UX2A 4UM3A 3ZDGA 4AFHA 2XNVA 2Y54A 2Y56A 4HQPA 4Z90A 4BQTA 4ZZBA 2PGZA 1I9BA 5HCJA 2W8FA 4FRRA 4UY2A 3U8KA 5AFHA 4X5TA 5J5GA 3WTJA 4UM3S 5KE4A 4ILAA 2X00D 4QAAA 4TWDA 4ZK4A 3SQ9A 4B5DA 4LMJA 4TWHA 5AFMB 2LLYA 3SIOA 5AFKA 2LM2A 4IL4A 4BFQA 1OEDA 5TVCA 5L4HA 2BG9A 2M6IA 4LMLA 3UU4A 4IL9A 4F8HA 2KSRA 4UM1A 3RIAA 3UU5A 4PIRA 4AFTA 2YKSA 2W8GA 5SYOA 4UXUA 3LSVA 4TWFA 2XNTA 4TNVA 3RIFA 3P50A 5HEGA 3UU3A 2ZJUA 2C9TA 3JADA 4HFEA 4COFA 4HFDA 2BR7A 2Y58A 4WV9A 2BYQA 3TLUA 5J5HA 3RQWA 4HFIA 4IREA 2UZ6A 4QABA 5BP0A 3TLVA 2X00A 5LG3A 4NZBA 2PH9A 2XNUA 5CFBA 4QH4A 2YMEA 4ZJSA 4AFGA 5CO5A 2LKGA 3UU8A 3TLWA 2BG9B 5KZUA 4QH1A 4HFHA 2XQAA 2BYRA 3U8MA 3WTMA 3WTNA 5FJVA 3JAFA 3JAEA 5L4EA 4ZJTA 3TLSA 2XQ6A 4HFCA 2YMDA 4HFBA 2XYTA 3U8JA 3UQ7A 2WN9A 3UQ4A 2XYSA 3GUAA 4ZRUA 5J0ZA 3WTKA 3PMZA 2Y7YA 3U8LA 2MAWA 3RQUA 4ILBA 5L47A 3WTIA 3SH1A 5AFMA 2XQ4A 2BYSA 2QC1B 5AFLA 3TLTA 4ZZCA 2XQ5A 2WNCA 3SQ6A 4ZK1A 3P4WA 4TNWA 5HEOA 5JMEA 1OEDB 2ZJVA 3WTLA 5HCMA 1UV6A 5BW2A 5HEJA 4LMKA 3UU6A 3RI5A 2WNJA 2XQ7A 3WIPA 4XK9A 5LXBA 3EHZA 3WTOA 5AINA 2BYNA 2XQ9A 2BYPA 3C79A 4NPPA 5AFJA 5J5IA 2BR8A 3ZDHA 5BRXA 3RHWA 4ZR6A 1UW6A 4Z91A 2Y57A 4A98A 2LKHA 2XZ5A 3T4MA 4DBMA 5AFNA 4ILCA 2M6BA 5HEUA 2WNLA 2WZYA 1OEDC 2XQ8A 4QACA 2BG9C 2YN6A 3ZKRA 4D01A 2VL0A 5J5FA 4QH5A 5IUXA 3IGQA 4UM3P 3U8NA 3UUBA 3WTHA 4EZ1A 2YOEA 5HEHA 1OEDE 2BJ0A 2BG9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEO A;  2XZ6 A;  2XQ3 A;  3EI0 A;  4A97 A;  3EAM A;  4ALX A;  3C84 A;  4XHE A;  1UX2 A;  4UM3 A;  3ZDG A;  4AFH A;  2XNV A;  2Y54 A;  2Y56 A;  4HQP A;  4Z90 A;  4BQT A;  4ZZB A;  2PGZ A;  1I9B A;  5HCJ A;  2W8F A;  4FRR A;  4UY2 A;  3U8K A;  5AFH A;  4X5T A;  5J5G A;  3WTJ A;  4UM3 S;  5KE4 A;  4ILA A;  2X00 D;  4QAA A;  4TWD A;  4ZK4 A;  3SQ9 A;  4B5D A;  4LMJ A;  4TWH A;  5AFM B;  2LLY A;  3SIO A;  5AFK A;  2LM2 A;  4IL4 A;  4BFQ A;  1OED A;  5TVC A;  5L4H A;  2BG9 A;  2M6I A;  4LML A;  3UU4 A;  4IL9 A;  4F8H A;  2KSR A;  4UM1 A;  3RIA A;  3UU5 A;  4PIR A;  4AFT A;  2YKS A;  2W8G A;  5SYO A;  4UXU A;  3LSV A;  4TWF A;  2XNT A;  4TNV A;  3RIF A;  3P50 A;  5HEG A;  3UU3 A;  2ZJU A;  2C9T A;  3JAD A;  4HFE A;  4COF A;  4HFD A;  2BR7 A;  2Y58 A;  4WV9 A;  2BYQ A;  3TLU A;  5J5H A;  3RQW A;  4HFI A;  4IRE A;  2UZ6 A;  4QAB A;  5BP0 A;  3TLV A;  2X00 A;  5LG3 A;  4NZB A;  2PH9 A;  2XNU A;  5CFB A;  4QH4 A;  2YME A;  4ZJS A;  4AFG A;  5CO5 A;  2LKG A;  3UU8 A;  3TLW A;  2BG9 B;  5KZU A;  4QH1 A;  4HFH A;  2XQA A;  2BYR A;  3U8M A;  3WTM A;  3WTN A;  5FJV A;  3JAF A;  3JAE A;  5L4E A;  4ZJT A;  3TLS A;  2XQ6 A;  4HFC A;  2YMD A;  4HFB A;  2XYT A;  3U8J A;  3UQ7 A;  2WN9 A;  3UQ4 A;  2XYS A;  3GUA A;  4ZRU A;  5J0Z A;  3WTK A;  3PMZ A;  2Y7Y A;  3U8L A;  2MAW A;  3RQU A;  4ILB A;  5L47 A;  3WTI A;  3SH1 A;  5AFM A;  2XQ4 A;  2BYS A;  2QC1 B;  5AFL A;  3TLT A;  4ZZC A;  2XQ5 A;  2WNC A;  3SQ6 A;  4ZK1 A;  3P4W A;  4TNW A;  5HEO A;  5JME A;  1OED B;  2ZJV A;  3WTL A;  5HCM A;  1UV6 A;  5BW2 A;  5HEJ A;  4LMK A;  3UU6 A;  3RI5 A;  2WNJ A;  2XQ7 A;  3WIP A;  4XK9 A;  5LXB A;  3EHZ A;  3WTO A;  5AIN A;  2BYN A;  2XQ9 A;  2BYP A;  3C79 A;  4NPP A;  5AFJ A;  5J5I A;  2BR8 A;  3ZDH A;  5BRX A;  3RHW A;  4ZR6 A;  1UW6 A;  4Z91 A;  2Y57 A;  4A98 A;  2LKH A;  2XZ5 A;  3T4M A;  4DBM A;  5AFN A;  4ILC A;  2M6B A;  5HEU A;  2WNL A;  2WZY A;  1OED C;  2XQ8 A;  4QAC A;  2BG9 C;  2YN6 A;  3ZKR A;  4D01 A;  2VL0 A;  5J5F A;  4QH5 A;  5IUX A;  3IGQ A;  4UM3 P;  3U8N A;  3UUB A;  3WTH A;  4EZ1 A;  2YOE A;  5HEH A;  1OED E;  2BJ0 A;  2BG9 E; 
#chains in the Genus database with same CATH topology
 3K8P C;  3Q5D A;  3RC3 A;  4I4T E;  2JRK A;  4IE0 A;  5AQO B;  5AFU L;  5LHG B;  5AQS B;  2V26 A;  3MXZ A;  5JDF A;  4CQI A;  5HXS A;  4MHC A;  3E08 A;  4TWD A;  4ZK4 A;  5AFM B;  5LA6 E;  2XZE A;  3SIO A;  1CUN A;  5C3J A;  5JDQ A;  3PUA A;  2BS2 A;  3VR8 A;  3AE4 A;  5JTG A;  5HEG A;  3NZP A;  4K0K T;  2V7I A;  3RH3 A;  3UUX B;  4AIU A;  2NOX A;  2C5I T;  4UV8 B;  2L9Q A;  3Q2M A;  1SE7 A;  1W09 A;  2W67 A;  3CQG B;  2LT3 A;  4X65 T;  4GOU A;  3WTM A;  2D9D A;  2XYS A;  4KMC A;  2N1G A;  4X1I E;  1EZ3 A;  3H3A A;  2Y7Y A;  2MAW A;  4ADZ A;  1ZEE A;  5FY7 A;  4A5X A;  4HN9 A;  5CB4 E;  4HKA A;  3VKG A;  1WYC A;  4X20 E;  3RPU A;  4AQY T;  3Q9D A;  4JLE A;  1Z0P A;  5BR8 T;  4GYS A;  4TZ4 C;  5HEO A;  4PK6 A;  1MND A;  3B5M A;  3C4W A;  2CHO A;  5JVD E;  4LF4 T;  4X62 T;  2QVA A;  3MA9 A;  2B1E A;  4X64 T;  4Z91 A;  4UV9 B;  4HGA A;  4AQF C;  3ZT6 A;  3KV4 A;  2IUB A;  3FZM B;  1JNZ A;  4UM3 P;  2D0U A;  4N78 D;  2YOE A;  2XZ6 A;  1S35 A;  5L3G B;  3EI0 A;  2N2N A;  3N9M A;  4P0A A;  4UY2 A;  4DV0 T;  4NXN T;  1XZY A;  4NXM T;  4ILU A;  2X00 D;  4HWD A;  5F5W A;  3E0Z A;  5FP3 A;  5E0O A;  1KK7 A;  4IL4 A;  2V7M A;  3HKD E;  4UM1 A;  1D0Y A;  2WZH A;  4GKJ T;  5LCY A;  2WBL A;  2LE8 A;  1FMV A;  2H7V C;  3KBT A;  3LSV A;  4TWF A;  1MIV A;  1ZHC A;  5LBQ B;  4QXH B;  2K9A A;  3UU3 A;  3AAE B;  2ZM6 T;  4DMV A;  4DR1 T;  1BR0 A;  3O1J A;  3PUS A;  3TLW A;  4HFH A;  3B13 A;  4QHO A;  3U8M A;  5FJV A;  2M67 A;  1UX5 A;  2NP9 A;  4HFC A;  5AQH B;  2E9X C;  1U5P A;  2QGS A;  2LSG A;  2E9X A;  4FJO A;  4LFA T;  4X66 T;  2XPK A;  4JYA T;  3HKB E;  5DQW A;  4NUU A;  1Y64 B;  4ZZC A;  1VCT A;  5JR9 A;  4MFR A;  5JH7 E;  4FI5 A;  4UIG A;  2A9U A;  2UXX B;  2YDS A;  5JME A;  4JI1 T;  4JI7 T;  5BW2 A;  3RI5 A;  2NR4 A;  4UEM A;  4EIW A;  3I9W A;  3GN5 A;  2KLQ A;  5LXB A;  2MPK A;  4G63 A;  1I6Z A;  3ANW A;  4NPP A;  5J5I A;  3OJA A;  1ZP0 A;  2WMN A;  4DBM A;  2M6B A;  2PTF A;  3QC9 A;  4WNK A;  1YW0 A;  3CPZ A;  5DAB A;  3GWH A;  4YY3 T;  5HEH A;  2BG9 E;  1IJ6 A;  5AQG B;  3H37 A;  2CRB A;  2WWU A;  1UUS A;  2A3D A;  3WTJ A;  3F31 A;  3KVA A;  3RKO A;  3MKD A;  1D0Z A;  4TWH A;  2BVL A;  3UU4 A;  4LML A;  2VKO A;  2D2S A;  3UU5 A;  2ACX A;  2WSS V;  5JRE A;  4L9I A;  3GMI A;  3AE1 A;  1UX4 A;  3PUX F;  5FVL A;  3ZYK A;  4YJ2 E;  4HFE A;  2BYQ A;  2V7K A;  1Y01 A;  3NBX X;  5H6Q B;  4O4H E;  3AA1 B;  1E1H B;  3A7M A;  4ZEY A;  2FJB A;  2XAS B;  5FY1 A;  5AFM A;  4YHH T;  2MYS A;  4LF8 T;  2CLY B;  4U3C A;  5AFL A;  4DR6 T;  3RRW A;  2D0T A;  3IEE A;  2XAQ B;  1OED B;  5HCM A;  5HEJ A;  2QA7 A;  5FXZ A;  2XUE A;  4IE4 A;  5ABE A;  2V1D B;  1KFY A;  3SS1 A;  2L8K A;  5BRX A;  4DR4 T;  4ZR6 A;  2KWI B;  5AQT B;  3SOL A;  1YXR A;  2WY2 A;  1FEW A;  4BAY B;  3OBV E;  4UF0 A;  3AAI A;  3QOF A;  3RRC A;  4QH5 A;  4B3M T;  2CXL A;  2YIN A;  3O4X E;  2YDR A;  3DP7 A;  2Y6X A;  1UX2 A;  3ZST A;  3ZDG A;  1J1J A;  4HQP A;  3LK3 B;  2I6H A;  3U8K A;  2BS3 A;  5AFH A;  4JUY A;  2VQF T;  4M1P A;  4DV1 T;  4YTP A;  2JQH A;  4LFB T;  2Z6E A;  5TVC A;  5L4H A;  2UXC T;  5DJQ C;  3RYF E;  4YSY A;  4AFT A;  3SWH A;  1QUU A;  3I0O A;  4DR5 T;  4P1N A;  5KMG P;  3BQK A;  1HFA A;  3PUQ A;  2CBJ A;  1YKH B;  2FUP A;  2CWO A;  4DV2 T;  2X00 A;  2JJ9 A;  2ZMA A;  5TAO A;  4QXB B;  4OX9 T;  4JEH B;  4X1K E;  4H9Q C;  5FY0 A;  2UU9 T;  3DJB A;  5J0Z A;  3PMZ A;  3LBX B;  3T1H T;  4EOZ B;  4J2C A;  1HNZ T;  1MMD A;  3V5S A;  4TN7 B;  1VCS A;  3CX7 B;  2XSB A;  3AEC A;  3CML A;  3HR0 A;  1LKX A;  4JEU B;  3ZC0 A;  4DBR A;  4P0B A;  4IDN A;  4AKH A;  3ONL C;  3QUJ A;  2VKD A;  2XZ5 A;  5LGU B;  3O1H A;  3FHN A;  2MTQ A;  2NW8 A;  2YMD A;  2IIU A;  2WB5 A;  2DCF A;  2OV9 A;  4O4J E;  2XTL A;  1OXZ A;  4QXC B;  2Y54 A;  3PUG A;  1LRZ A;  4HWI B;  4I43 B;  3K1S A;  3ZT5 A;  4QAA A;  4WBO A;  1D1A A;  4PJM A;  4UEL A;  4JI3 T;  3OYZ A;  4AIS A;  2WU5 A;  4CZZ B;  1W9R A;  3T1Y T;  4B3R T;  2YKS A;  3AA7 B;  2C5K T;  3VKH A;  3AE7 A;  3GA8 A;  3JAD A;  2JMK A;  3C98 B;  1Z8U A;  3TLV A;  4EZ4 A;  1HF8 A;  4CXY A;  3WTN A;  2FJE A;  5AQV B;  3UT5 E;  2DNX A;  3U8J A;  2I0M A;  4KP3 C;  2JQK A;  2KZ7 B;  2LSY A;  4U2Y A;  3SH1 A;  3KDS E;  4I55 E;  5L3E B;  3VU7 H;  2BS4 A;  3AE2 A;  3AEG A;  1VRB A;  1HR0 T;  2DL1 A;  1SUM B;  1WR0 A;  4ERR A;  4XZC A;  4EYY R;  3ZDH A;  1IAP A;  3PUR A;  1WR6 A;  4U74 A;  1S94 A;  4GKK T;  1UUR A;  2WZY A;  5JRC B;  4D01 A;  3ZLI A;  5ABG A;  4IST A;  5J2U E;  2RA1 A;  4KUM B;  2V7L A;  2AXD S;  4YHJ A;  2XNV A;  4I50 E;  4JI6 T;  2CLY C;  2W2U A;  5J5G A;  4OYK A;  1W0A A;  3ZEF B;  1OED A;  2KSR A;  2V6Y B;  1DU2 A;  3ZMS B;  3UUN A;  1M62 A;  2FJA A;  3AB3 B;  4CI1 B;  4WW0 A;  2IDO B;  4EGW A;  2XJ7 A;  3QB5 K;  4DV5 T;  1YQ4 A;  1ZV4 X;  4YFS A;  1T8B A;  4AFG A;  3V5U A;  1KNP A;  2BYR A;  4YTN A;  2CBI A;  3RX6 A;  2P9B A;  5BMV E;  2XYT A;  4KHZ F;  3FB2 A;  2YDQ A;  3AE8 A;  3LK2 B;  4TUY E;  2XQ4 A;  4CN4 A;  3VRB A;  2H88 A;  5LHI B;  2WNJ A;  2UXD T;  5HWX A;  3N9L A;  2IAK A;  5CA0 E;  5FVK A;  5HEU A;  1WRD A;  4JV5 T;  4YLH A;  2OLT A;  1QSD A;  2W00 A;  2G0U A;  4DBQ A;  1GQE A;  2E2A A;  2YK0 A;  4IDQ A;  1FMW A;  4IE6 A;  5HAX A;  3LBX A;  4EAH A;  1NAF A;  4DV7 T;  1I9B A;  2W8F A;  3NVO A;  4QKN A;  3CX8 B;  1HTJ F;  4LMJ A;  2VAS A;  2LSK A;  3KVB A;  5AFK A;  3AED A;  1FIO A;  5LMN T;  4AQF A;  3RIA A;  4ZI2 C;  2EHO C;  3EAB A;  1FJG T;  5IYZ E;  5SYO A;  3N2O A;  2UXN B;  4A56 A;  3RIF A;  5FXV A;  4DID B;  3UFE A;  5JDH A;  1CHU A;  1W0B A;  5LG3 A;  3FZH B;  2QYW A;  4UR9 A;  5EZY E;  2BG9 B;  5HWY A;  1AJ3 A;  2Q9Q B;  5F8P A;  4HE8 A;  5LB7 B;  5FXX A;  4MLK A;  4DV3 T;  4H9R C;  3VRA A;  2W0G A;  3ZYM A;  4OHF A;  4O4L E;  5ABF A;  2UUB T;  3I1A A;  2Q9Q D;  4TNW A;  3HKC E;  2C5J A;  3LK4 2;  4KBM B;  2C0S A;  4EYU A;  3RLF F;  3ZC1 A;  1ZKE A;  2K48 A;  5AFJ A;  4CXW A;  2ODV A;  2FJD A;  3AE3 A;  2HN1 A;  4QAC A;  2H89 A;  4PW8 A;  1HCI A;  2VL0 A;  2V8S V;  3F2E A;  4EB6 E;  4A97 A;  5CA1 E;  1U4Q A;  2WP9 A;  4GIW A;  1HX8 A;  3KV6 A;  3PJA A;  3L8R A;  4CI2 B;  1HG5 A;  4TV8 E;  5FNV E;  3QB5 A;  4IL9 A;  4U33 A;  1N32 T;  1XWM A;  3AEF A;  3RIU C;  5CJ5 A;  4YT0 A;  2JQ9 A;  5J2T E;  3AEE A;  2W8G A;  3Q5E A;  4WV9 A;  2MBG A;  2X67 A;  4WZX A;  4HFI A;  5AQP B;  4U2Z A;  4CN1 A;  4H9P C;  2LKG A;  2CEA A;  3JAE A;  5L4E A;  4AXP A;  4MAL A;  1XNQ T;  3P4P A;  3UQ7 A;  5LP6 E;  2CM0 A;  2IML A;  1D1C A;  2GK9 A;  4OK0 A;  5HXR A;  2UXB T;  2X9X A;  3FXE B;  4B6X A;  4ZXL A;  3UU6 A;  2KT9 A;  3C4X A;  2Y48 B;  3LDQ B;  2WNL A;  2WDV A;  2A72 A;  2YN6 A;  2F4V T;  5LNK A;  4IDP A;  4K0U A;  2XQ3 A;  5JQG E;  4XHE A;  5AQI B;  4V1A v;  4YSX A;  2VKJ A;  4UM3 S;  2ZM2 A;  2W4X A;  3N9N A;  5C8Y E;  2LLY A;  2V7J A;  2HH7 A;  3VR9 A;  4DR3 T;  3PUW F;  2YU2 A;  3P4S A;  2W66 A;  1HG2 A;  3J9X 1;  4AKG A;  3NRY A;  2VVN A;  4UXU A;  1XMQ T;  4JBW F;  5KDM C;  4TNV A;  2CXF A;  2LHN A;  4BJN A;  2PH9 A;  4DND A;  5LHH B;  2VKH A;  3WAJ A;  2XQA A;  4IE7 A;  4HEA A;  1YQ3 A;  3SRZ A;  4LF9 T;  4ZI3 C;  2VVS A;  4IDZ A;  3WTI A;  1HNW T;  3KBU A;  5IWA T;  4ZK1 A;  5AQM B;  4BJM A;  1HS7 A;  3IBP A;  4EED A;  5FKY A;  2K3W A;  3Q5X A;  3EHZ A;  2LSI A;  3AAA B;  2UUC T;  2BYP A;  3C79 A;  3ZYL A;  2VL8 A;  2LKH A;  2BG9 C;  5LXT E;  5J5F A;  1M7K A;  4YTM A;  2Q9Q C;  3IGQ A;  4AQG A;  1OED E;  2Q9Q A;  3PEO A;  4PJN A;  4KI0 F;  3FZL B;  3PUY F;  1L0V A;  1KEY A;  4GK5 E;  2ZM0 A;  2K5B B;  2XAJ B;  2JMH A;  2ES0 A;  2EHO B;  2IC9 A;  2J1D G;  4DUY T;  2IW5 B;  5EK2 A;  3UFG A;  2BDE A;  2XHE B;  4JI4 T;  1XDP A;  2VWA A;  4ZI2 D;  2B76 A;  2WMO A;  3FBL A;  2EHO D;  3OKQ A;  4EZH A;  2V5D A;  3P50 A;  4DVD A;  3ETV A;  5IHY A;  2JPF A;  3UUM A;  4ASK A;  4QAB A;  3KFW X;  4NUV A;  3L3P A;  3AE9 A;  5KX5 E;  3ETU A;  5EK4 A;  2IC6 A;  2VQE T;  3C50 A;  5AQU B;  3DTO A;  1OWA A;  2HHH T;  4HWC A;  3UQ4 A;  4KHP T;  4ZRU A;  3QK6 A;  1N36 T;  5LMU T;  3CK6 A;  4YJ3 E;  2WAU A;  4P09 A;  3P4Q A;  4ZS3 A;  3NKZ A;  2XQ5 A;  3N5L A;  3ZCJ A;  3J7Y q;  2XAG B;  5C2T A;  5ADX L;  2XQ7 A;  5L3C B;  3WIP A;  3C64 A;  3P8C D;  5AIN A;  4H9S E;  2BR8 A;  5A1L A;  3RHW A;  4U7I A;  2J47 A;  4ILC A;  4QX8 B;  1I94 T;  2V6X A;  5LJN A;  3OTO T;  5IUX A;  3U8N A;  5JR9 B;  3ZJ1 A;  3ZMZ B;  4ANJ A;  4BQT A;  3GN5 B;  4IGU A;  4FRR A;  4X5T A;  2BZB A;  2KIN B;  2N9D A;  5DQV A;  3ZT7 A;  1MIW A;  3SQ9 A;  4ZOL E;  4WYV A;  4U7Y A;  2JIW A;  3LFM A;  3SFD A;  2NWB A;  4O4I E;  2NW9 A;  3AVR A;  5KXJ A;  1T7S A;  5LBM A;  2PJQ A;  1R8I A;  3EDV A;  3R84 B;  5FMN A;  3OYX A;  1NEN A;  2ZJU A;  3K3O A;  4HFD A;  2OA5 A;  4PFO A;  5J5H A;  5J1G A;  2UZ6 A;  4IRE A;  4WBN E;  3WAK A;  4NZB A;  3NWI A;  5CFB A;  4UXN B;  4B3S T;  3UU8 A;  4PJJ A;  1E2A A;  4UVA B;  1WLX A;  3L09 A;  2WN9 A;  3GUA A;  3WTK A;  1H7C A;  1WYB A;  3PV0 F;  3ZMV B;  3HI2 A;  4H63 V;  4ILB A;  5L47 A;  1NEK A;  3UUL A;  2RP4 A;  1XMO T;  3N2G E;  5HXE A;  3S4U A;  2CCQ A;  5AQN B;  1T98 A;  1YKE B;  5M4Y A;  5JDG A;  3SQ6 A;  3R6N A;  4IIJ E;  2SPC A;  3AA6 B;  3QNU A;  4TX5 A;  4AKR B;  3WTO A;  4ISS A;  1QLB A;  3PU3 A;  2Y57 A;  2X0H A;  2WU2 A;  5FYM A;  3LG7 A;  4ZS2 A;  2YU1 A;  2AE9 A;  1X9B A;  3N9P A;  5GON E;  4EZ1 A;  2A2F X;  4PAG A;  3EAM A;  4AFH A;  2Y56 A;  3IHR A;  4Z90 A;  1D0X A;  1VOM A;  3O9X A;  1B7T A;  1MMN A;  1MNE A;  2L3L A;  2PG8 A;  2LM2 A;  4UF0 B;  5LGT B;  2X68 A;  5JDM A;  3LJC A;  2M6I A;  3MAC A;  3AEB A;  4PFP A;  2LEH A;  2WDQ A;  1BR1 A;  2ACZ A;  4F6R C;  3HL6 A;  3HKE E;  3KV9 A;  2XNT A;  5JDL A;  4COF A;  2DWG A;  3ESL A;  2W63 A;  5L3D B;  3PU8 A;  2E5L T;  2X9W A;  4QH4 A;  2HPL A;  3PUZ F;  4ZJS A;  3ZMU B;  5CO5 A;  4QH1 A;  2DWK A;  2WWV A;  4DUZ T;  3ZMT B;  4LFC T;  4DV6 T;  1J5E T;  1XNR T;  2EHO A;  3U78 A;  2W62 A;  1MIY A;  3K3Q C;  4ZI3 D;  4JI5 T;  3AXJ B;  4U72 A;  3AE5 A;  2NTX A;  3ZCI A;  2X66 A;  3K3N A;  2VUR A;  2X0L B;  1HX1 B;  4XAX B;  1UV6 A;  5HXH A;  4KX6 A;  2BBH A;  1KNZ A;  4A98 A;  3AE6 A;  5LYJ E;  5AFN A;  3JCF A;  3PUV F;  1LVF A;  3JC6 C;  3L39 A;  3C84 A;  3G06 A;  4LF7 T;  4UM3 A;  3N9O A;  2BKP A;  3D0T A;  2PGZ A;  2PFV A;  3T8O A;  2R6G F;  1LVK A;  2KND A;  1G73 A;  2LRL A;  4E7Z A;  4CN6 A;  4DR7 T;  5LJM A;  2WQY A;  2LJL A;  5L2L A;  4O2B E;  3AA0 B;  2WCA A;  1N33 T;  3CVR A;  3ZPO A;  3EDU A;  4H9N C;  4OYJ A;  1IBK T;  2YEV C;  3MZK B;  3CKD A;  5JR9 C;  3RQW A;  3M65 A;  4L5G A;  2YME A;  4Z8X A;  1J5W A;  5KZU A;  3C4Z A;  4AKL A;  3TLS A;  4ZJT A;  3RIU A;  5AQQ B;  4HFB A;  5L3B B;  2X51 A;  3FZK B;  2H7O A;  2WDR A;  5JRC A;  1XDO A;  2BYS A;  2QC1 B;  4EEB A;  3ZSS A;  3TLT A;  2XM1 A;  1YD8 G;  1V9D A;  3VHL A;  4ZHQ E;  3WTL A;  4IE5 A;  2CXD A;  2H3R A;  1IBM T;  2CE7 A;  4LMK A;  3O1I A;  2X0Y A;  4DMW A;  2I59 A;  2J62 A;  1IBL T;  2D5U A;  2JQQ A;  2WM9 A;  3EVY A;  2XQ8 A;  3FBZ A;  3M3Z B;  2V6Y A;  3WTH A;  2LRK A;  3A8Y C;  4CI3 B;  4ALX A;  3OPC A;  3WI3 A;  4U31 A;  3U3I A;  4ZZB A;  2X9H A;  2DI4 A;  4ZI7 E;  4MBQ A;  5HYA A;  5KE4 A;  3BK9 A;  4B5D A;  2XY8 B;  2ODU A;  4C91 A;  5AQJ B;  1IZN B;  4L0R A;  3HA4 A;  2MOZ A;  2V5C A;  3I0Q A;  3RYC E;  2WS3 A;  3CQC B;  4QX7 B;  3RYI E;  5H6R B;  3IF8 B;  1UK5 A;  2CMR A;  3TKL B;  2NTY A;  3FXD B;  3C51 A;  3AEA A;  1N34 T;  3KIN B;  4AKI A;  4HTE A;  1KF6 A;  5JDN A;  4EXT A;  2VK9 A;  3MK7 C;  3PDY A;  2KMF A;  3X1D A;  5FL0 A;  2WZI A;  4E7S A;  4UVB B;  3PJA J;  4NIQ A;  2LM9 A;  2BKO A;  4UVC B;  1UW6 A;  5AQF B;  3T4M A;  2XAH B;  4X1Y E;  3P4R A;  3IA3 A;  3PE0 A;  4XBF B;  1O3X A;  5AQL B;  3RC8 A;  1MMG A;  1SA0 E;  3CWZ B;  1IJ5 A;  3KV5 A;  5F3J A;  2IHR 1;  3AXJ A;  4HWF A;  3RKG A;  4PK5 A;  2XAF B;  2XQY A;  3A5X A;  3PTR B;  1WFD A;  2ZM8 A;  3N9Q A;  2KXP B;  5LOV E;  2BG9 A;  1WCR A;  4F8H A;  2UUA T;  5CGM A;  5EK3 A;  5FXW A;  1X79 A;  2PBI A;  1D1B A;  4H9O C;  1SHZ C;  3BQL A;  4TV9 E;  1BR4 A;  3CQX C;  3ABV A;  2BVM A;  4HWH A;  3EUH A;  3RGL A;  4CXX A;  3JAF A;  4DO0 A;  3B57 A;  4JI0 T;  3ZJ2 A;  2RPA A;  4LF6 T;  3BQI A;  4YXD A;  2LOP A;  5AQR B;  2WNC A;  1T72 A;  3P4W A;  2DHR A;  2LHR A;  4LF5 T;  2ZLY A;  3CX6 B;  1KNR A;  3AVS A;  4IT4 A;  2J4G A;  3W15 B;  4GK0 E;  3N2K E;  2BBJ A;  2XM2 A;  4BA9 A;  2E8I A;  4PNI A;  2Y8D A;  2LOS A;  5AQK B;  2XSA A;  3JC6 D;  5ABF B;  1UCU A;  3H3M A;  2CHN A;  4GYR A;  2LSJ A;  4JI2 T;  3CIR A;  3NZQ A;  5HXC A;  3ZN1 B;  2E5V A;  3OVU A;  5HCJ A;  4AI6 A;  4JI8 T;  1E7P A;  4ILA A;  2FBW A;  2E9X B;  2KWH A;  1MMA A;  1NWM X;  4BFQ A;  1HNX T;  3E22 E;  5ETW A;  2QRX A;  4G2A A;  4PIR A;  3Q5W A;  3MJX A;  4IDO A;  5L3F B;  5FL1 A;  4I0U A;  1UGO A;  2E9X D;  4Q25 A;  4OFZ A;  3ONX A;  4IHJ E;  2C9T A;  2Y58 A;  2BR7 A;  3ANW B;  3TLU A;  5BP0 A;  1JNR A;  2XNU A;  4HFV A;  4B3T T;  3UTK A;  4H63 H;  5ABH A;  1US7 B;  1ZOY A;  2XQ6 A;  3U8L A;  1BR2 A;  3RQU A;  4QWN B;  2DLR A;  2BKN A;  2VB6 A;  3RF1 A;  3ZN0 B;  4O2A E;  2HPJ A;  3SFE A;  4DV4 T;  3F57 A;  2CPT A;  3FZF B;  2ZJV A;  2CWY A;  2K24 A;  4XK9 A;  2BYN A;  2XQ9 A;  4PJL A;  5LG4 A;  4PK4 A;  2X9Y A;  3NRX A;  4C90 A;  4DR2 T;  1OED C;  4YSZ A;  3ZKR A;  2CA5 A;  4O8S A;  3P7I A;  3ONJ A;  3RYH E;  2HN2 A;  3I9Y A;  2NW7 A;  3UUB A;  2W61 A;  4EV6 A;  5LGN B;  2BJ0 A;  1G8X A; 
#chains in the Genus database with same CATH homology
 3PEO A;  2XZ6 A;  2XQ3 A;  3EI0 A;  4A97 A;  3EAM A;  4ALX A;  3C84 A;  4XHE A;  1UX2 A;  4UM3 A;  3ZDG A;  4AFH A;  2XNV A;  2Y54 A;  2Y56 A;  4HQP A;  4Z90 A;  4BQT A;  4ZZB A;  2PGZ A;  1I9B A;  5HCJ A;  2W8F A;  4FRR A;  4UY2 A;  3U8K A;  5AFH A;  4X5T A;  5J5G A;  3WTJ A;  4UM3 S;  5KE4 A;  4ILA A;  2X00 D;  4QAA A;  4TWD A;  4ZK4 A;  3SQ9 A;  4B5D A;  4LMJ A;  4TWH A;  5AFM B;  2LLY A;  3SIO A;  5AFK A;  2LM2 A;  4IL4 A;  4BFQ A;  1OED A;  5TVC A;  5L4H A;  2BG9 A;  2M6I A;  4LML A;  3UU4 A;  4IL9 A;  4F8H A;  2KSR A;  4UM1 A;  3RIA A;  3UU5 A;  4PIR A;  4AFT A;  2YKS A;  2W8G A;  5SYO A;  4UXU A;  3LSV A;  4TWF A;  2XNT A;  4TNV A;  3RIF A;  3P50 A;  5HEG A;  3UU3 A;  2ZJU A;  2C9T A;  3JAD A;  4HFE A;  4COF A;  4HFD A;  2BR7 A;  2Y58 A;  4WV9 A;  2BYQ A;  3TLU A;  5J5H A;  3RQW A;  4HFI A;  4IRE A;  2UZ6 A;  4QAB A;  5BP0 A;  3TLV A;  2X00 A;  5LG3 A;  4NZB A;  2PH9 A;  2XNU A;  5CFB A;  4QH4 A;  2YME A;  4ZJS A;  4AFG A;  5CO5 A;  2LKG A;  3UU8 A;  3TLW A;  2BG9 B;  5KZU A;  4QH1 A;  4HFH A;  2XQA A;  2BYR A;  3U8M A;  3WTM A;  3WTN A;  5FJV A;  3JAF A;  3JAE A;  5L4E A;  4ZJT A;  3TLS A;  2XQ6 A;  4HFC A;  2YMD A;  4HFB A;  2XYT A;  3U8J A;  3UQ7 A;  2WN9 A;  3UQ4 A;  2XYS A;  3GUA A;  4ZRU A;  5J0Z A;  3WTK A;  3PMZ A;  2Y7Y A;  3U8L A;  2MAW A;  3RQU A;  4ILB A;  5L47 A;  3WTI A;  3SH1 A;  5AFM A;  2XQ4 A;  2BYS A;  2QC1 B;  5AFL A;  3TLT A;  4ZZC A;  2XQ5 A;  2WNC A;  3SQ6 A;  4ZK1 A;  3P4W A;  4TNW A;  5HEO A;  5JME A;  1OED B;  2ZJV A;  3WTL A;  5HCM A;  1UV6 A;  5BW2 A;  5HEJ A;  4LMK A;  3UU6 A;  3RI5 A;  2WNJ A;  2XQ7 A;  3WIP A;  4XK9 A;  5LXB A;  3EHZ A;  3WTO A;  5AIN A;  2BYN A;  2XQ9 A;  2BYP A;  3C79 A;  4NPP A;  5AFJ A;  5J5I A;  2BR8 A;  3ZDH A;  5BRX A;  3RHW A;  4ZR6 A;  1UW6 A;  4Z91 A;  2Y57 A;  4A98 A;  2LKH A;  2XZ5 A;  3T4M A;  4DBM A;  5AFN A;  4ILC A;  2M6B A;  5HEU A;  2WNL A;  2WZY A;  1OED C;  2XQ8 A;  4QAC A;  2BG9 C;  2YN6 A;  3ZKR A;  4D01 A;  2VL0 A;  5J5F A;  4QH5 A;  5IUX A;  3IGQ A;  4UM3 P;  3U8N A;  3UUB A;  3WTH A;  4EZ1 A;  2YOE A;  5HEH A;  1OED E;  2BJ0 A;  2BG9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...