4LMKA

Glic liganded-closed-channel conformation, mutant y27'a
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPAMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Proton-gated ion channel
publication title Gating of the proton-gated ion channel from Gloeobacter violaceus at pH 4 as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 90
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4lmkA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4lmkA01
1OEDE 2XQ3A 3C84A 4IREA 4TNVA 2Y58A 5J5FA 3EAMA 3T4MA 2W8GA 2BYSA 2Y54A 4ALXA 2KSRA 4NZBA 5CO5A 2XYSA 4QACA 3U8JA 2XNTA 3PMZA 5HCMA 4QABA 3U8KA 4QH5A 3SIOA 2YMDA 3LSVA 5L4HA 2Y56A 4UXUA 2XZ6A 3PEOA 5JMEA 5HEJA 2YOEA 2BG9B 4D01A 2LKGA 4X5TA 5BRXA 3WTIA 2BG9C 3JADA 3UU4A 3JAFA 2PH9A 4ZZBA 2M6IA 2BR8A 2WNJA 3P4WA 5AFHA 3RQWA 4UM1A 5BP0A 4NPPA 2PGZA 2XQAA 3ZDGA 2XQ9A 2LM2A 2YKSA 4LMJA 2XNUA 4HFDA 4IL4A 3UU3A 4A97A 4UM3P 1I9BA 2WNCA 2XQ6A 5HEOA 3P50A 2MAWA 4QH4A 4PIRA 5TVCA 4ILCA 4HFCA 4QH1A 4IL9A 3GUAA 2W8FA 3TLTA 4XHEA 5AFNA 5KE4A 3JAEA 3UUBA 2C9TA 2VL0A 5HCJA 2YN6A 3RIFA 4HFBA 5IUXA 2XQ4A 2BG9A 4A98A 4AFGA 5J5HA 5AFMB 5CFBA 1OEDB 3WTJA 4UM3A 3C79A 3RHWA 2XZ5A 4COFA 4HQPA 5HEHA 3UQ4A 2UZ6A 3WTLA 5HEUA 2X00A 1OEDC 4TNWA 4LMKA 5L4EA 1OEDA 5AFMA 1UV6A 5LXBA 4ZK1A 3UU5A 2LLYA 4XK9A 4ZJTA 2WNLA 3SQ9A 3TLUA 2XQ8A 2YMEA 3U8MA 2Y57A 5J0ZA 2BR7A 4UY2A 3WIPA 4ZJSA 5AFJA 3U8NA 2LKHA 4ZRUA 2BG9E 3SH1A 4WV9A 3EI0A 5J5IA 1UW6A 2XQ5A 2BYQA 4AFTA 3ZDHA 4HFEA 3UU8A 2BYNA 5AFLA 4FRRA 4B5DA 4EZ1A 4ZR6A 3WTMA 3ZKRA 3TLVA 2ZJVA 3WTNA 5L47A 4ILBA 4Z91A 2X00D 5AINA 5SYOA 4UM3S 5BW2A 3TLWA 2BYRA 5KZUA 4ILAA 4QAAA 3SQ6A 3WTKA 1UX2A 5LG3A 2BJ0A 4TWFA 4ZZCA 4AFHA 3UU6A 4Z90A 2M6BA 4DBMA 3UQ7A 4ZK4A 3U8LA 2ZJUA 2XNVA 2BYPA 3RIAA 4TWDA 3WTOA 4HFHA 5HEGA 2QC1B 3WTHA 3RI5A 3IGQA 2Y7YA 4BQTA 5FJVA 5AFKA 4HFIA 3EHZA 2WZYA 3TLSA 4F8HA 4TWHA 2XYTA 5J5GA 3RQUA 2WN9A 4LMLA 4BFQA 2XQ7A
chains in the Genus database with same CATH superfamily
2YU1A 5JRCB 5EZYE 4LF6T 2V6XA 2WQYA 2C5IT 3U8KA 2YMDA 5L4HA 4QWNB 2Q9QA 2XAQB 2LE8A 5AQNB 3UU4A 5GONE 3UTKA 4ZI2D 4TV9E 2CBJA 2W61A 2JQKA 3AE4A 4IIJE 5JRCA 4L9IA 1IBLT 1W0AA 2K9AA 4HFCA 4UVAB 3AAAB 5HXEA 5F3JA 2J62A 3ZMSB 1OEDB 4HWHA 5FXZA 4JYAT 4QXCB 1HX1B 4JI1T 4AKIA 4CXYA 1YQ4A 4ZS2A 3AE7A 2BS4A 1MIYA 1NAFA 4PFOA 2XTLA 3SQ6A 2LHNA 4O4IE 3WTKA 2B76A 2BDEA 2X9XA 3N2OA 4ADZA 3L3PA 3Q5WA 3RIAA 2JRKA 5HEGA 4B3RT 2Y7YA 5AFKA 3PU8A 2DI4A 3CQCB 4GK0E 2LSJA 4ZI2C 4KUMB 3BQLA 5CO5A 4EGWA 3IBPA 4Z8XA 2C5JA 2W66A 2WWVA 5JDHA 2P9BA 3ZPOA 4J2CA 4X64T 3KV4A 4JI5T 3FXEB 2V7KA 5AQTB 1MIVA 4ILCA 2KWIB 1WCRA 4IL9A 5HXSA 2C9TA 2VL0A 3KV6A 2HPLA 3ONLC 4AISA 3C79A 3QB5A 5JR9A 5M4YA 5LP6E 3PTRB 4DV3T 2E9XD 4LMKA 4EOZB 4O4LE 4JI3T 4QKNA 4KX6A 2LSGA 1FMWA 5AFJA 2N1GA 2H89A 3EI0A 2BYQA 1E2AA 3UU8A 3PURA 2CWOA 5LBMA 5JREA 4U7IA 2MBGA 2FBWA 4Z91A 5FY0A 1ZP0A 2BJ0A 1VRBA 4ANJA 1YXRA 5KDMC 5ABEA 1N33T 3O4XE 2C5KT 3OJAA 2CWYA 4WNKA 1T72A 3C4WA 5DQWA 4UF0A 4X65T 3ZYMA 4NZBA 4QACA 5EK4A 2XZ6A 2I59A 2JMHA 2HN2A 5L3CB 3QB5K 3K1SA 2UU9T 1X79A 3PUYF 3JADA 2N9DA 2WMNA 4YHJA 3D0TA 5AFHA 4P0AA 1XZYA 2PJQA 4HE8A 3N9MA 2UUCT 3O9XA 2YKSA 3NBXX 5FY1A 2VQET 2E9XC 4DMWA 5LGUB 1HNWT 3P4RA 4C91A 3ZMVB 4HTEA 1U5PA 3K3NA 5JVDE 2K3WA 2WBLA 2XAGB 4UVBB 4NXNT 1US7B 4DR7T 4NUUA 2WS3A 4COFA 5LJNA 5LB7B 2WSSV 2YMEA 2LKHA 1IBKT 3GN5B 1ZV4X 2VWAA 3OPCA 4ZOLE 4FRRA 2A3DA 4ZHQE 3B57A 2DNXA 2X0LB 1W09A 1V9DA 4HKAA 5AQFB 4M1PA 1T98A 2X66A 4EIWA 2XNVA 4EB6E 2BYPA 4TWDA 2ACXA 3AEGA 2R6GF 2CHOA 1YD8G 1Y64B 4NXMT 4UIGA 1N34T 5FL1A 2XYTA 3QUJA 3GN5A 1YQ3A 2Y48B 5LBQB 2Y54A 3FBZA 3O1IA 3MA9A 1LVKA 2XNTA 4QABA 2BBHA 4QH5A 3CX6B 4TV8E 3EVYA 3WAKA 3CK6A 2KLQA 2BKPA 1M7KA 3AB3B 3RRCA 3RYHE 4YT0A 2ODUA 4PJLA 5JTGA 1XNRT 3UU3A 5CA0E 3IA3A 2VURA 1KNRA 2WU5A 3CQGB 4MFRA 3PUXF 5AFNA 2J1DG 3LK3B 4DVDA 1JNZA 1O3XA 2YN6A 3PUSA 4A98A 1KNZA 3AE6A 5JR9C 2WDRA 3AEDA 1UV6A 5FVKA 3UU5A 4ZK1A 2WNLA 3KV9A 4OHFA 2XY8B 2KINB 5J5IA 2XQ5A 4AFTA 4KP3C 2VKDA 2OLTA 3ZYKA 2ZJVA 4YJ2E 3IF8B 4O8SA 2XSAA 2V26A 5IYZE 1UX2A 3I9WA 4ZZCA 5ABFA 1CHUA 2W67A 2BS3A 4HFHA 3AXJB 3LK2B 3N9NA 3AA1B 3BQIA 3ZT7A 3F57A 3VKGA 4EAHA 2DLRA 2I6HA 2Y58A 2ZM6T 3B5MA 3VR8A 1WLXA 3AAIA 1ZKEA 3T8OA 2Y56A 4JI0T 4X5TA 1LKXA 2MOZA 2A72A 1IAPA 2PH9A 2BR8A 2SPCA 3RYFE 4HFDA 3QNUA 5C8YE 1XWMA 2WNCA 5HEOA 4WBNE 4NIQA 2KXPB 2V1DB 4E7SA 4Q25A 2WCAA 1N32T 5C3JA 4OYJA 3WI3A 1J1JA 4OYKA 2CXLA 3H3MA 4AQFC 4CXXA 1AJ3A 2BR7A 3KBTA 3ZLIA 3QOFA 3NRYA 2Y8DA 4O2BE 5HAXA 1OXZA 4B3ST 3FZLB 2H7OA 5FP3A 3CPZA 2ES0A 1OWAA 2EHOA 3NVOA 3ZMTB 4LF5T 3AA0B 2CBIA 1KFYA 5AQVB 2QC1B 2W4XA 5L3EB 5LCYA 1UUSA 5AQOB 4KHZF 4JI6T 3VR9A 2NP9A 3N2KE 1HF8A 2NW8A 4JLEA 3KBUA 4TN7B 2V5CA 3PU3A 3SS1A 3OVUA 4XBFB 5JMEA 4UXUA 3FZMB 2BKOA 2WP9A 2GK9A 4C90A 5LOVE 3KVBA 2XAJB 4AI6A 4IDNA 5FL0A 2E9XB 3ZDGA 3AE1A 2PG8A 2ZM8A 3FB2A 2AXDS 3DP7A 4UM3P 3AE5A 3AEBA 4DR5T 5EK2A 5AQRB 3LK42 3ZMUB 1B7TA 2K48A 4XHEA 3PUGA 3P4QA 5ABGA 4AFGA 2D9DA 2ACZA 3NWIA 3WTLA 2YK0A 4IHJE 5LXBA 2E9XA 2CHNA 3M3ZB 4ZRUA 2DWGA 3ABVA 4DR2T 4O2AE 3ZSSA 3ZKRA 4EYUA 4IE4A 3RX6A 3N9QA 5AFUL 2Y6XA 5H6QB 4E7ZA 2RPAA 4H9PC 3FHNA 4LFAT 1SE7A 1LVFA 2WMOA 2IC9A 2CA5A 1E1HB 4U2YA 5FJVA 1D1AA 3EHZA 3EDVA 3O1HA 2LSIA 2BKNA 5E0OA 1D0YA 2IAKA 2EHOD 4KI0F 2X68A 5L3BB 4DV0T 5L2LA 4YHHT 4ERRA 3U8JA 3HA4A 3SIOA 2UUBT 1SA0E 4HWCA 2F4VT 4CN4A 3H37A 3UT5E 1NEKA 2X9YA 4A56A 4LF8T 3NRXA 2WM9A 4EEDA 1I9BA 4TX5A 3LG7A 4IE0A 2A2FX 3S4UA 2V7MA 1UK5A 1VOMA 3JAEA 3U78A 5JR9B 4BA9A 3NZPA 2IMLA 4OK0A 3IEEA 4UR9A 3UQ4A 5AFMA 3KINB 2YINA 3PUQA 2W63A 3RIUC 4UY2A 3WIPA 4JUYA 3ZCJA 2MPKA 1UW6A 4AKHA 4WW0A 4AKLA 4GKJT 2XUEA 3FZFB 2VB6A 1QSDA 3C64A 2YDQA 3WTNA 4QHOA 5BW2A 2BYRA 4H9OC 3RKOA 2L8KA 3PV0F 4QAAA 4DMVA 2EHOC 3FZKB 4TWFA 4Z90A 5DQVA 3U8LA 3P8CD 2D0TA 3E08A 5HWXA 1QLBA 1BR2A 3UFEA 4HFIA 3TLSA 1I6ZA 4TWHA 1HG2A 4UF0B 3K3OA 2XQ3A 4X20E 3HKBE 4V1Av 5J5FA 1N36T 5HEJA 2XPKA 2YOEA 1HNZT 4I50E 2YEVC 4KBMB 4DR4T 2BG9C 3JAFA 5AQHB 4LFCT 1ZEEA 4DV1T 2W00A 3AE8A 2PGZA 4LF4T 1YKEB 4LMJA 1XMOT 3KV5A 4CI3B 3F31A 4UV8B 1YKHB 5F8PA 2UXNB 4DR1T 2WWUA 3HL6A 4O4HE 4U7YA 4KMCA 4HWIB 5KX5E 4TNWA 2J4GA 5L4EA 3O1JA 2JIWA 3P7IA 3U8MA 4H63H 5J0ZA 1IJ5A 3N9LA 3RKGA 4BJMA 2BG9E 4L0RA 4ZXLA 4IDPA 3RF1A 5LXTE 3LBXA 3HI2A 2V8SV 3PJAJ 1KEYA 5FXWA 3ZT6A 3AA7B 5SYOA 4UM3S 3TLWA 3CKDA 3OYZA 4ILAA 4HEAA 4PW8A 2E5VA 3KFWX 3OKQA 2BZBA 3A8YC 3KDSE 4AQFA 1HS7A 2ZJUA 2KZ7B 4I55E 4F6RC 4X66T 2QVAA 3PUZF 2W2UA 1UX4A 2IC6A 2NW7A 4B6XA 1VCSA 3OYXA 5HCMA 2NOXA 4DIDB 3ESLA 5KMGP 1H7CA 5AQGB 4ISSA 2LSKA 3MZKB 3PDYA 1L0VA 4NUVA 3K8PC 3M65A 5CB4E 4UM1A 3J9X1 3SRZA 3ZEFB 1BR4A 3U3IA 1MIWA 1KK7A 5HYAA 3J7Yq 5JDMA 1Y01A 3A5XA 3VRBA 2NWBA 3C51A 1DU2A 2XM2A 4CN6A 2UXBT 4CQIA 3LFMA 3HKEE 5CFBA 5HXHA 2XZ5A 3N5LA 5J1GA 5L3GB 3F2EA 2PBIA 3DTOA 3ZJ2A 5LNKA 3ONXA 4QX7B 2Y57A 3EDUA 4GK5E 3U8NA 3SH1A 2JQHA 4B5DA 3AECA 1QUUA 5JDQA 1YW0A 5ABFB 4MHCA 3UULA 3KVAA 1WYBA 3PE0A 4DBMA 2V7IA 3SOLA 2W62A 1HTJF 3ETUA 2HN1A 2VKHA 1KF6A 5J5GA 2KWHA 2XQ7A 4EZHA 2XAFB 2AE9A 4P09A 3EAMA 1UURA 2CCQA 1HNXT 2WDVA 4CXWA 2KNDA 3WAJA 3LSVA 2Z6EA 2LOPA 3ETVA 3GA8A 3PJAA 2LKGA 5EK3A 1MMNA 3ONJA 1XMQT 2XHEB 2BBJA 1FMVA 3FBLA 1MMDA 5AQIB 2QRXA 5L3DB 4CN1A 3RQWA 3A7MA 3C98B 3PUWF 1WYCA 2WB5A 4QX8B 2XQAA 3E0ZA 4YY3T 2LM2A 5AQKB 3CMLA 3VU7H 4CI1B 3RPUA 2VVNA 1J5WA 2OA5A 3Q5DA 5LMUT 1UGOA 2HPJA 3BK9A 3TLTA 3LDQB 3CIRA 5ABHA 3EABA 2XQ4A 2ZMAA 4PK5A 3WTJA 3RHWA 5AQJB 3VKHA 1BR1A 4GYSA 2LLYA 3X1DA 1IJ6A 2YDSA 5BR8T 4WZXA 2NTXA 1HFAA 2NTYA 4YXDA 1WR6A 2EHOB 4AQGA 5JDGA 5ADXL 4PK4A 2X0YA 2KMFA 3RLFF 3ZJ1A 2ZLYA 1Z8UA 4P1NA 4ZK4A 4AQYT 2FJEA 2UXCT 3T1HT 3AA6B 4JBWF 3RIUA 3RI5A 2MYSA 3V5SA 5L3FB 2WZYA 1KNPA 4TZ4C 3NZQA 4GIWA 4LMLA 4BFQA 4GOUA 5J2UE 3C84A 3ZT5A 5LGNB 4U74A 4JI8T 2BVMA 2KT9A 4X1YE 4IE5A 2ODVA 3L09A 4UVCB 2BG9B 2A9UA 3CWZB 4DUYT 3WTIA 4K0UA 2WNJA 5TAOA 5BP0A 5LHGB 4NPPA 2VVSA 4ILUA 3CX8B 5FXXA 1SUMB 4IL4A 2JQ9A 4YSYA 2OV9A 4UELA 1MNDA 2IIUA 2VASA 2BVLA 1WRDA 3UUBA 2WDQA 2BG9A 1U4QA 2QA7A 4UM3A 2WZHA 5LG4A 3T1YT 1ZOYA 5JH7E 3MXZA 3C4ZA 4ZJSA 4H9SE 4YSXA 4U3CA 2BYNA 3GWHA 3JC6D 4LFBT 2C0SA 3TLVA 4JEHB 4YTNA 2JPFA 5AQQB 5LJMA 4XAXB 3UU6A 2X67A 2WAUA 4ASKA 4CI2B 3AEAA 1D0XA 5A1LA 3I0QA 1HG5A 1XDOA 5AQSB 4IREA 3ZYLA 4TNVA 2X9WA 4JEUB 2H88A 4IDOA 5FYMA 3PMZA 3AVSA 1T8BA 2PTFA 4UXNB 5BRXA 3QK6A 5FVLA 2VKOA 3B13A 4ZZBA 4H9RC 4B3MT 2LM9A 2HH7A 4DBRA 2VL8A 5JDNA 3RRWA 4A97A 2WZIA 3UUMA 5JDFA 1IBMT 1XDPA 5KE4A 4LF9T 3EUHA 3RIFA 4DV2T 3AAEB 5AFMB 3JC6C 3FZHB 3AE2A 4JI2T 5HEHA 5HEUA 2RP4A 1OEDA 4PJJA 1IZNB 4XK9A 4L5GA 3HKCE 2D5UA 3N9PA 4H9QC 4HWFA 5AQUB 4ZR6A 1UCUA 2YDRA 5KZUA 4AIUA 2NR4A 2H3RA 1G73A 4IDZA 1W9RA 3GMIA 1G8XA 2DL1A 2E5LT 3ANWB 3OBVE 1FEWA 4AXPA 4OFZA 4YSZA 4X1KE 1SHZC 2WN9A 2LHRA 1XNQT 3R6NA 2KSRA 2LEHA 2XYSA 2Q9QD 4X1IE 4OX9T 1J5ET 4K0KT 3PEOA 1BR0A 4H9NC 2V6YB 3ANWA 4EYYR 3C50A 3AVRA 3AEFA 5DJQC 2JQQA 2XQ9A 4PJNA 4YLHA 4LF7T 4UEMA 2MAWA 2IUBA 4QH1A 2LRLA 4DV5T 5HCJA 4IDQA 5DABA 3RGLA 1FJGT 5J5HA 3H3AA 4ZEYA 2CLYC 1FIOA 3MACA 2V6YA 2UZ6A 2IW5B 3TLUA 2XQ8A 3IHRA 2XASB 3LBXB 2XJ7A 1HX8A 2CMRA 2CEAA 2FUPA 3ZDHA 3N9OA 4FI5A 4IGUA 3UUXB 4EZ4A 1ZHCA 4ILBA 4AKRB 4DNDA 5AINA 4CZZB 2HHHT 4IE7A 2L3LA 5CJ5A 5LG3A 4PK6A 4AFHA 3VHLA 2E2AA 2Q9QC 3QC9A 5JQGE 4AKGA 1S94A 3PUVF 4I43B 3ZSTA 4BQTA 4F8HA 3I1AA 5AQLB 4YTMA 1WFDA 1W0BA 2IHR1 1T7SA 2X0HA 3I0OA 1D0ZA 4H63V 2JJ9A 4ALXA 2ZM0A 4HFVA 3V5UA 3SWHA 4D01A 2LRKA 2CM0A 1MNEA 4DV4T 2UUAT 4ZS3A 4GKKT 4I4TE 4TUYE 3UUNA 2PFVA 4HWDA 5H6RB 2CRBA 2FJBA 4PFPA 3P50A 2K24A 5LHIB 2V7LA 1GQEA 3VRAA 2I0MA 1X9BA 2QYWA 1CUNA 5IWAT 4HQPA 4QXBB 2RA1A 1OEDC 4JV5T 4JI4T 1NWMX 3HKDE 4DBQA 4BAYB 3P4PA 1NENA 4I0UA 2CE7A 2DCFA 5C2TA 1JNRA 2LT3A 4EV6A 3FXDB 2LJLA 3L39A 5ETWA 4U72A 5FMNA 5JDLA 2V7JA 3UQ7A 1Z0PA 4O4JE 3NKZA 4YTPA 5IHYA 3HR0A 1E7PA 4IE6A 4EEBA 2UXDT 3Q5EA 5LA6E 4PNIA 2E8IA 1OEDE 3AEEA 2XM1A 3ZMZB 2XSBA 2W8GA 1HCIA 3JCFA 3UFGA 2FJDA 2BS2A 3P4SA 3ZC0A 5HXRA 5FY7A 5CGMA 2W0GA 4DV7T 2UXXB 5KXJA 3BQKA 3Q9DA 5LMNT 3G06A 2D0UA 5FNVE 2XNUA 4EXTA 4KHPT 2VKJA 2B1EA 4DR6T 4ISTA 2XQ6A 2WU2A 4QH4A 2MTQA 4PIRA 5TVCA 3MJXA 3ZN0B 2VK9A 2FJAA 2ZM2A 5HXCA 3AE3A 4G63A 4U31A 4DR3T 4HFBA 2IDOB 3CQXC 3CX7B 3ZN1B 3RH3A 1UX5A 3DJBA 2CXFA 4DUZT 2LSYA 4YFSA 2X00A 3SFEA 4UV9B 3AE9A 5FKYA 5BMVE 3L8RA 1S35A 3RYIE 4HN9A 2H7VC 3MKDA 4JI7T 3I9YA 4DO0A 5J2TE 4B3TT 3K3QC 3SFDA 2XZEA 5HWYA 5L47A 2D2SA 3RYCE 3CVRA 2J47A 2JMKA 2QGSA 4WBOA 2M6BA 2X9HA 3WTOA 3WTHA 3IGQA 4YJ3E 2LOSA 3AXJA 2CPTA 1MMGA 2XQYA 4GYRA 4U2ZA 4DV6T 3T4MA 2BYSA 4XZCA 3MK7C 4QXHB 1R8IA 2M67A 1MMAA 4ZI3D 4PJMA 3TKLB 3N2GE 4IT4A 4MLKA 1EZ3A 5LYJE 2YU2A 4BJNA 1M62A 2M6IA 2CXDA 3P4WA 2G0UA 5F5WA 3RC8A 3LJCA 3Q5XA 3ZCIA 2DWKA 4N78D 1D1CA 2N2NA 2WY2A 3W15B 3E22E 4WYVA 3GUAA 2W8FA 5FXVA 4ZI7E 2V5DA 4MBQA 4PAGA 5AQPB 4A5XA 4MALA 2CLYB 5IUXA 3R84B 5CA1E 2VQFT 2NW9A 4ZJTA 4X62T 3SQ9A 4WV9A 3PUAA 1VCTA 4HFEA 1D1BA 1I94T 2K5BB 5AFLA 4EZ1A 1HR0T 3WTMA 1WR0A 4U33A 3C4XA 3OTOT 3Q2MA 2X00D 2L9QA 2Q9QB 4FJOA 2DHRA 3ZC1A 5AQMB 5LHHB 1LRZA 5LGTB 2XAHB 4ZI3C 2X51A 3RQUA 4HGAA 3RC3A 4G2AA 4P0BA
chains in the Genus database with same CATH topology
1OEDE 2XQ3A 3C84A 4IREA 4TNVA 2Y58A 5J5FA 3EAMA 3T4MA 2W8GA 2BYSA 2Y54A 4ALXA 2KSRA 4NZBA 5CO5A 2XYSA 4QACA 3U8JA 2XNTA 3PMZA 5HCMA 4QABA 3U8KA 4QH5A 3SIOA 2YMDA 3LSVA 5L4HA 2Y56A 4UXUA 2XZ6A 3PEOA 5JMEA 5HEJA 2YOEA 2BG9B 4D01A 2LKGA 4X5TA 5BRXA 3WTIA 2BG9C 3JADA 3UU4A 3JAFA 2PH9A 4ZZBA 2M6IA 2BR8A 2WNJA 3P4WA 5AFHA 3RQWA 4UM1A 5BP0A 4NPPA 2PGZA 2XQAA 3ZDGA 2XQ9A 2LM2A 2YKSA 4LMJA 2XNUA 4HFDA 4IL4A 3UU3A 4A97A 4UM3P 1I9BA 2WNCA 2XQ6A 5HEOA 3P50A 2MAWA 4QH4A 4PIRA 5TVCA 4ILCA 4HFCA 4QH1A 4IL9A 3GUAA 2W8FA 3TLTA 4XHEA 5AFNA 5KE4A 3JAEA 3UUBA 2C9TA 2VL0A 5HCJA 2YN6A 3RIFA 4HFBA 5IUXA 2XQ4A 2BG9A 4A98A 4AFGA 5J5HA 5AFMB 5CFBA 1OEDB 3WTJA 4UM3A 3C79A 3RHWA 2XZ5A 4COFA 4HQPA 5HEHA 3UQ4A 2UZ6A 3WTLA 5HEUA 2X00A 1OEDC 4TNWA 4LMKA 5L4EA 1OEDA 5AFMA 1UV6A 5LXBA 4ZK1A 3UU5A 2LLYA 4XK9A 4ZJTA 2WNLA 3SQ9A 3TLUA 2XQ8A 2YMEA 3U8MA 2Y57A 5J0ZA 2BR7A 4UY2A 3WIPA 4ZJSA 5AFJA 3U8NA 2LKHA 4ZRUA 2BG9E 3SH1A 4WV9A 3EI0A 5J5IA 1UW6A 2XQ5A 2BYQA 4AFTA 3ZDHA 4HFEA 3UU8A 2BYNA 5AFLA 4FRRA 4B5DA 4EZ1A 4ZR6A 3WTMA 3ZKRA 3TLVA 2ZJVA 3WTNA 5L47A 4ILBA 4Z91A 2X00D 5AINA 5SYOA 4UM3S 5BW2A 3TLWA 2BYRA 5KZUA 4ILAA 4QAAA 3SQ6A 3WTKA 1UX2A 5LG3A 2BJ0A 4TWFA 4ZZCA 4AFHA 3UU6A 4Z90A 2M6BA 4DBMA 3UQ7A 4ZK4A 3U8LA 2ZJUA 2XNVA 2BYPA 3RIAA 4TWDA 3WTOA 4HFHA 5HEGA 2QC1B 3WTHA 3RI5A 3IGQA 2Y7YA 4BQTA 5FJVA 5AFKA 4HFIA 3EHZA 2WZYA 3TLSA 4F8HA 4TWHA 2XYTA 5J5GA 3RQUA 2WN9A 4LMLA 4BFQA 2XQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OED E;  2XQ3 A;  3C84 A;  4IRE A;  4TNV A;  2Y58 A;  5J5F A;  3EAM A;  3T4M A;  2W8G A;  2BYS A;  2Y54 A;  4ALX A;  2KSR A;  4NZB A;  5CO5 A;  2XYS A;  4QAC A;  3U8J A;  2XNT A;  3PMZ A;  5HCM A;  4QAB A;  3U8K A;  4QH5 A;  3SIO A;  2YMD A;  3LSV A;  5L4H A;  2Y56 A;  4UXU A;  2XZ6 A;  3PEO A;  5JME A;  5HEJ A;  2YOE A;  2BG9 B;  4D01 A;  2LKG A;  4X5T A;  5BRX A;  3WTI A;  2BG9 C;  3JAD A;  3UU4 A;  3JAF A;  2PH9 A;  4ZZB A;  2M6I A;  2BR8 A;  2WNJ A;  3P4W A;  5AFH A;  3RQW A;  4UM1 A;  5BP0 A;  4NPP A;  2PGZ A;  2XQA A;  3ZDG A;  2XQ9 A;  2LM2 A;  2YKS A;  4LMJ A;  2XNU A;  4HFD A;  4IL4 A;  3UU3 A;  4A97 A;  4UM3 P;  1I9B A;  2WNC A;  2XQ6 A;  5HEO A;  3P50 A;  2MAW A;  4QH4 A;  4PIR A;  5TVC A;  4ILC A;  4HFC A;  4QH1 A;  4IL9 A;  3GUA A;  2W8F A;  3TLT A;  4XHE A;  5AFN A;  5KE4 A;  3JAE A;  3UUB A;  2C9T A;  2VL0 A;  5HCJ A;  2YN6 A;  3RIF A;  4HFB A;  5IUX A;  2XQ4 A;  2BG9 A;  4A98 A;  4AFG A;  5J5H A;  5AFM B;  5CFB A;  1OED B;  3WTJ A;  4UM3 A;  3C79 A;  3RHW A;  2XZ5 A;  4COF A;  4HQP A;  5HEH A;  3UQ4 A;  2UZ6 A;  3WTL A;  5HEU A;  2X00 A;  1OED C;  4TNW A;  4LMK A;  5L4E A;  1OED A;  5AFM A;  1UV6 A;  5LXB A;  4ZK1 A;  3UU5 A;  2LLY A;  4XK9 A;  4ZJT A;  2WNL A;  3SQ9 A;  3TLU A;  2XQ8 A;  2YME A;  3U8M A;  2Y57 A;  5J0Z A;  2BR7 A;  4UY2 A;  3WIP A;  4ZJS A;  5AFJ A;  3U8N A;  2LKH A;  4ZRU A;  2BG9 E;  3SH1 A;  4WV9 A;  3EI0 A;  5J5I A;  1UW6 A;  2XQ5 A;  2BYQ A;  4AFT A;  3ZDH A;  4HFE A;  3UU8 A;  2BYN A;  5AFL A;  4FRR A;  4B5D A;  4EZ1 A;  4ZR6 A;  3WTM A;  3ZKR A;  3TLV A;  2ZJV A;  3WTN A;  5L47 A;  4ILB A;  4Z91 A;  2X00 D;  5AIN A;  5SYO A;  4UM3 S;  5BW2 A;  3TLW A;  2BYR A;  5KZU A;  4ILA A;  4QAA A;  3SQ6 A;  3WTK A;  1UX2 A;  5LG3 A;  2BJ0 A;  4TWF A;  4ZZC A;  4AFH A;  3UU6 A;  4Z90 A;  2M6B A;  4DBM A;  3UQ7 A;  4ZK4 A;  3U8L A;  2ZJU A;  2XNV A;  2BYP A;  3RIA A;  4TWD A;  3WTO A;  4HFH A;  5HEG A;  2QC1 B;  3WTH A;  3RI5 A;  3IGQ A;  2Y7Y A;  4BQT A;  5FJV A;  5AFK A;  4HFI A;  3EHZ A;  2WZY A;  3TLS A;  4F8H A;  4TWH A;  2XYT A;  5J5G A;  3RQU A;  2WN9 A;  4LML A;  4BFQ A;  2XQ7 A; 
#chains in the Genus database with same CATH topology
 2YU1 A;  5JRC B;  5EZY E;  4LF6 T;  2V6X A;  2WQY A;  2C5I T;  3U8K A;  2YMD A;  5L4H A;  4QWN B;  2Q9Q A;  2XAQ B;  2LE8 A;  5AQN B;  3UU4 A;  5GON E;  3UTK A;  4ZI2 D;  4TV9 E;  2CBJ A;  2W61 A;  2JQK A;  3AE4 A;  4IIJ E;  5JRC A;  4L9I A;  1IBL T;  1W0A A;  2K9A A;  4HFC A;  4UVA B;  3AAA B;  5HXE A;  5F3J A;  2J62 A;  3ZMS B;  1OED B;  4HWH A;  5FXZ A;  4JYA T;  4QXC B;  1HX1 B;  4JI1 T;  4AKI A;  4CXY A;  1YQ4 A;  4ZS2 A;  3AE7 A;  2BS4 A;  1MIY A;  1NAF A;  4PFO A;  2XTL A;  3SQ6 A;  2LHN A;  4O4I E;  3WTK A;  2B76 A;  2BDE A;  2X9X A;  3N2O A;  4ADZ A;  3L3P A;  3Q5W A;  3RIA A;  2JRK A;  5HEG A;  4B3R T;  2Y7Y A;  5AFK A;  3PU8 A;  2DI4 A;  3CQC B;  4GK0 E;  2LSJ A;  4ZI2 C;  4KUM B;  3BQL A;  5CO5 A;  4EGW A;  3IBP A;  4Z8X A;  2C5J A;  2W66 A;  2WWV A;  5JDH A;  2P9B A;  3ZPO A;  4J2C A;  4X64 T;  3KV4 A;  4JI5 T;  3FXE B;  2V7K A;  5AQT B;  1MIV A;  4ILC A;  2KWI B;  1WCR A;  4IL9 A;  5HXS A;  2C9T A;  2VL0 A;  3KV6 A;  2HPL A;  3ONL C;  4AIS A;  3C79 A;  3QB5 A;  5JR9 A;  5M4Y A;  5LP6 E;  3PTR B;  4DV3 T;  2E9X D;  4LMK A;  4EOZ B;  4O4L E;  4JI3 T;  4QKN A;  4KX6 A;  2LSG A;  1FMW A;  5AFJ A;  2N1G A;  2H89 A;  3EI0 A;  2BYQ A;  1E2A A;  3UU8 A;  3PUR A;  2CWO A;  5LBM A;  5JRE A;  4U7I A;  2MBG A;  2FBW A;  4Z91 A;  5FY0 A;  1ZP0 A;  2BJ0 A;  1VRB A;  4ANJ A;  1YXR A;  5KDM C;  5ABE A;  1N33 T;  3O4X E;  2C5K T;  3OJA A;  2CWY A;  4WNK A;  1T72 A;  3C4W A;  5DQW A;  4UF0 A;  4X65 T;  3ZYM A;  4NZB A;  4QAC A;  5EK4 A;  2XZ6 A;  2I59 A;  2JMH A;  2HN2 A;  5L3C B;  3QB5 K;  3K1S A;  2UU9 T;  1X79 A;  3PUY F;  3JAD A;  2N9D A;  2WMN A;  4YHJ A;  3D0T A;  5AFH A;  4P0A A;  1XZY A;  2PJQ A;  4HE8 A;  3N9M A;  2UUC T;  3O9X A;  2YKS A;  3NBX X;  5FY1 A;  2VQE T;  2E9X C;  4DMW A;  5LGU B;  1HNW T;  3P4R A;  4C91 A;  3ZMV B;  4HTE A;  1U5P A;  3K3N A;  5JVD E;  2K3W A;  2WBL A;  2XAG B;  4UVB B;  4NXN T;  1US7 B;  4DR7 T;  4NUU A;  2WS3 A;  4COF A;  5LJN A;  5LB7 B;  2WSS V;  2YME A;  2LKH A;  1IBK T;  3GN5 B;  1ZV4 X;  2VWA A;  3OPC A;  4ZOL E;  4FRR A;  2A3D A;  4ZHQ E;  3B57 A;  2DNX A;  2X0L B;  1W09 A;  1V9D A;  4HKA A;  5AQF B;  4M1P A;  1T98 A;  2X66 A;  4EIW A;  2XNV A;  4EB6 E;  2BYP A;  4TWD A;  2ACX A;  3AEG A;  2R6G F;  2CHO A;  1YD8 G;  1Y64 B;  4NXM T;  4UIG A;  1N34 T;  5FL1 A;  2XYT A;  3QUJ A;  3GN5 A;  1YQ3 A;  2Y48 B;  5LBQ B;  2Y54 A;  3FBZ A;  3O1I A;  3MA9 A;  1LVK A;  2XNT A;  4QAB A;  2BBH A;  4QH5 A;  3CX6 B;  4TV8 E;  3EVY A;  3WAK A;  3CK6 A;  2KLQ A;  2BKP A;  1M7K A;  3AB3 B;  3RRC A;  3RYH E;  4YT0 A;  2ODU A;  4PJL A;  5JTG A;  1XNR T;  3UU3 A;  5CA0 E;  3IA3 A;  2VUR A;  1KNR A;  2WU5 A;  3CQG B;  4MFR A;  3PUX F;  5AFN A;  2J1D G;  3LK3 B;  4DVD A;  1JNZ A;  1O3X A;  2YN6 A;  3PUS A;  4A98 A;  1KNZ A;  3AE6 A;  5JR9 C;  2WDR A;  3AED A;  1UV6 A;  5FVK A;  3UU5 A;  4ZK1 A;  2WNL A;  3KV9 A;  4OHF A;  2XY8 B;  2KIN B;  5J5I A;  2XQ5 A;  4AFT A;  4KP3 C;  2VKD A;  2OLT A;  3ZYK A;  2ZJV A;  4YJ2 E;  3IF8 B;  4O8S A;  2XSA A;  2V26 A;  5IYZ E;  1UX2 A;  3I9W A;  4ZZC A;  5ABF A;  1CHU A;  2W67 A;  2BS3 A;  4HFH A;  3AXJ B;  3LK2 B;  3N9N A;  3AA1 B;  3BQI A;  3ZT7 A;  3F57 A;  3VKG A;  4EAH A;  2DLR A;  2I6H A;  2Y58 A;  2ZM6 T;  3B5M A;  3VR8 A;  1WLX A;  3AAI A;  1ZKE A;  3T8O A;  2Y56 A;  4JI0 T;  4X5T A;  1LKX A;  2MOZ A;  2A72 A;  1IAP A;  2PH9 A;  2BR8 A;  2SPC A;  3RYF E;  4HFD A;  3QNU A;  5C8Y E;  1XWM A;  2WNC A;  5HEO A;  4WBN E;  4NIQ A;  2KXP B;  2V1D B;  4E7S A;  4Q25 A;  2WCA A;  1N32 T;  5C3J A;  4OYJ A;  3WI3 A;  1J1J A;  4OYK A;  2CXL A;  3H3M A;  4AQF C;  4CXX A;  1AJ3 A;  2BR7 A;  3KBT A;  3ZLI A;  3QOF A;  3NRY A;  2Y8D A;  4O2B E;  5HAX A;  1OXZ A;  4B3S T;  3FZL B;  2H7O A;  5FP3 A;  3CPZ A;  2ES0 A;  1OWA A;  2EHO A;  3NVO A;  3ZMT B;  4LF5 T;  3AA0 B;  2CBI A;  1KFY A;  5AQV B;  2QC1 B;  2W4X A;  5L3E B;  5LCY A;  1UUS A;  5AQO B;  4KHZ F;  4JI6 T;  3VR9 A;  2NP9 A;  3N2K E;  1HF8 A;  2NW8 A;  4JLE A;  3KBU A;  4TN7 B;  2V5C A;  3PU3 A;  3SS1 A;  3OVU A;  4XBF B;  5JME A;  4UXU A;  3FZM B;  2BKO A;  2WP9 A;  2GK9 A;  4C90 A;  5LOV E;  3KVB A;  2XAJ B;  4AI6 A;  4IDN A;  5FL0 A;  2E9X B;  3ZDG A;  3AE1 A;  2PG8 A;  2ZM8 A;  3FB2 A;  2AXD S;  3DP7 A;  4UM3 P;  3AE5 A;  3AEB A;  4DR5 T;  5EK2 A;  5AQR B;  3LK4 2;  3ZMU B;  1B7T A;  2K48 A;  4XHE A;  3PUG A;  3P4Q A;  5ABG A;  4AFG A;  2D9D A;  2ACZ A;  3NWI A;  3WTL A;  2YK0 A;  4IHJ E;  5LXB A;  2E9X A;  2CHN A;  3M3Z B;  4ZRU A;  2DWG A;  3ABV A;  4DR2 T;  4O2A E;  3ZSS A;  3ZKR A;  4EYU A;  4IE4 A;  3RX6 A;  3N9Q A;  5AFU L;  2Y6X A;  5H6Q B;  4E7Z A;  2RPA A;  4H9P C;  3FHN A;  4LFA T;  1SE7 A;  1LVF A;  2WMO A;  2IC9 A;  2CA5 A;  1E1H B;  4U2Y A;  5FJV A;  1D1A A;  3EHZ A;  3EDV A;  3O1H A;  2LSI A;  2BKN A;  5E0O A;  1D0Y A;  2IAK A;  2EHO D;  4KI0 F;  2X68 A;  5L3B B;  4DV0 T;  5L2L A;  4YHH T;  4ERR A;  3U8J A;  3HA4 A;  3SIO A;  2UUB T;  1SA0 E;  4HWC A;  2F4V T;  4CN4 A;  3H37 A;  3UT5 E;  1NEK A;  2X9Y A;  4A56 A;  4LF8 T;  3NRX A;  2WM9 A;  4EED A;  1I9B A;  4TX5 A;  3LG7 A;  4IE0 A;  2A2F X;  3S4U A;  2V7M A;  1UK5 A;  1VOM A;  3JAE A;  3U78 A;  5JR9 B;  4BA9 A;  3NZP A;  2IML A;  4OK0 A;  3IEE A;  4UR9 A;  3UQ4 A;  5AFM A;  3KIN B;  2YIN A;  3PUQ A;  2W63 A;  3RIU C;  4UY2 A;  3WIP A;  4JUY A;  3ZCJ A;  2MPK A;  1UW6 A;  4AKH A;  4WW0 A;  4AKL A;  4GKJ T;  2XUE A;  3FZF B;  2VB6 A;  1QSD A;  3C64 A;  2YDQ A;  3WTN A;  4QHO A;  5BW2 A;  2BYR A;  4H9O C;  3RKO A;  2L8K A;  3PV0 F;  4QAA A;  4DMV A;  2EHO C;  3FZK B;  4TWF A;  4Z90 A;  5DQV A;  3U8L A;  3P8C D;  2D0T A;  3E08 A;  5HWX A;  1QLB A;  1BR2 A;  3UFE A;  4HFI A;  3TLS A;  1I6Z A;  4TWH A;  1HG2 A;  4UF0 B;  3K3O A;  2XQ3 A;  4X20 E;  3HKB E;  4V1A v;  5J5F A;  1N36 T;  5HEJ A;  2XPK A;  2YOE A;  1HNZ T;  4I50 E;  2YEV C;  4KBM B;  4DR4 T;  2BG9 C;  3JAF A;  5AQH B;  4LFC T;  1ZEE A;  4DV1 T;  2W00 A;  3AE8 A;  2PGZ A;  4LF4 T;  1YKE B;  4LMJ A;  1XMO T;  3KV5 A;  4CI3 B;  3F31 A;  4UV8 B;  1YKH B;  5F8P A;  2UXN B;  4DR1 T;  2WWU A;  3HL6 A;  4O4H E;  4U7Y A;  4KMC A;  4HWI B;  5KX5 E;  4TNW A;  2J4G A;  5L4E A;  3O1J A;  2JIW A;  3P7I A;  3U8M A;  4H63 H;  5J0Z A;  1IJ5 A;  3N9L A;  3RKG A;  4BJM A;  2BG9 E;  4L0R A;  4ZXL A;  4IDP A;  3RF1 A;  5LXT E;  3LBX A;  3HI2 A;  2V8S V;  3PJA J;  1KEY A;  5FXW A;  3ZT6 A;  3AA7 B;  5SYO A;  4UM3 S;  3TLW A;  3CKD A;  3OYZ A;  4ILA A;  4HEA A;  4PW8 A;  2E5V A;  3KFW X;  3OKQ A;  2BZB A;  3A8Y C;  3KDS E;  4AQF A;  1HS7 A;  2ZJU A;  2KZ7 B;  4I55 E;  4F6R C;  4X66 T;  2QVA A;  3PUZ F;  2W2U A;  1UX4 A;  2IC6 A;  2NW7 A;  4B6X A;  1VCS A;  3OYX A;  5HCM A;  2NOX A;  4DID B;  3ESL A;  5KMG P;  1H7C A;  5AQG B;  4ISS A;  2LSK A;  3MZK B;  3PDY A;  1L0V A;  4NUV A;  3K8P C;  3M65 A;  5CB4 E;  4UM1 A;  3J9X 1;  3SRZ A;  3ZEF B;  1BR4 A;  3U3I A;  1MIW A;  1KK7 A;  5HYA A;  3J7Y q;  5JDM A;  1Y01 A;  3A5X A;  3VRB A;  2NWB A;  3C51 A;  1DU2 A;  2XM2 A;  4CN6 A;  2UXB T;  4CQI A;  3LFM A;  3HKE E;  5CFB A;  5HXH A;  2XZ5 A;  3N5L A;  5J1G A;  5L3G B;  3F2E A;  2PBI A;  3DTO A;  3ZJ2 A;  5LNK A;  3ONX A;  4QX7 B;  2Y57 A;  3EDU A;  4GK5 E;  3U8N A;  3SH1 A;  2JQH A;  4B5D A;  3AEC A;  1QUU A;  5JDQ A;  1YW0 A;  5ABF B;  4MHC A;  3UUL A;  3KVA A;  1WYB A;  3PE0 A;  4DBM A;  2V7I A;  3SOL A;  2W62 A;  1HTJ F;  3ETU A;  2HN1 A;  2VKH A;  1KF6 A;  5J5G A;  2KWH A;  2XQ7 A;  4EZH A;  2XAF B;  2AE9 A;  4P09 A;  3EAM A;  1UUR A;  2CCQ A;  1HNX T;  2WDV A;  4CXW A;  2KND A;  3WAJ A;  3LSV A;  2Z6E A;  2LOP A;  3ETV A;  3GA8 A;  3PJA A;  2LKG A;  5EK3 A;  1MMN A;  3ONJ A;  1XMQ T;  2XHE B;  2BBJ A;  1FMV A;  3FBL A;  1MMD A;  5AQI B;  2QRX A;  5L3D B;  4CN1 A;  3RQW A;  3A7M A;  3C98 B;  3PUW F;  1WYC A;  2WB5 A;  4QX8 B;  2XQA A;  3E0Z A;  4YY3 T;  2LM2 A;  5AQK B;  3CML A;  3VU7 H;  4CI1 B;  3RPU A;  2VVN A;  1J5W A;  2OA5 A;  3Q5D A;  5LMU T;  1UGO A;  2HPJ A;  3BK9 A;  3TLT A;  3LDQ B;  3CIR A;  5ABH A;  3EAB A;  2XQ4 A;  2ZMA A;  4PK5 A;  3WTJ A;  3RHW A;  5AQJ B;  3VKH A;  1BR1 A;  4GYS A;  2LLY A;  3X1D A;  1IJ6 A;  2YDS A;  5BR8 T;  4WZX A;  2NTX A;  1HFA A;  2NTY A;  4YXD A;  1WR6 A;  2EHO B;  4AQG A;  5JDG A;  5ADX L;  4PK4 A;  2X0Y A;  2KMF A;  3RLF F;  3ZJ1 A;  2ZLY A;  1Z8U A;  4P1N A;  4ZK4 A;  4AQY T;  2FJE A;  2UXC T;  3T1H T;  3AA6 B;  4JBW F;  3RIU A;  3RI5 A;  2MYS A;  3V5S A;  5L3F B;  2WZY A;  1KNP A;  4TZ4 C;  3NZQ A;  4GIW A;  4LML A;  4BFQ A;  4GOU A;  5J2U E;  3C84 A;  3ZT5 A;  5LGN B;  4U74 A;  4JI8 T;  2BVM A;  2KT9 A;  4X1Y E;  4IE5 A;  2ODV A;  3L09 A;  4UVC B;  2BG9 B;  2A9U A;  3CWZ B;  4DUY T;  3WTI A;  4K0U A;  2WNJ A;  5TAO A;  5BP0 A;  5LHG B;  4NPP A;  2VVS A;  4ILU A;  3CX8 B;  5FXX A;  1SUM B;  4IL4 A;  2JQ9 A;  4YSY A;  2OV9 A;  4UEL A;  1MND A;  2IIU A;  2VAS A;  2BVL A;  1WRD A;  3UUB A;  2WDQ A;  2BG9 A;  1U4Q A;  2QA7 A;  4UM3 A;  2WZH A;  5LG4 A;  3T1Y T;  1ZOY A;  5JH7 E;  3MXZ A;  3C4Z A;  4ZJS A;  4H9S E;  4YSX A;  4U3C A;  2BYN A;  3GWH A;  3JC6 D;  4LFB T;  2C0S A;  3TLV A;  4JEH B;  4YTN A;  2JPF A;  5AQQ B;  5LJM A;  4XAX B;  3UU6 A;  2X67 A;  2WAU A;  4ASK A;  4CI2 B;  3AEA A;  1D0X A;  5A1L A;  3I0Q A;  1HG5 A;  1XDO A;  5AQS B;  4IRE A;  3ZYL A;  4TNV A;  2X9W A;  4JEU B;  2H88 A;  4IDO A;  5FYM A;  3PMZ A;  3AVS A;  1T8B A;  2PTF A;  4UXN B;  5BRX A;  3QK6 A;  5FVL A;  2VKO A;  3B13 A;  4ZZB A;  4H9R C;  4B3M T;  2LM9 A;  2HH7 A;  4DBR A;  2VL8 A;  5JDN A;  3RRW A;  4A97 A;  2WZI A;  3UUM A;  5JDF A;  1IBM T;  1XDP A;  5KE4 A;  4LF9 T;  3EUH A;  3RIF A;  4DV2 T;  3AAE B;  5AFM B;  3JC6 C;  3FZH B;  3AE2 A;  4JI2 T;  5HEH A;  5HEU A;  2RP4 A;  1OED A;  4PJJ A;  1IZN B;  4XK9 A;  4L5G A;  3HKC E;  2D5U A;  3N9P A;  4H9Q C;  4HWF A;  5AQU B;  4ZR6 A;  1UCU A;  2YDR A;  5KZU A;  4AIU A;  2NR4 A;  2H3R A;  1G73 A;  4IDZ A;  1W9R A;  3GMI A;  1G8X A;  2DL1 A;  2E5L T;  3ANW B;  3OBV E;  1FEW A;  4AXP A;  4OFZ A;  4YSZ A;  4X1K E;  1SHZ C;  2WN9 A;  2LHR A;  1XNQ T;  3R6N A;  2KSR A;  2LEH A;  2XYS A;  2Q9Q D;  4X1I E;  4OX9 T;  1J5E T;  4K0K T;  3PEO A;  1BR0 A;  4H9N C;  2V6Y B;  3ANW A;  4EYY R;  3C50 A;  3AVR A;  3AEF A;  5DJQ C;  2JQQ A;  2XQ9 A;  4PJN A;  4YLH A;  4LF7 T;  4UEM A;  2MAW A;  2IUB A;  4QH1 A;  2LRL A;  4DV5 T;  5HCJ A;  4IDQ A;  5DAB A;  3RGL A;  1FJG T;  5J5H A;  3H3A A;  4ZEY A;  2CLY C;  1FIO A;  3MAC A;  2V6Y A;  2UZ6 A;  2IW5 B;  3TLU A;  2XQ8 A;  3IHR A;  2XAS B;  3LBX B;  2XJ7 A;  1HX8 A;  2CMR A;  2CEA A;  2FUP A;  3ZDH A;  3N9O A;  4FI5 A;  4IGU A;  3UUX B;  4EZ4 A;  1ZHC A;  4ILB A;  4AKR B;  4DND A;  5AIN A;  4CZZ B;  2HHH T;  4IE7 A;  2L3L A;  5CJ5 A;  5LG3 A;  4PK6 A;  4AFH A;  3VHL A;  2E2A A;  2Q9Q C;  3QC9 A;  5JQG E;  4AKG A;  1S94 A;  3PUV F;  4I43 B;  3ZST A;  4BQT A;  4F8H A;  3I1A A;  5AQL B;  4YTM A;  1WFD A;  1W0B A;  2IHR 1;  1T7S A;  2X0H A;  3I0O A;  1D0Z A;  4H63 V;  2JJ9 A;  4ALX A;  2ZM0 A;  4HFV A;  3V5U A;  3SWH A;  4D01 A;  2LRK A;  2CM0 A;  1MNE A;  4DV4 T;  2UUA T;  4ZS3 A;  4GKK T;  4I4T E;  4TUY E;  3UUN A;  2PFV A;  4HWD A;  5H6R B;  2CRB A;  2FJB A;  4PFP A;  3P50 A;  2K24 A;  5LHI B;  2V7L A;  1GQE A;  3VRA A;  2I0M A;  1X9B A;  2QYW A;  1CUN A;  5IWA T;  4HQP A;  4QXB B;  2RA1 A;  1OED C;  4JV5 T;  4JI4 T;  1NWM X;  3HKD E;  4DBQ A;  4BAY B;  3P4P A;  1NEN A;  4I0U A;  2CE7 A;  2DCF A;  5C2T A;  1JNR A;  2LT3 A;  4EV6 A;  3FXD B;  2LJL A;  3L39 A;  5ETW A;  4U72 A;  5FMN A;  5JDL A;  2V7J A;  3UQ7 A;  1Z0P A;  4O4J E;  3NKZ A;  4YTP A;  5IHY A;  3HR0 A;  1E7P A;  4IE6 A;  4EEB A;  2UXD T;  3Q5E A;  5LA6 E;  4PNI A;  2E8I A;  1OED E;  3AEE A;  2XM1 A;  3ZMZ B;  2XSB A;  2W8G A;  1HCI A;  3JCF A;  3UFG A;  2FJD A;  2BS2 A;  3P4S A;  3ZC0 A;  5HXR A;  5FY7 A;  5CGM A;  2W0G A;  4DV7 T;  2UXX B;  5KXJ A;  3BQK A;  3Q9D A;  5LMN T;  3G06 A;  2D0U A;  5FNV E;  2XNU A;  4EXT A;  4KHP T;  2VKJ A;  2B1E A;  4DR6 T;  4IST A;  2XQ6 A;  2WU2 A;  4QH4 A;  2MTQ A;  4PIR A;  5TVC A;  3MJX A;  3ZN0 B;  2VK9 A;  2FJA A;  2ZM2 A;  5HXC A;  3AE3 A;  4G63 A;  4U31 A;  4DR3 T;  4HFB A;  2IDO B;  3CQX C;  3CX7 B;  3ZN1 B;  3RH3 A;  1UX5 A;  3DJB A;  2CXF A;  4DUZ T;  2LSY A;  4YFS A;  2X00 A;  3SFE A;  4UV9 B;  3AE9 A;  5FKY A;  5BMV E;  3L8R A;  1S35 A;  3RYI E;  4HN9 A;  2H7V C;  3MKD A;  4JI7 T;  3I9Y A;  4DO0 A;  5J2T E;  4B3T T;  3K3Q C;  3SFD A;  2XZE A;  5HWY A;  5L47 A;  2D2S A;  3RYC E;  3CVR A;  2J47 A;  2JMK A;  2QGS A;  4WBO A;  2M6B A;  2X9H A;  3WTO A;  3WTH A;  3IGQ A;  4YJ3 E;  2LOS A;  3AXJ A;  2CPT A;  1MMG A;  2XQY A;  4GYR A;  4U2Z A;  4DV6 T;  3T4M A;  2BYS A;  4XZC A;  3MK7 C;  4QXH B;  1R8I A;  2M67 A;  1MMA A;  4ZI3 D;  4PJM A;  3TKL B;  3N2G E;  4IT4 A;  4MLK A;  1EZ3 A;  5LYJ E;  2YU2 A;  4BJN A;  1M62 A;  2M6I A;  2CXD A;  3P4W A;  2G0U A;  5F5W A;  3RC8 A;  3LJC A;  3Q5X A;  3ZCI A;  2DWK A;  4N78 D;  1D1C A;  2N2N A;  2WY2 A;  3W15 B;  3E22 E;  4WYV A;  3GUA A;  2W8F A;  5FXV A;  4ZI7 E;  2V5D A;  4MBQ A;  4PAG A;  5AQP B;  4A5X A;  4MAL A;  2CLY B;  5IUX A;  3R84 B;  5CA1 E;  2VQF T;  2NW9 A;  4ZJT A;  4X62 T;  3SQ9 A;  4WV9 A;  3PUA A;  1VCT A;  4HFE A;  1D1B A;  1I94 T;  2K5B B;  5AFL A;  4EZ1 A;  1HR0 T;  3WTM A;  1WR0 A;  4U33 A;  3C4X A;  3OTO T;  3Q2M A;  2X00 D;  2L9Q A;  2Q9Q B;  4FJO A;  2DHR A;  3ZC1 A;  5AQM B;  5LHH B;  1LRZ A;  5LGT B;  2XAH B;  4ZI3 C;  2X51 A;  3RQU A;  4HGA A;  3RC3 A;  4G2A A;  4P0B A; 
#chains in the Genus database with same CATH homology
 1OED E;  2XQ3 A;  3C84 A;  4IRE A;  4TNV A;  2Y58 A;  5J5F A;  3EAM A;  3T4M A;  2W8G A;  2BYS A;  2Y54 A;  4ALX A;  2KSR A;  4NZB A;  5CO5 A;  2XYS A;  4QAC A;  3U8J A;  2XNT A;  3PMZ A;  5HCM A;  4QAB A;  3U8K A;  4QH5 A;  3SIO A;  2YMD A;  3LSV A;  5L4H A;  2Y56 A;  4UXU A;  2XZ6 A;  3PEO A;  5JME A;  5HEJ A;  2YOE A;  2BG9 B;  4D01 A;  2LKG A;  4X5T A;  5BRX A;  3WTI A;  2BG9 C;  3JAD A;  3UU4 A;  3JAF A;  2PH9 A;  4ZZB A;  2M6I A;  2BR8 A;  2WNJ A;  3P4W A;  5AFH A;  3RQW A;  4UM1 A;  5BP0 A;  4NPP A;  2PGZ A;  2XQA A;  3ZDG A;  2XQ9 A;  2LM2 A;  2YKS A;  4LMJ A;  2XNU A;  4HFD A;  4IL4 A;  3UU3 A;  4A97 A;  4UM3 P;  1I9B A;  2WNC A;  2XQ6 A;  5HEO A;  3P50 A;  2MAW A;  4QH4 A;  4PIR A;  5TVC A;  4ILC A;  4HFC A;  4QH1 A;  4IL9 A;  3GUA A;  2W8F A;  3TLT A;  4XHE A;  5AFN A;  5KE4 A;  3JAE A;  3UUB A;  2C9T A;  2VL0 A;  5HCJ A;  2YN6 A;  3RIF A;  4HFB A;  5IUX A;  2XQ4 A;  2BG9 A;  4A98 A;  4AFG A;  5J5H A;  5AFM B;  5CFB A;  1OED B;  3WTJ A;  4UM3 A;  3C79 A;  3RHW A;  2XZ5 A;  4COF A;  4HQP A;  5HEH A;  3UQ4 A;  2UZ6 A;  3WTL A;  5HEU A;  2X00 A;  1OED C;  4TNW A;  4LMK A;  5L4E A;  1OED A;  5AFM A;  1UV6 A;  5LXB A;  4ZK1 A;  3UU5 A;  2LLY A;  4XK9 A;  4ZJT A;  2WNL A;  3SQ9 A;  3TLU A;  2XQ8 A;  2YME A;  3U8M A;  2Y57 A;  5J0Z A;  2BR7 A;  4UY2 A;  3WIP A;  4ZJS A;  5AFJ A;  3U8N A;  2LKH A;  4ZRU A;  2BG9 E;  3SH1 A;  4WV9 A;  3EI0 A;  5J5I A;  1UW6 A;  2XQ5 A;  2BYQ A;  4AFT A;  3ZDH A;  4HFE A;  3UU8 A;  2BYN A;  5AFL A;  4FRR A;  4B5D A;  4EZ1 A;  4ZR6 A;  3WTM A;  3ZKR A;  3TLV A;  2ZJV A;  3WTN A;  5L47 A;  4ILB A;  4Z91 A;  2X00 D;  5AIN A;  5SYO A;  4UM3 S;  5BW2 A;  3TLW A;  2BYR A;  5KZU A;  4ILA A;  4QAA A;  3SQ6 A;  3WTK A;  1UX2 A;  5LG3 A;  2BJ0 A;  4TWF A;  4ZZC A;  4AFH A;  3UU6 A;  4Z90 A;  2M6B A;  4DBM A;  3UQ7 A;  4ZK4 A;  3U8L A;  2ZJU A;  2XNV A;  2BYP A;  3RIA A;  4TWD A;  3WTO A;  4HFH A;  5HEG A;  2QC1 B;  3WTH A;  3RI5 A;  3IGQ A;  2Y7Y A;  4BQT A;  5FJV A;  5AFK A;  4HFI A;  3EHZ A;  2WZY A;  3TLS A;  4F8H A;  4TWH A;  2XYT A;  5J5G A;  3RQU A;  2WN9 A;  4LML A;  4BFQ A;  2XQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...