4LMKA

Glic liganded-closed-channel conformation, mutant y27'a
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPAMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gating of the proton-gated ion channel from Gloeobacter violaceus at pH 4 as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 90
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4lmkA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4lmkA01
4UM3P 2BYRA 3ZKRA 1UW6A 4ILAA 4QH4A 5IUXA 2Y54A 2BR7A 3WTHA 3UQ4A 3TLVA 3U8KA 3UUBA 3SH1A 5JMEA 3RQWA 2BYPA 4ZZCA 2PH9A 3RI5A 3SQ9A 2BYNA 2YKSA 4HFCA 4NPPA 3WTOA 4HFHA 4ZK4A 2XZ6A 3UU8A 2BJ0A 2XQ6A 2M6BA 5J5FA 4LMLA 2ZJUA 2WNLA 3P50A 4IL4A 2X00A 5HEOA 2ZJVA 5KZUA 2W8GA 2C9TA 5L4HA 2LM2A 3ZDGA 5HCMA 5AFMB 3SIOA 3EHZA 1OEDA 4NZBA 4LMKA 3GUAA 5AFMA 1OEDB 4LMJA 5L4EA 5FJVA 5LG3A 2BR8A 2X00D 2LKHA 4QH1A 3RHWA 4PIRA 4XK9A 3UU3A 5CO5A 5AINA 2YMEA 4TWFA 4AFGA 2BG9A 2XQ7A 4AFTA 2XQAA 5HEJA 2XYTA 3RIAA 2BG9B 5HEGA 2MAWA 3U8JA 4QABA 4B5DA 2QC1B 3LSVA 2Y57A 3T4MA 4IREA 5J0ZA 3PEOA 3UU6A 3WTLA 2YN6A 2WNJA 4ZZBA 5CFBA 4HQPA 4UXUA 1OEDE 2XQ3A 4HFBA 3UQ7A 2XQ9A 2Y56A 4HFDA 4UY2A 4BQTA 4EZ1A 2XQ8A 2BG9C 4HFEA 4ZJTA 3JAFA 5AFNA 5AFHA 2WN9A 3WTMA 1UX2A 3TLUA 4ALXA 2XQ4A 3TLWA 2YOEA 5HEUA 2BG9E 4ZJSA 2UZ6A 3TLSA 5BW2A 3C84A 3RIFA 3C79A 4QH5A 3WTNA 3EI0A 3SQ6A 3EAMA 3WIPA 3WTJA 3ZDHA 2PGZA 4Z91A 3U8NA 4AFHA 4UM3S 4A97A 4QACA 4UM3A 1UV6A 4HFIA 3U8MA 4ZK1A 5BP0A 3JAEA 5J5GA 3UU4A 3WTKA 2BYSA 3U8LA 4IL9A 2M6IA 5BRXA 3IGQA 2XNVA 5J5IA 4TNWA 4TNVA 4UM1A 5J5HA 4ILCA 2VL0A 2XQ5A 5LXBA 3TLTA 4F8HA 3UU5A 3RQUA 2BYQA 4QAAA 3PMZA 2LKGA 1I9BA 2WZYA 5SYOA 4COFA 2XNUA 2XZ5A 2LLYA 4DBMA 2KSRA 4ILBA 5AFKA 5KE4A 2XNTA 4A98A 5L47A 2W8FA 2Y7YA 5HCJA 2YMDA 4D01A 4ZR6A 3WTIA 4WV9A 5TVCA 5HEHA 4X5TA 4TWHA 2WNCA 2XYSA 4BFQA 5AFLA 4XHEA 4TWDA 5AFJA 4FRRA 3JADA 3P4WA 4Z90A 4ZRUA 2Y58A 1OEDC
chains in the Genus database with same CATH superfamily
4AI6A 4I0UA 4CI3B 2LSIA 3PUVF 3SH1A 3RQWA 3AE3A 4EIWA 4NPPA 4E7ZA 2Q9QD 2X68A 2XAGB 3ZJ1A 4B6XA 3P50A 3ZN1B 5LMUT 2W8GA 5HXRA 2IHR1 1OEDA 2WS3A 5E0OA 5FJVA 4CXYA 2CWOA 3ZJ2A 3CQGB 3N2GE 1N36T 4QX7B 4AFTA 3SOLA 4IDPA 2QVAA 1IBLT 3HKEE 2A3DA 3J9X1 2W2UA 5J0ZA 3PEOA 2XPKA 1UK5A 3WTLA 5CFBA 3ZC0A 3CVRA 4DUZT 3T1HT 2YDSA 2QRXA 4P1NA 5HEUA 3U3IA 5LHGB 5FXZA 3OYXA 5BW2A 1XZYA 4CN4A 3N9LA 2ZM8A 3S4UA 5JR9B 4UM3S 4QACA 4UM3A 4JI5T 2L9QA 5KDMC 4DV6T 1NAFA 3K8PC 3H3AA 3AA1B 4ISTA 2IDOB 4FJOA 4QKNA 4TNVA 1J5ET 1NWMX 2XQ5A 5FVKA 5LXBA 2JQ9A 5AFKA 5FNVE 4AISA 4L0RA 4U72A 1X79A 3MK7C 4CXWA 3Q5EA 3RYIE 4ISSA 3QK6A 2BR7A 2WWVA 3WTHA 3TLVA 4U7YA 3O4XE 4JV5T 1IZNB 2VQFT 2CXDA 3KV4A 3DTOA 2ZJUA 1KK7A 3B5MA 5KZUA 3O1JA 2LSJA 3UFGA 5BR8T 4LMJA 2LEHA 1JNRA 1VRBA 3RHWA 3LK3B 4DR1T 4X65T 3HA4A 1H7CA 2E8IA 2Q9QB 5JDQA 5AQFB 2WNJA 2ZMAA 3K3QC 2ZM0A 2KINB 4KMCA 5ABFB 4UV9B 4KHPT 2YDRA 4ALXA 2XQ4A 3TLWA 3DJBA 4JI4T 5LGUB 3OYZA 2K3WA 2Z6EA 1V9DA 3AEBA 2E9XD 5LBMA 4P0AA 3RRWA 1HG5A 3HI2A 3ZPOA 2N2NA 5BRXA 3UTKA 3IGQA 3C51A 1FEWA 3HL6A 1MNDA 4IE7A 2XNTA 5L47A 2XM1A 3WTIA 4X5TA 5AQHB 2JQHA 3N9NA 2V7MA 2JQKA 2K24A 2YEVC 3AE2A 3OJAA 5AQOB 3ZKRA 4QH4A 2CXFA 3CQCB 3AA0B 2PBIA 1ZKEA 2PH9A 3O1IA 3V5SA 1IBKT 2BKNA 2ZM2A 3JCFA 3QOFA 4JYAT 4PAGA 5HEOA 2ZJVA 1NENA 3KV6A 4CN1A 3ZDGA 4F6RC 3LK42 4O4JE 4QHOA 2HPJA 4NZBA 5AQUB 3GWHA 2XAJB 4H9QC 3CPZA 1OXZA 3L8RA 4IDZA 5LGNB 4KP3C 5JR9C 3FXDB 1CUNA 3MKDA 1OEDE 1IBMT 3JAFA 2N1GA 5EK4A 2YOEA 2BG9E 2KT9A 2FUPA 2D0UA 3CWZB 2CXLA 2LOSA 1OWAA 3EAMA 2X66A 1D1BA 4AQGA 5AQVB 4I4TE 4LF9T 4UM1A 5J5HA 4DIDB 4ZI3C 3RQUA 4PJMA 3PMZA 1Y01A 2AE9A 1D0ZA 5LYJE 2WZYA 2KSRA 4B3MT 5CA0E 2Y7YA 3P8CD 2YMDA 4WV9A 2W67A 4JLEA 4BFQA 2V1DB 4X62T 4L9IA 4ZRUA 5J1GA 1DU2A 1US7B 2BYNA 4U2YA 2NOXA 5LBQB 5FYMA 4X20E 3IA3A 3ZT6A 5L3EB 5L3DB 3Q5WA 3SIOA 3EHZA 2XTLA 3GUAA 3RYFE 3A5XA 4EB6E 2KNDA 4PIRA 5BMVE 4XK9A 3AE1A 5DQWA 3EUHA 4CI2B 5IYZE 2CRBA 3HKBE 4TUYE 2UUBT 4ZZBA 3UQ7A 3OPCA 4HFEA 4O2AE 4HKAA 4DR4T 5C3JA 4M1PA 1R8IA 3TLSA 3CIRA 1HX8A 2K48A 2PGZA 2NR4A 2V8SV 4LFCT 4GYSA 4JI8T 3JAEA 1X9BA 5AQLB 3NRXA 2M6IA 2PG8A 2BS4A 3N9PA 3FXEB 1BR1A 2LKGA 2CHOA 4AIUA 5HEHA 2XUEA 2CLYC 3CX8B 4XHEA 2NWBA 2WAUA 3ZEFB 4HE8A 4YJ3E 2DHRA 2BZBA 4KUMB 2D5UA 3UUBA 2BYPA 4YHHT 2VASA 3AEEA 2C5KT 5EK3A 3RIUC 4HFCA 4TN7B 4YSXA 3PDYA 2M67A 4MBQA 4HEAA 2JRKA 4K0KT 2LT3A 4ZOLE 5FY7A 2X9XA 5L2LA 5JRCA 1UURA 2RP4A 2VK9A 4EOZB 3AEGA 5HXSA 4YTPA 2QA7A 3KBUA 2V5DA 5AINA 4G2AA 3SS1A 4I50E 4TWFA 2WMOA 3NZQA 4KHZF 5A1LA 4UR9A 2WDVA 3ZYKA 3GMIA 3T4MA 3B13A 2UU9T 2CE7A 4E7SA 2XQ9A 1BR2A 2WB5A 4PNIA 1MMNA 5KXJA 3AAEB 3I9WA 3R84B 4V1Av 4EZ4A 1M62A 2MPKA 1HNZT 2NP9A 5F5WA 5ETWA 4MALA 4QH5A 2Y48B 1AJ3A 3SQ6A 3NVOA 4A97A 4HFIA 5FL1A 5BP0A 5HXEA 1D1CA 4LF5T 3UFEA 2RPAA 2JMHA 3ESLA 2LSYA 4HWDA 3ETVA 2GK9A 2XZ5A 1IJ5A 4PK6A 3N9QA 3C4XA 3CX7B 3C98B 4Z90A 4DMWA 3AXJA 2UUCT 3C50A 3BQKA 4AXPA 4PK5A 4JI0T 2YU2A 2A2FX 5LGTB 2PJQA 1LKXA 1J1JA 5HWYA 1HX1B 5JRCB 4UIGA 4G63A 4NXMT 4AKIA 4IDNA 4QH1A 2YMEA 2VKHA 2V7KA 2V6YB 4OHFA 3ZT5A 1I94T 2Y56A 4BQTA 3AA6B 2BVMA 2D9DA 5LNKA 3VR8A 3AVSA 3NWIA 3OBVE 2K9AA 4GOUA 4HWIB 3WTNA 5ABHA 1T98A 4Z91A 4AFHA 4YFSA 4IGUA 3GN5A 4H63V 4CXXA 4YY3T 4PK4A 3RPUA 3NBXX 4YTMA 3AE5A 1XMOT 3RYCE 1XMQT 4AKRB 2VL0A 1WYCA 3HKDE 3OTOT 4COFA 3PUXF 5AQNB 1VOMA 2H7OA 2JQQA 2WNCA 4DNDA 2J4GA 1UGOA 4IT4A 4O8SA 2Y58A 2I0MA 4GIWA 5FVLA 4EV6A 2OLTA 4DR6T 1FMVA 1WRDA 3ONJA 3SQ9A 3AEAA 4O4IE 4MHCA 2KWIB 2BKPA 4JEHB 5EK2A 4X1YE 2XHEB 2XSAA 3AEFA 3WAKA 2B1EA 1M7KA 4AQYT 4YTNA 5JDNA 2R6GF 2HN1A 2VURA 3RX6A 2UXXB 1IJ6A 4B3TT 5AQKB 1Z0PA 3E0ZA 3L09A 4ILUA 2X00D 4OK0A 5CO5A 3ZMZB 3DP7A 2XQ7A 2YINA 3IBPA 3LSVA 3RF1A 1T72A 5HAXA 4HFDA 4UY2A 2XQ8A 3ZYMA 4MFRA 4AQFC 2RA1A 2XJ7A 2LHRA 3H3MA 2XAFB 2VKDA 3RIFA 5KMGP 5J2UE 5IHYA 3WTJA 4LF6T 3IEEA 2DNXA 2KMFA 2CM0A 4WBOA 3K3OA 3W15B 2ODVA 2UXBT 4MLKA 1T8BA 3UU5A 4JI1T 4QAAA 3CQXC 2XNUA 3LBXA 4YSZA 3PJAA 3JC6D 4A98A 3C64A 5FP3A 4ZR6A 2DLRA 5AFLA 1SHZC 3EVYA 2W63A 3ZSSA 3JADA 1OEDC 5ADXL 2KXPB 2B76A 5F8PA 5F3JA 1W0BA 2HH7A 4XAXB 4WYVA 1HNWT 4ZXLA 5LMNT 1E7PA 2XQ6A 3N2KE 2X00A 1HFAA 5AQSB 2W00A 4IIJE 3FZHB 4PFPA 3ZSTA 4X64T 3VHLA 1OEDB 2CA5A 2LKHA 5ABFA 4ZS2A 4U33A 4UELA 2BG9B 1U4QA 4NXNT 1KF6A 4DV1T 2LSKA 3FZMB 4KX6A 3A7MA 2FJEA 1B7TA 2V6XA 1UX2A 1N32T 3J7Yq 3RIUA 1HTJF 3SFDA 4C91A 5LCYA 2HN2A 5JR9A 3EDVA 3EABA 4ZK1A 3UU4A 4HWHA 5JH7E 3MXZA 3FHNA 4ANJA 2LLYA 5LB7B 2NTXA 4OFZA 3RKOA 2Y8DA 5CJ5A 2E2AA 4DVDA 4TWDA 5AFJA 2C5IT 5IUXA 2Y54A 2CWYA 4DV2T 3JC6C 1W09A 2I59A 3M3ZB 3BQIA 2LM2A 2ZLYA 5IWAT 2YDQA 3NRYA 4OYJA 2W4XA 5TAOA 3AE7A 2BKOA 1W0AA 4ZEYA 5AQMB 4X1KE 2BG9A 3B57A 3IHRA 4UF0A 4TX5A 2QC1B 4JI7T 1HF8A 5AQTB 4P0BA 1YD8G 5AQIB 1HR0T 1KNZA 3P4PA 2V5CA 3SFEA 2BS2A 4P09A 4JBWF 4ZI3D 5C8YE 4QXHB 4ZHQE 1FIOA 1KNPA 4DMVA 1HS7A 3KVBA 2MOZA 4B3RT 2VWAA 3AVRA 3EDUA 3RGLA 3WIPA 4HWFA 2BDEA 3ZDHA 2J1DG 1MIWA 3ONLC 4KBMB 4TV9E 5EZYE 1T7SA 4DV5T 3U8LA 3N2OA 1WYBA 2E9XB 4GKKT 4TNWA 4DV7T 3ANWA 1I9BA 5KX5E 5SYOA 3OKQA 4UXNB 2H88A 3PE0A 3U8MA 3P4WA 4AQFA 5HXHA 5LA6E 3PUGA 2WU5A 2XSBA 1MIYA 2WBLA 3SRZA 3RI5A 4DBRA 5FKYA 2L8KA 5AQGB 3UU8A 2WNLA 3PUAA 4YT0A 4K0UA 2C9TA 3AAIA 5L4HA 4DR3T 2LSGA 2IUBA 2X9WA 2I6HA 2N9DA 4TZ4C 1YQ3A 4QXCB 2LHNA 2X0YA 1XWMA 1D0XA 4QWNB 2VL8A 3F2EA 2DL1A 2VQET 2MTQA 1E1HB 2DI4A 1MMGA 2YN6A 2FJAA 3I0OA 4EZ1A 4BJMA 1JNZA 2X67A 3ZN0B 4B3ST 5AFNA 1FMWA 4YJ2E 3UUMA 4O2BE 2IW5B 3AE8A 3AE4A 2SPCA 2NW9A 3PUSA 2XZEA 2X0HA 2EHOA 4H63H 2LOPA 3ZMVB 5JQGE 3X1DA 1S94A 5J5GA 2L3LA 4H9OC 5AQPB 1UUSA 4UVAB 4DV3T 2XNVA 2W61A 3TLTA 2BYQA 1KNRA 3E08A 4DBMA 2Q9QC 2PTFA 2WP9A 3MZKB 2LE8A 3RC8A 5HCJA 3N9MA 1FJGT 1MMDA 2HHHT 4DUYT 5H6QB 4H9NC 2Y6XA 1VCSA 2D2SA 3LFMA 1D1AA 3QC9A 4JEUB 3ZT7A 3Q5DA 4HFHA 2ACXA 2WZIA 5AFMB 2JMKA 3RRCA 3AB3B 4LF4T 5AQQB 5LG3A 2BR8A 1XNQT 2E9XC 4ASKA 1E2AA 2HPLA 5GONE 5HXCA 5J2TE 4TV8E 4XZCA 5CA1E 4IE5A 2IAKA 4HQPA 4UXUA 3RKGA 4XBFB 4NIQA 5AQRB 2H3RA 5LG4A 1ZV4X 2W62A 2YK0A 4ZI2D 4UF0B 2UXCT 3SWHA 3R6NA 5FL0A 1QUUA 1QLBA 4FI5A 3KDSE 3VKHA 1UCUA 4WW0A 4EEBA 2V26A 3RLFF 5JDMA 3O9XA 4IL9A 3VRBA 2VKOA 2D0TA 3PU8A 3ZLIA 3FBLA 2FJBA 2NW8A 3KVAA 2PFVA 3P4RA 2BBJA 2LM9A 4JI2T 4UEMA 2W8FA 3GN5B 3AEDA 4EAHA 1IAPA 1QSDA 4FRRA 3P4SA 5JDGA 2H7VC 1G73A 3P7IA 1GQEA 3I1AA 4Q25A 4A5XA 1XDOA 4AKLA 4PW8A 4NUVA 3F57A 2XQYA 3VU7H 4LF7T 3O1HA 2YKSA 4DBQA 5J5FA 3KBTA 3GA8A 4IL4A 2A9UA 3ZCIA 1ZEEA 4CI1B 1J5WA 1UX4A 5LJNA 2F4VT 1YW0A 2WZHA 1YQ4A 2C5JA 4LFBT 4C90A 5JDLA 4Z8XA 4EZHA 3UU3A 5LP6E 4DR2T 2DWKA 2XYTA 2CBIA 5HEGA 3Q9DA 4ERRA 4KI0F 3M65A 3LK2B 5FY0A 2XAHB 3RH3A 4UVBB 1YKHB 2BG9C 3ZMTB 4GYRA 4DO0A 1HCIA 5LOVE 1N33T 2MBGA 2CMRA 4YLHA 4EGWA 5DQVA 2J47A 4CZZB 3VRAA 1WFDA 4ZJSA 3PU3A 2UZ6A 3EI0A 4ZS3A 5CGMA 4ZI7E 3FZFB 1UV6A 2X51A 1N34T 3MACA 3QB5K 2A72A 2ZM6T 4U3CA 2WU2A 1CHUA 5JTGA 4UVCB 3KV5A 1MIVA 1BR4A 1LVFA 4ADZA 4IE0A 5LJMA 5JVDE 4QXBB 2E5LT 5JREA 3N9OA 3K3NA 1ZP0A 3HR0A 1NEKA 2C0SA 5AQJB 3U8KA 5JMEA 3ZMUB 4WZXA 4BJNA 4BAYB 1HG2A 4QX8B 1ZHCA 3HKCE 5DJQC 2LRLA 4YXDA 3CMLA 4EYUA 2WM9A 2IC6A 3PJAJ 3P4QA 4U7IA 2XM2A 2WY2A 5C2TA 1I6ZA 4AFGA 5HEJA 3WI3A 1LVKA 3PUYF 4J2CA 3TKLB 5LHIB 4HFBA 5HYAA 5H6RB 4ZJTA 3FZLB 3PUWF 5FXWA 3C79A 2V7LA 2FBWA 4HGAA 2ODUA 4WNKA 3AE9A 3U8NA 3ZMSB 4X1IE 2H89A 2BBHA 2DCFA 2CEAA 3L39A 2WCAA 2E5VA 4ILCA 3Q5XA 4UV8B 2IIUA 2WWUA 4ILBA 2XASB 3FB2A 5TVCA 2XAQB 3LJCA 3QUJA 2X9HA 5L3BB 2WDQA 5HWXA 1KEYA 2BYRA 2IC9A 3AE6A 3MJXA 2ACZA 3ETUA 4ZZCA 1YXRA 3C4WA 4HFVA 1BR0A 1WCRA 3WTOA 2XZ6A 2V7IA 2WSSV 3KINB 4NUUA 4IE4A 3FZKB 4I55E 4LMKA 4EYYR 1EZ3A 4CQIA 5ABGA 5M4YA 3T1YT 4OX9T 3LG7A 2LRKA 2Q9QA 2XQAA 5DABA 3U8JA 2MAWA 4QABA 3V5UA 2W0GA 2UXDT 2OA5A 3Q2MA 3VR9A 4LFAT 3KFWX 3VKGA 3CKDA 5AFUL 3PURA 4IDOA 3RC3A 3TLUA 5L3CB 5FXXA 1ZOYA 1LRZA 2EHOB 3E22E 2LJLA 2JPFA 3QNUA 4IDQA 3D0TA 4OYKA 1SA0E 5L3GB 2WDRA 3F31A 2BYSA 3FBZA 3UUNA 4GK0E 4O4LE 3L3PA 4GK5E 3CX6B 5LXTE 4F8HA 4JI3T 4L5GA 5L3FB 4A56A 3ABVA 5FY1A 4DR5T 3G06A 2NTYA 2UXNB 2YU1A 4O4HE 4TWHA 4DR7T 3PUZF 2JIWA 4X66T 1Y64B 2CBJA 3AXJB 4B5DA 3QB5A 3WAJA 3UQ4A 3RYHE 3I0QA 3I9YA 4ZK4A 2BJ0A 1WR0A 1MMAA 1KFYA 3N5LA 4H9SE 4LMLA 2XY8B 2CPTA 4HTEA 1L0VA 4AKGA 3BQLA 1UX5A 2WQYA 5AFMA 3AAAB 4H9PC 1U5PA 2VVNA 4EXTA 4DV4T 2FJDA 4I43B 3K1SA 2QGSA 2V6YA 3RIAA 1HNXT 4IREA 2X0LB 2EHOC 2XQ3A 1D0YA 3IF8B 3AECA 1W9RA 2DWGA 1WR6A 5AFHA 3U78A 4U74A 3WTMA 2EHOD 3ZCJA 2CLYB 2J62A 5JDHA 3C84A 4JUYA 2BS3A 3ANWB 2ES0A 1Z8UA 2MYSA 5JDFA 5LHHB 3WTKA 4H9RC 3NZPA 4EEDA 3CK6A 2NW7A 4IHJE 2BVLA 3A8YC 4LF8T 4ZI2C 2X9YA 4JI6T 4AKHA 5KE4A 2K5BB 1G8XA 2G0UA 4HN9A 4U2ZA 3UUXB 2VB6A 4N78D 2OV9A 2KLQA 3ZC1A 4D01A 4YHJA 4UM3P 1UW6A 4ILAA 2W66A 5FMNA 1MNEA 2P9BA 4PJNA 4PJJA 1YKEB 5ABEA 3OVUA 2M6BA 4DV0T 5HCMA 2JJ9A 2KWHA 3PUQA 5L4EA 1XNRT 1SUMB 4HWCA 5FXVA 3NKZA 4GKJT 2Y57A 4CN6A 3UU6A 3AA7B 2VKJA 1VCTA 3H37A 4PFOA 1O3XA 2WN9A 2KZ7B 1SE7A 2V7JA 2VVSA 2CCQA 1XDPA 4U31A 3ONXA 4WBNE 4IE6A 3MA9A 4PJLA 4BA9A 3LDQB 2UUAT 3KV9A 2QYWA 5J5IA 1S35A 2E9XA 3PV0F 5CB4E 3LBXB 2CHNA 2WMNA 4YSYA 2IMLA 3UT5E 3BK9A 1WLXA 3T8OA 2AXDS 3PTRB 3ZYLA 2XYSA 3UULA 3C4ZA
chains in the Genus database with same CATH topology
4UM3P 2BYRA 3ZKRA 1UW6A 4ILAA 4QH4A 5IUXA 2Y54A 2BR7A 3WTHA 3UQ4A 3TLVA 3U8KA 3UUBA 3SH1A 5JMEA 3RQWA 2BYPA 4ZZCA 2PH9A 3RI5A 3SQ9A 2BYNA 2YKSA 4HFCA 4NPPA 3WTOA 4HFHA 4ZK4A 2XZ6A 3UU8A 2BJ0A 2XQ6A 2M6BA 5J5FA 4LMLA 2ZJUA 2WNLA 3P50A 4IL4A 2X00A 5HEOA 2ZJVA 5KZUA 2W8GA 2C9TA 5L4HA 2LM2A 3ZDGA 5HCMA 5AFMB 3SIOA 3EHZA 1OEDA 4NZBA 4LMKA 3GUAA 5AFMA 1OEDB 4LMJA 5L4EA 5FJVA 5LG3A 2BR8A 2X00D 2LKHA 4QH1A 3RHWA 4PIRA 4XK9A 3UU3A 5CO5A 5AINA 2YMEA 4TWFA 4AFGA 2BG9A 2XQ7A 4AFTA 2XQAA 5HEJA 2XYTA 3RIAA 2BG9B 5HEGA 2MAWA 3U8JA 4QABA 4B5DA 2QC1B 3LSVA 2Y57A 3T4MA 4IREA 5J0ZA 3PEOA 3UU6A 3WTLA 2YN6A 2WNJA 4ZZBA 5CFBA 4HQPA 4UXUA 1OEDE 2XQ3A 4HFBA 3UQ7A 2XQ9A 2Y56A 4HFDA 4UY2A 4BQTA 4EZ1A 2XQ8A 2BG9C 4HFEA 4ZJTA 3JAFA 5AFNA 5AFHA 2WN9A 3WTMA 1UX2A 3TLUA 4ALXA 2XQ4A 3TLWA 2YOEA 5HEUA 2BG9E 4ZJSA 2UZ6A 3TLSA 5BW2A 3C84A 3RIFA 3C79A 4QH5A 3WTNA 3EI0A 3SQ6A 3EAMA 3WIPA 3WTJA 3ZDHA 2PGZA 4Z91A 3U8NA 4AFHA 4UM3S 4A97A 4QACA 4UM3A 1UV6A 4HFIA 3U8MA 4ZK1A 5BP0A 3JAEA 5J5GA 3UU4A 3WTKA 2BYSA 3U8LA 4IL9A 2M6IA 5BRXA 3IGQA 2XNVA 5J5IA 4TNWA 4TNVA 4UM1A 5J5HA 4ILCA 2VL0A 2XQ5A 5LXBA 3TLTA 4F8HA 3UU5A 3RQUA 2BYQA 4QAAA 3PMZA 2LKGA 1I9BA 2WZYA 5SYOA 4COFA 2XNUA 2XZ5A 2LLYA 4DBMA 2KSRA 4ILBA 5AFKA 5KE4A 2XNTA 4A98A 5L47A 2W8FA 2Y7YA 5HCJA 2YMDA 4D01A 4ZR6A 3WTIA 4WV9A 5TVCA 5HEHA 4X5TA 4TWHA 2WNCA 2XYSA 4BFQA 5AFLA 4XHEA 4TWDA 5AFJA 4FRRA 3JADA 3P4WA 4Z90A 4ZRUA 2Y58A 1OEDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UM3 P;  2BYR A;  3ZKR A;  1UW6 A;  4ILA A;  4QH4 A;  5IUX A;  2Y54 A;  2BR7 A;  3WTH A;  3UQ4 A;  3TLV A;  3U8K A;  3UUB A;  3SH1 A;  5JME A;  3RQW A;  2BYP A;  4ZZC A;  2PH9 A;  3RI5 A;  3SQ9 A;  2BYN A;  2YKS A;  4HFC A;  4NPP A;  3WTO A;  4HFH A;  4ZK4 A;  2XZ6 A;  3UU8 A;  2BJ0 A;  2XQ6 A;  2M6B A;  5J5F A;  4LML A;  2ZJU A;  2WNL A;  3P50 A;  4IL4 A;  2X00 A;  5HEO A;  2ZJV A;  5KZU A;  2W8G A;  2C9T A;  5L4H A;  2LM2 A;  3ZDG A;  5HCM A;  5AFM B;  3SIO A;  3EHZ A;  1OED A;  4NZB A;  4LMK A;  3GUA A;  5AFM A;  1OED B;  4LMJ A;  5L4E A;  5FJV A;  5LG3 A;  2BR8 A;  2X00 D;  2LKH A;  4QH1 A;  3RHW A;  4PIR A;  4XK9 A;  3UU3 A;  5CO5 A;  5AIN A;  2YME A;  4TWF A;  4AFG A;  2BG9 A;  2XQ7 A;  4AFT A;  2XQA A;  5HEJ A;  2XYT A;  3RIA A;  2BG9 B;  5HEG A;  2MAW A;  3U8J A;  4QAB A;  4B5D A;  2QC1 B;  3LSV A;  2Y57 A;  3T4M A;  4IRE A;  5J0Z A;  3PEO A;  3UU6 A;  3WTL A;  2YN6 A;  2WNJ A;  4ZZB A;  5CFB A;  4HQP A;  4UXU A;  1OED E;  2XQ3 A;  4HFB A;  3UQ7 A;  2XQ9 A;  2Y56 A;  4HFD A;  4UY2 A;  4BQT A;  4EZ1 A;  2XQ8 A;  2BG9 C;  4HFE A;  4ZJT A;  3JAF A;  5AFN A;  5AFH A;  2WN9 A;  3WTM A;  1UX2 A;  3TLU A;  4ALX A;  2XQ4 A;  3TLW A;  2YOE A;  5HEU A;  2BG9 E;  4ZJS A;  2UZ6 A;  3TLS A;  5BW2 A;  3C84 A;  3RIF A;  3C79 A;  4QH5 A;  3WTN A;  3EI0 A;  3SQ6 A;  3EAM A;  3WIP A;  3WTJ A;  3ZDH A;  2PGZ A;  4Z91 A;  3U8N A;  4AFH A;  4UM3 S;  4A97 A;  4QAC A;  4UM3 A;  1UV6 A;  4HFI A;  3U8M A;  4ZK1 A;  5BP0 A;  3JAE A;  5J5G A;  3UU4 A;  3WTK A;  2BYS A;  3U8L A;  4IL9 A;  2M6I A;  5BRX A;  3IGQ A;  2XNV A;  5J5I A;  4TNW A;  4TNV A;  4UM1 A;  5J5H A;  4ILC A;  2VL0 A;  2XQ5 A;  5LXB A;  3TLT A;  4F8H A;  3UU5 A;  3RQU A;  2BYQ A;  4QAA A;  3PMZ A;  2LKG A;  1I9B A;  2WZY A;  5SYO A;  4COF A;  2XNU A;  2XZ5 A;  2LLY A;  4DBM A;  2KSR A;  4ILB A;  5AFK A;  5KE4 A;  2XNT A;  4A98 A;  5L47 A;  2W8F A;  2Y7Y A;  5HCJ A;  2YMD A;  4D01 A;  4ZR6 A;  3WTI A;  4WV9 A;  5TVC A;  5HEH A;  4X5T A;  4TWH A;  2WNC A;  2XYS A;  4BFQ A;  5AFL A;  4XHE A;  4TWD A;  5AFJ A;  4FRR A;  3JAD A;  3P4W A;  4Z90 A;  4ZRU A;  2Y58 A;  1OED C; 
#chains in the Genus database with same CATH topology
 4AI6 A;  4I0U A;  4CI3 B;  2LSI A;  3PUV F;  3SH1 A;  3RQW A;  3AE3 A;  4EIW A;  4NPP A;  4E7Z A;  2Q9Q D;  2X68 A;  2XAG B;  3ZJ1 A;  4B6X A;  3P50 A;  3ZN1 B;  5LMU T;  2W8G A;  5HXR A;  2IHR 1;  1OED A;  2WS3 A;  5E0O A;  5FJV A;  4CXY A;  2CWO A;  3ZJ2 A;  3CQG B;  3N2G E;  1N36 T;  4QX7 B;  4AFT A;  3SOL A;  4IDP A;  2QVA A;  1IBL T;  3HKE E;  2A3D A;  3J9X 1;  2W2U A;  5J0Z A;  3PEO A;  2XPK A;  1UK5 A;  3WTL A;  5CFB A;  3ZC0 A;  3CVR A;  4DUZ T;  3T1H T;  2YDS A;  2QRX A;  4P1N A;  5HEU A;  3U3I A;  5LHG B;  5FXZ A;  3OYX A;  5BW2 A;  1XZY A;  4CN4 A;  3N9L A;  2ZM8 A;  3S4U A;  5JR9 B;  4UM3 S;  4QAC A;  4UM3 A;  4JI5 T;  2L9Q A;  5KDM C;  4DV6 T;  1NAF A;  3K8P C;  3H3A A;  3AA1 B;  4IST A;  2IDO B;  4FJO A;  4QKN A;  4TNV A;  1J5E T;  1NWM X;  2XQ5 A;  5FVK A;  5LXB A;  2JQ9 A;  5AFK A;  5FNV E;  4AIS A;  4L0R A;  4U72 A;  1X79 A;  3MK7 C;  4CXW A;  3Q5E A;  3RYI E;  4ISS A;  3QK6 A;  2BR7 A;  2WWV A;  3WTH A;  3TLV A;  4U7Y A;  3O4X E;  4JV5 T;  1IZN B;  2VQF T;  2CXD A;  3KV4 A;  3DTO A;  2ZJU A;  1KK7 A;  3B5M A;  5KZU A;  3O1J A;  2LSJ A;  3UFG A;  5BR8 T;  4LMJ A;  2LEH A;  1JNR A;  1VRB A;  3RHW A;  3LK3 B;  4DR1 T;  4X65 T;  3HA4 A;  1H7C A;  2E8I A;  2Q9Q B;  5JDQ A;  5AQF B;  2WNJ A;  2ZMA A;  3K3Q C;  2ZM0 A;  2KIN B;  4KMC A;  5ABF B;  4UV9 B;  4KHP T;  2YDR A;  4ALX A;  2XQ4 A;  3TLW A;  3DJB A;  4JI4 T;  5LGU B;  3OYZ A;  2K3W A;  2Z6E A;  1V9D A;  3AEB A;  2E9X D;  5LBM A;  4P0A A;  3RRW A;  1HG5 A;  3HI2 A;  3ZPO A;  2N2N A;  5BRX A;  3UTK A;  3IGQ A;  3C51 A;  1FEW A;  3HL6 A;  1MND A;  4IE7 A;  2XNT A;  5L47 A;  2XM1 A;  3WTI A;  4X5T A;  5AQH B;  2JQH A;  3N9N A;  2V7M A;  2JQK A;  2K24 A;  2YEV C;  3AE2 A;  3OJA A;  5AQO B;  3ZKR A;  4QH4 A;  2CXF A;  3CQC B;  3AA0 B;  2PBI A;  1ZKE A;  2PH9 A;  3O1I A;  3V5S A;  1IBK T;  2BKN A;  2ZM2 A;  3JCF A;  3QOF A;  4JYA T;  4PAG A;  5HEO A;  2ZJV A;  1NEN A;  3KV6 A;  4CN1 A;  3ZDG A;  4F6R C;  3LK4 2;  4O4J E;  4QHO A;  2HPJ A;  4NZB A;  5AQU B;  3GWH A;  2XAJ B;  4H9Q C;  3CPZ A;  1OXZ A;  3L8R A;  4IDZ A;  5LGN B;  4KP3 C;  5JR9 C;  3FXD B;  1CUN A;  3MKD A;  1OED E;  1IBM T;  3JAF A;  2N1G A;  5EK4 A;  2YOE A;  2BG9 E;  2KT9 A;  2FUP A;  2D0U A;  3CWZ B;  2CXL A;  2LOS A;  1OWA A;  3EAM A;  2X66 A;  1D1B A;  4AQG A;  5AQV B;  4I4T E;  4LF9 T;  4UM1 A;  5J5H A;  4DID B;  4ZI3 C;  3RQU A;  4PJM A;  3PMZ A;  1Y01 A;  2AE9 A;  1D0Z A;  5LYJ E;  2WZY A;  2KSR A;  4B3M T;  5CA0 E;  2Y7Y A;  3P8C D;  2YMD A;  4WV9 A;  2W67 A;  4JLE A;  4BFQ A;  2V1D B;  4X62 T;  4L9I A;  4ZRU A;  5J1G A;  1DU2 A;  1US7 B;  2BYN A;  4U2Y A;  2NOX A;  5LBQ B;  5FYM A;  4X20 E;  3IA3 A;  3ZT6 A;  5L3E B;  5L3D B;  3Q5W A;  3SIO A;  3EHZ A;  2XTL A;  3GUA A;  3RYF E;  3A5X A;  4EB6 E;  2KND A;  4PIR A;  5BMV E;  4XK9 A;  3AE1 A;  5DQW A;  3EUH A;  4CI2 B;  5IYZ E;  2CRB A;  3HKB E;  4TUY E;  2UUB T;  4ZZB A;  3UQ7 A;  3OPC A;  4HFE A;  4O2A E;  4HKA A;  4DR4 T;  5C3J A;  4M1P A;  1R8I A;  3TLS A;  3CIR A;  1HX8 A;  2K48 A;  2PGZ A;  2NR4 A;  2V8S V;  4LFC T;  4GYS A;  4JI8 T;  3JAE A;  1X9B A;  5AQL B;  3NRX A;  2M6I A;  2PG8 A;  2BS4 A;  3N9P A;  3FXE B;  1BR1 A;  2LKG A;  2CHO A;  4AIU A;  5HEH A;  2XUE A;  2CLY C;  3CX8 B;  4XHE A;  2NWB A;  2WAU A;  3ZEF B;  4HE8 A;  4YJ3 E;  2DHR A;  2BZB A;  4KUM B;  2D5U A;  3UUB A;  2BYP A;  4YHH T;  2VAS A;  3AEE A;  2C5K T;  5EK3 A;  3RIU C;  4HFC A;  4TN7 B;  4YSX A;  3PDY A;  2M67 A;  4MBQ A;  4HEA A;  2JRK A;  4K0K T;  2LT3 A;  4ZOL E;  5FY7 A;  2X9X A;  5L2L A;  5JRC A;  1UUR A;  2RP4 A;  2VK9 A;  4EOZ B;  3AEG A;  5HXS A;  4YTP A;  2QA7 A;  3KBU A;  2V5D A;  5AIN A;  4G2A A;  3SS1 A;  4I50 E;  4TWF A;  2WMO A;  3NZQ A;  4KHZ F;  5A1L A;  4UR9 A;  2WDV A;  3ZYK A;  3GMI A;  3T4M A;  3B13 A;  2UU9 T;  2CE7 A;  4E7S A;  2XQ9 A;  1BR2 A;  2WB5 A;  4PNI A;  1MMN A;  5KXJ A;  3AAE B;  3I9W A;  3R84 B;  4V1A v;  4EZ4 A;  1M62 A;  2MPK A;  1HNZ T;  2NP9 A;  5F5W A;  5ETW A;  4MAL A;  4QH5 A;  2Y48 B;  1AJ3 A;  3SQ6 A;  3NVO A;  4A97 A;  4HFI A;  5FL1 A;  5BP0 A;  5HXE A;  1D1C A;  4LF5 T;  3UFE A;  2RPA A;  2JMH A;  3ESL A;  2LSY A;  4HWD A;  3ETV A;  2GK9 A;  2XZ5 A;  1IJ5 A;  4PK6 A;  3N9Q A;  3C4X A;  3CX7 B;  3C98 B;  4Z90 A;  4DMW A;  3AXJ A;  2UUC T;  3C50 A;  3BQK A;  4AXP A;  4PK5 A;  4JI0 T;  2YU2 A;  2A2F X;  5LGT B;  2PJQ A;  1LKX A;  1J1J A;  5HWY A;  1HX1 B;  5JRC B;  4UIG A;  4G63 A;  4NXM T;  4AKI A;  4IDN A;  4QH1 A;  2YME A;  2VKH A;  2V7K A;  2V6Y B;  4OHF A;  3ZT5 A;  1I94 T;  2Y56 A;  4BQT A;  3AA6 B;  2BVM A;  2D9D A;  5LNK A;  3VR8 A;  3AVS A;  3NWI A;  3OBV E;  2K9A A;  4GOU A;  4HWI B;  3WTN A;  5ABH A;  1T98 A;  4Z91 A;  4AFH A;  4YFS A;  4IGU A;  3GN5 A;  4H63 V;  4CXX A;  4YY3 T;  4PK4 A;  3RPU A;  3NBX X;  4YTM A;  3AE5 A;  1XMO T;  3RYC E;  1XMQ T;  4AKR B;  2VL0 A;  1WYC A;  3HKD E;  3OTO T;  4COF A;  3PUX F;  5AQN B;  1VOM A;  2H7O A;  2JQQ A;  2WNC A;  4DND A;  2J4G A;  1UGO A;  4IT4 A;  4O8S A;  2Y58 A;  2I0M A;  4GIW A;  5FVL A;  4EV6 A;  2OLT A;  4DR6 T;  1FMV A;  1WRD A;  3ONJ A;  3SQ9 A;  3AEA A;  4O4I E;  4MHC A;  2KWI B;  2BKP A;  4JEH B;  5EK2 A;  4X1Y E;  2XHE B;  2XSA A;  3AEF A;  3WAK A;  2B1E A;  1M7K A;  4AQY T;  4YTN A;  5JDN A;  2R6G F;  2HN1 A;  2VUR A;  3RX6 A;  2UXX B;  1IJ6 A;  4B3T T;  5AQK B;  1Z0P A;  3E0Z A;  3L09 A;  4ILU A;  2X00 D;  4OK0 A;  5CO5 A;  3ZMZ B;  3DP7 A;  2XQ7 A;  2YIN A;  3IBP A;  3LSV A;  3RF1 A;  1T72 A;  5HAX A;  4HFD A;  4UY2 A;  2XQ8 A;  3ZYM A;  4MFR A;  4AQF C;  2RA1 A;  2XJ7 A;  2LHR A;  3H3M A;  2XAF B;  2VKD A;  3RIF A;  5KMG P;  5J2U E;  5IHY A;  3WTJ A;  4LF6 T;  3IEE A;  2DNX A;  2KMF A;  2CM0 A;  4WBO A;  3K3O A;  3W15 B;  2ODV A;  2UXB T;  4MLK A;  1T8B A;  3UU5 A;  4JI1 T;  4QAA A;  3CQX C;  2XNU A;  3LBX A;  4YSZ A;  3PJA A;  3JC6 D;  4A98 A;  3C64 A;  5FP3 A;  4ZR6 A;  2DLR A;  5AFL A;  1SHZ C;  3EVY A;  2W63 A;  3ZSS A;  3JAD A;  1OED C;  5ADX L;  2KXP B;  2B76 A;  5F8P A;  5F3J A;  1W0B A;  2HH7 A;  4XAX B;  4WYV A;  1HNW T;  4ZXL A;  5LMN T;  1E7P A;  2XQ6 A;  3N2K E;  2X00 A;  1HFA A;  5AQS B;  2W00 A;  4IIJ E;  3FZH B;  4PFP A;  3ZST A;  4X64 T;  3VHL A;  1OED B;  2CA5 A;  2LKH A;  5ABF A;  4ZS2 A;  4U33 A;  4UEL A;  2BG9 B;  1U4Q A;  4NXN T;  1KF6 A;  4DV1 T;  2LSK A;  3FZM B;  4KX6 A;  3A7M A;  2FJE A;  1B7T A;  2V6X A;  1UX2 A;  1N32 T;  3J7Y q;  3RIU A;  1HTJ F;  3SFD A;  4C91 A;  5LCY A;  2HN2 A;  5JR9 A;  3EDV A;  3EAB A;  4ZK1 A;  3UU4 A;  4HWH A;  5JH7 E;  3MXZ A;  3FHN A;  4ANJ A;  2LLY A;  5LB7 B;  2NTX A;  4OFZ A;  3RKO A;  2Y8D A;  5CJ5 A;  2E2A A;  4DVD A;  4TWD A;  5AFJ A;  2C5I T;  5IUX A;  2Y54 A;  2CWY A;  4DV2 T;  3JC6 C;  1W09 A;  2I59 A;  3M3Z B;  3BQI A;  2LM2 A;  2ZLY A;  5IWA T;  2YDQ A;  3NRY A;  4OYJ A;  2W4X A;  5TAO A;  3AE7 A;  2BKO A;  1W0A A;  4ZEY A;  5AQM B;  4X1K E;  2BG9 A;  3B57 A;  3IHR A;  4UF0 A;  4TX5 A;  2QC1 B;  4JI7 T;  1HF8 A;  5AQT B;  4P0B A;  1YD8 G;  5AQI B;  1HR0 T;  1KNZ A;  3P4P A;  2V5C A;  3SFE A;  2BS2 A;  4P09 A;  4JBW F;  4ZI3 D;  5C8Y E;  4QXH B;  4ZHQ E;  1FIO A;  1KNP A;  4DMV A;  1HS7 A;  3KVB A;  2MOZ A;  4B3R T;  2VWA A;  3AVR A;  3EDU A;  3RGL A;  3WIP A;  4HWF A;  2BDE A;  3ZDH A;  2J1D G;  1MIW A;  3ONL C;  4KBM B;  4TV9 E;  5EZY E;  1T7S A;  4DV5 T;  3U8L A;  3N2O A;  1WYB A;  2E9X B;  4GKK T;  4TNW A;  4DV7 T;  3ANW A;  1I9B A;  5KX5 E;  5SYO A;  3OKQ A;  4UXN B;  2H88 A;  3PE0 A;  3U8M A;  3P4W A;  4AQF A;  5HXH A;  5LA6 E;  3PUG A;  2WU5 A;  2XSB A;  1MIY A;  2WBL A;  3SRZ A;  3RI5 A;  4DBR A;  5FKY A;  2L8K A;  5AQG B;  3UU8 A;  2WNL A;  3PUA A;  4YT0 A;  4K0U A;  2C9T A;  3AAI A;  5L4H A;  4DR3 T;  2LSG A;  2IUB A;  2X9W A;  2I6H A;  2N9D A;  4TZ4 C;  1YQ3 A;  4QXC B;  2LHN A;  2X0Y A;  1XWM A;  1D0X A;  4QWN B;  2VL8 A;  3F2E A;  2DL1 A;  2VQE T;  2MTQ A;  1E1H B;  2DI4 A;  1MMG A;  2YN6 A;  2FJA A;  3I0O A;  4EZ1 A;  4BJM A;  1JNZ A;  2X67 A;  3ZN0 B;  4B3S T;  5AFN A;  1FMW A;  4YJ2 E;  3UUM A;  4O2B E;  2IW5 B;  3AE8 A;  3AE4 A;  2SPC A;  2NW9 A;  3PUS A;  2XZE A;  2X0H A;  2EHO A;  4H63 H;  2LOP A;  3ZMV B;  5JQG E;  3X1D A;  1S94 A;  5J5G A;  2L3L A;  4H9O C;  5AQP B;  1UUS A;  4UVA B;  4DV3 T;  2XNV A;  2W61 A;  3TLT A;  2BYQ A;  1KNR A;  3E08 A;  4DBM A;  2Q9Q C;  2PTF A;  2WP9 A;  3MZK B;  2LE8 A;  3RC8 A;  5HCJ A;  3N9M A;  1FJG T;  1MMD A;  2HHH T;  4DUY T;  5H6Q B;  4H9N C;  2Y6X A;  1VCS A;  2D2S A;  3LFM A;  1D1A A;  3QC9 A;  4JEU B;  3ZT7 A;  3Q5D A;  4HFH A;  2ACX A;  2WZI A;  5AFM B;  2JMK A;  3RRC A;  3AB3 B;  4LF4 T;  5AQQ B;  5LG3 A;  2BR8 A;  1XNQ T;  2E9X C;  4ASK A;  1E2A A;  2HPL A;  5GON E;  5HXC A;  5J2T E;  4TV8 E;  4XZC A;  5CA1 E;  4IE5 A;  2IAK A;  4HQP A;  4UXU A;  3RKG A;  4XBF B;  4NIQ A;  5AQR B;  2H3R A;  5LG4 A;  1ZV4 X;  2W62 A;  2YK0 A;  4ZI2 D;  4UF0 B;  2UXC T;  3SWH A;  3R6N A;  5FL0 A;  1QUU A;  1QLB A;  4FI5 A;  3KDS E;  3VKH A;  1UCU A;  4WW0 A;  4EEB A;  2V26 A;  3RLF F;  5JDM A;  3O9X A;  4IL9 A;  3VRB A;  2VKO A;  2D0T A;  3PU8 A;  3ZLI A;  3FBL A;  2FJB A;  2NW8 A;  3KVA A;  2PFV A;  3P4R A;  2BBJ A;  2LM9 A;  4JI2 T;  4UEM A;  2W8F A;  3GN5 B;  3AED A;  4EAH A;  1IAP A;  1QSD A;  4FRR A;  3P4S A;  5JDG A;  2H7V C;  1G73 A;  3P7I A;  1GQE A;  3I1A A;  4Q25 A;  4A5X A;  1XDO A;  4AKL A;  4PW8 A;  4NUV A;  3F57 A;  2XQY A;  3VU7 H;  4LF7 T;  3O1H A;  2YKS A;  4DBQ A;  5J5F A;  3KBT A;  3GA8 A;  4IL4 A;  2A9U A;  3ZCI A;  1ZEE A;  4CI1 B;  1J5W A;  1UX4 A;  5LJN A;  2F4V T;  1YW0 A;  2WZH A;  1YQ4 A;  2C5J A;  4LFB T;  4C90 A;  5JDL A;  4Z8X A;  4EZH A;  3UU3 A;  5LP6 E;  4DR2 T;  2DWK A;  2XYT A;  2CBI A;  5HEG A;  3Q9D A;  4ERR A;  4KI0 F;  3M65 A;  3LK2 B;  5FY0 A;  2XAH B;  3RH3 A;  4UVB B;  1YKH B;  2BG9 C;  3ZMT B;  4GYR A;  4DO0 A;  1HCI A;  5LOV E;  1N33 T;  2MBG A;  2CMR A;  4YLH A;  4EGW A;  5DQV A;  2J47 A;  4CZZ B;  3VRA A;  1WFD A;  4ZJS A;  3PU3 A;  2UZ6 A;  3EI0 A;  4ZS3 A;  5CGM A;  4ZI7 E;  3FZF B;  1UV6 A;  2X51 A;  1N34 T;  3MAC A;  3QB5 K;  2A72 A;  2ZM6 T;  4U3C A;  2WU2 A;  1CHU A;  5JTG A;  4UVC B;  3KV5 A;  1MIV A;  1BR4 A;  1LVF A;  4ADZ A;  4IE0 A;  5LJM A;  5JVD E;  4QXB B;  2E5L T;  5JRE A;  3N9O A;  3K3N A;  1ZP0 A;  3HR0 A;  1NEK A;  2C0S A;  5AQJ B;  3U8K A;  5JME A;  3ZMU B;  4WZX A;  4BJN A;  4BAY B;  1HG2 A;  4QX8 B;  1ZHC A;  3HKC E;  5DJQ C;  2LRL A;  4YXD A;  3CML A;  4EYU A;  2WM9 A;  2IC6 A;  3PJA J;  3P4Q A;  4U7I A;  2XM2 A;  2WY2 A;  5C2T A;  1I6Z A;  4AFG A;  5HEJ A;  3WI3 A;  1LVK A;  3PUY F;  4J2C A;  3TKL B;  5LHI B;  4HFB A;  5HYA A;  5H6R B;  4ZJT A;  3FZL B;  3PUW F;  5FXW A;  3C79 A;  2V7L A;  2FBW A;  4HGA A;  2ODU A;  4WNK A;  3AE9 A;  3U8N A;  3ZMS B;  4X1I E;  2H89 A;  2BBH A;  2DCF A;  2CEA A;  3L39 A;  2WCA A;  2E5V A;  4ILC A;  3Q5X A;  4UV8 B;  2IIU A;  2WWU A;  4ILB A;  2XAS B;  3FB2 A;  5TVC A;  2XAQ B;  3LJC A;  3QUJ A;  2X9H A;  5L3B B;  2WDQ A;  5HWX A;  1KEY A;  2BYR A;  2IC9 A;  3AE6 A;  3MJX A;  2ACZ A;  3ETU A;  4ZZC A;  1YXR A;  3C4W A;  4HFV A;  1BR0 A;  1WCR A;  3WTO A;  2XZ6 A;  2V7I A;  2WSS V;  3KIN B;  4NUU A;  4IE4 A;  3FZK B;  4I55 E;  4LMK A;  4EYY R;  1EZ3 A;  4CQI A;  5ABG A;  5M4Y A;  3T1Y T;  4OX9 T;  3LG7 A;  2LRK A;  2Q9Q A;  2XQA A;  5DAB A;  3U8J A;  2MAW A;  4QAB A;  3V5U A;  2W0G A;  2UXD T;  2OA5 A;  3Q2M A;  3VR9 A;  4LFA T;  3KFW X;  3VKG A;  3CKD A;  5AFU L;  3PUR A;  4IDO A;  3RC3 A;  3TLU A;  5L3C B;  5FXX A;  1ZOY A;  1LRZ A;  2EHO B;  3E22 E;  2LJL A;  2JPF A;  3QNU A;  4IDQ A;  3D0T A;  4OYK A;  1SA0 E;  5L3G B;  2WDR A;  3F31 A;  2BYS A;  3FBZ A;  3UUN A;  4GK0 E;  4O4L E;  3L3P A;  4GK5 E;  3CX6 B;  5LXT E;  4F8H A;  4JI3 T;  4L5G A;  5L3F B;  4A56 A;  3ABV A;  5FY1 A;  4DR5 T;  3G06 A;  2NTY A;  2UXN B;  2YU1 A;  4O4H E;  4TWH A;  4DR7 T;  3PUZ F;  2JIW A;  4X66 T;  1Y64 B;  2CBJ A;  3AXJ B;  4B5D A;  3QB5 A;  3WAJ A;  3UQ4 A;  3RYH E;  3I0Q A;  3I9Y A;  4ZK4 A;  2BJ0 A;  1WR0 A;  1MMA A;  1KFY A;  3N5L A;  4H9S E;  4LML A;  2XY8 B;  2CPT A;  4HTE A;  1L0V A;  4AKG A;  3BQL A;  1UX5 A;  2WQY A;  5AFM A;  3AAA B;  4H9P C;  1U5P A;  2VVN A;  4EXT A;  4DV4 T;  2FJD A;  4I43 B;  3K1S A;  2QGS A;  2V6Y A;  3RIA A;  1HNX T;  4IRE A;  2X0L B;  2EHO C;  2XQ3 A;  1D0Y A;  3IF8 B;  3AEC A;  1W9R A;  2DWG A;  1WR6 A;  5AFH A;  3U78 A;  4U74 A;  3WTM A;  2EHO D;  3ZCJ A;  2CLY B;  2J62 A;  5JDH A;  3C84 A;  4JUY A;  2BS3 A;  3ANW B;  2ES0 A;  1Z8U A;  2MYS A;  5JDF A;  5LHH B;  3WTK A;  4H9R C;  3NZP A;  4EED A;  3CK6 A;  2NW7 A;  4IHJ E;  2BVL A;  3A8Y C;  4LF8 T;  4ZI2 C;  2X9Y A;  4JI6 T;  4AKH A;  5KE4 A;  2K5B B;  1G8X A;  2G0U A;  4HN9 A;  4U2Z A;  3UUX B;  2VB6 A;  4N78 D;  2OV9 A;  2KLQ A;  3ZC1 A;  4D01 A;  4YHJ A;  4UM3 P;  1UW6 A;  4ILA A;  2W66 A;  5FMN A;  1MNE A;  2P9B A;  4PJN A;  4PJJ A;  1YKE B;  5ABE A;  3OVU A;  2M6B A;  4DV0 T;  5HCM A;  2JJ9 A;  2KWH A;  3PUQ A;  5L4E A;  1XNR T;  1SUM B;  4HWC A;  5FXV A;  3NKZ A;  4GKJ T;  2Y57 A;  4CN6 A;  3UU6 A;  3AA7 B;  2VKJ A;  1VCT A;  3H37 A;  4PFO A;  1O3X A;  2WN9 A;  2KZ7 B;  1SE7 A;  2V7J A;  2VVS A;  2CCQ A;  1XDP A;  4U31 A;  3ONX A;  4WBN E;  4IE6 A;  3MA9 A;  4PJL A;  4BA9 A;  3LDQ B;  2UUA T;  3KV9 A;  2QYW A;  5J5I A;  1S35 A;  2E9X A;  3PV0 F;  5CB4 E;  3LBX B;  2CHN A;  2WMN A;  4YSY A;  2IML A;  3UT5 E;  3BK9 A;  1WLX A;  3T8O A;  2AXD S;  3PTR B;  3ZYL A;  2XYS A;  3UUL A;  3C4Z A; 
#chains in the Genus database with same CATH homology
 4UM3 P;  2BYR A;  3ZKR A;  1UW6 A;  4ILA A;  4QH4 A;  5IUX A;  2Y54 A;  2BR7 A;  3WTH A;  3UQ4 A;  3TLV A;  3U8K A;  3UUB A;  3SH1 A;  5JME A;  3RQW A;  2BYP A;  4ZZC A;  2PH9 A;  3RI5 A;  3SQ9 A;  2BYN A;  2YKS A;  4HFC A;  4NPP A;  3WTO A;  4HFH A;  4ZK4 A;  2XZ6 A;  3UU8 A;  2BJ0 A;  2XQ6 A;  2M6B A;  5J5F A;  4LML A;  2ZJU A;  2WNL A;  3P50 A;  4IL4 A;  2X00 A;  5HEO A;  2ZJV A;  5KZU A;  2W8G A;  2C9T A;  5L4H A;  2LM2 A;  3ZDG A;  5HCM A;  5AFM B;  3SIO A;  3EHZ A;  1OED A;  4NZB A;  4LMK A;  3GUA A;  5AFM A;  1OED B;  4LMJ A;  5L4E A;  5FJV A;  5LG3 A;  2BR8 A;  2X00 D;  2LKH A;  4QH1 A;  3RHW A;  4PIR A;  4XK9 A;  3UU3 A;  5CO5 A;  5AIN A;  2YME A;  4TWF A;  4AFG A;  2BG9 A;  2XQ7 A;  4AFT A;  2XQA A;  5HEJ A;  2XYT A;  3RIA A;  2BG9 B;  5HEG A;  2MAW A;  3U8J A;  4QAB A;  4B5D A;  2QC1 B;  3LSV A;  2Y57 A;  3T4M A;  4IRE A;  5J0Z A;  3PEO A;  3UU6 A;  3WTL A;  2YN6 A;  2WNJ A;  4ZZB A;  5CFB A;  4HQP A;  4UXU A;  1OED E;  2XQ3 A;  4HFB A;  3UQ7 A;  2XQ9 A;  2Y56 A;  4HFD A;  4UY2 A;  4BQT A;  4EZ1 A;  2XQ8 A;  2BG9 C;  4HFE A;  4ZJT A;  3JAF A;  5AFN A;  5AFH A;  2WN9 A;  3WTM A;  1UX2 A;  3TLU A;  4ALX A;  2XQ4 A;  3TLW A;  2YOE A;  5HEU A;  2BG9 E;  4ZJS A;  2UZ6 A;  3TLS A;  5BW2 A;  3C84 A;  3RIF A;  3C79 A;  4QH5 A;  3WTN A;  3EI0 A;  3SQ6 A;  3EAM A;  3WIP A;  3WTJ A;  3ZDH A;  2PGZ A;  4Z91 A;  3U8N A;  4AFH A;  4UM3 S;  4A97 A;  4QAC A;  4UM3 A;  1UV6 A;  4HFI A;  3U8M A;  4ZK1 A;  5BP0 A;  3JAE A;  5J5G A;  3UU4 A;  3WTK A;  2BYS A;  3U8L A;  4IL9 A;  2M6I A;  5BRX A;  3IGQ A;  2XNV A;  5J5I A;  4TNW A;  4TNV A;  4UM1 A;  5J5H A;  4ILC A;  2VL0 A;  2XQ5 A;  5LXB A;  3TLT A;  4F8H A;  3UU5 A;  3RQU A;  2BYQ A;  4QAA A;  3PMZ A;  2LKG A;  1I9B A;  2WZY A;  5SYO A;  4COF A;  2XNU A;  2XZ5 A;  2LLY A;  4DBM A;  2KSR A;  4ILB A;  5AFK A;  5KE4 A;  2XNT A;  4A98 A;  5L47 A;  2W8F A;  2Y7Y A;  5HCJ A;  2YMD A;  4D01 A;  4ZR6 A;  3WTI A;  4WV9 A;  5TVC A;  5HEH A;  4X5T A;  4TWH A;  2WNC A;  2XYS A;  4BFQ A;  5AFL A;  4XHE A;  4TWD A;  5AFJ A;  4FRR A;  3JAD A;  3P4W A;  4Z90 A;  4ZRU A;  2Y58 A;  1OED C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...