4LMKA

Glic liganded-closed-channel conformation, mutant y27'a
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPAMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gating of the proton-gated ion channel from Gloeobacter violaceus at pH 4 as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 90
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4lmkA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4lmkA01
5AFHA 1OEDE 3U8MA 1OEDC 3TLUA 4UXUA 2BYRA 2W8GA 2LKGA 4TNVA 2BYPA 2Y56A 4QH4A 5HCMA 2ZJVA 3PMZA 4ZJSA 5AFMB 2BG9C 4UM3A 4HFCA 3RQUA 2XZ6A 4PIRA 3WTJA 2X00D 3C84A 4HFBA 2XQ7A 3TLSA 5AFMA 3EHZA 1I9BA 2BR8A 4F8HA 2BYNA 5L47A 4LMLA 4LMJA 5J5IA 5J5HA 4EZ1A 4Z91A 2Y7YA 2PGZA 4WV9A 5BRXA 3WTMA 2ZJUA 5HEUA 4A97A 5KZUA 3TLWA 4IREA 5IUXA 3RHWA 4HQPA 4TWFA 3ZKRA 4QABA 3SIOA 2Y54A 4Z90A 4ILCA 3UU6A 3IGQA 5L4EA 5L4HA 3RIFA 5AFKA 2LKHA 4HFHA 5LXBA 4QH5A 3RQWA 4ILBA 2PH9A 2XQ6A 4AFTA 2M6IA 2XYSA 2XQ8A 2XQ9A 4TNWA 4UY2A 5FJVA 3UU4A 3WTOA 2Y58A 2WNJA 4NZBA 4D01A 5BW2A 3RI5A 3PEOA 2BG9B 2XZ5A 2BR7A 4IL4A 5HCJA 4QACA 4COFA 4BQTA 4BFQA 4ZJTA 1OEDB 2XQ5A 4TWDA 2X00A 3TLTA 3P50A 3WTNA 2UZ6A 5SYOA 4ZRUA 2BYQA 5LG3A 4AFGA 2YMEA 3LSVA 4LMKA 3WIPA 4NPPA 3UU8A 3WTKA 5HEGA 2YMDA 2BG9E 4ZK4A 4QAAA 1UW6A 4ZR6A 4ZZCA 5HEOA 5BP0A 3EI0A 2WZYA 2XNVA 5J0ZA 2WNLA 4A98A 4XHEA 2M6BA 3U8JA 2BG9A 3UU3A 1UV6A 4UM3P 3UUBA 3WTLA 2KSRA 5AFLA 3UQ4A 5CO5A 5AFJA 3JAEA 5TVCA 3C79A 4B5DA 2YOEA 1OEDA 4X5TA 3UU5A 2WN9A 4HFEA 2BYSA 2XYTA 5JMEA 4ILAA 2C9TA 3TLVA 2LM2A 4ALXA 2XQ3A 4UM1A 4TWHA 3JADA 5CFBA 3GUAA 4XK9A 4DBMA 2W8FA 2Y57A 5J5GA 4AFHA 4HFDA 2MAWA 2BJ0A 4ZZBA 3T4MA 4ZK1A 2YN6A 3SQ9A 2LLYA 2XQ4A 3RIAA 3U8NA 1UX2A 4QH1A 5J5FA 3WTHA 4FRRA 4HFIA 3ZDHA 2QC1B 2XNTA 2WNCA 2XQAA 5AINA 4IL9A 3EAMA 5AFNA 3SH1A 5HEJA 5KE4A 3P4WA 4UM3S 3U8LA 2YKSA 2XNUA 3ZDGA 2VL0A 3U8KA 3JAFA 3SQ6A 5HEHA 3UQ7A 3WTIA
chains in the Genus database with same CATH superfamily
3ZT7A 3GA8A 1YXRA 4O2BE 2W8GA 4AISA 4QH4A 4PIRA 4KHZF 3AEAA 1OXZA 2IMLA 2D5UA 3EABA 1HTJF 2AXDS 3SFDA 2V7IA 4IE5A 4XZCA 3GN5B 5HYAA 2XY8B 5FY0A 4JI7T 3NWIA 3IGQA 5HXRA 2XAHB 3PUYF 5L4HA 5KDMC 4YTNA 2CBIA 3T1HT 3VR8A 2XJ7A 4DV6T 3PTRB 2M6IA 1I6ZA 1WYBA 2VK9A 2WQYA 2LE8A 2HH7A 3RPUA 3CX6B 3AE3A 4IE4A 1WCRA 5ADXL 4ZHQE 4BFQA 1SE7A 3U78A 5KX5E 2X00A 5LG3A 2V7LA 3LDQB 3GMIA 4DR7T 5L3BB 3KINB 2VVSA 3RLFF 1VCSA 5LYJE 4HWCA 4DR5T 3FHNA 4JYAT 3JAEA 2CWOA 4B3MT 4JI8T 4IHJE 2LJLA 5AQLB 2C9TA 4JI5T 4DBMA 2HN1A 2YN6A 5FL0A 3Q5XA 2JQKA 3ZJ2A 5J5FA 5HWYA 1X9BA 3U8LA 2SPCA 2W63A 2NW7A 2XM2A 4MLKA 4ZI2D 1IBMT 5FXVA 1M7KA 1CUNA 2V7MA 4GKKT 2XAGB 1CHUA 4GK0E 2VASA 1LRZA 4PJJA 5AQOB 3CQCB 5C2TA 5AQMB 4EZ1A 4O4LE 2GK9A 5JR9B 4QABA 3CVRA 4CN4A 3ZSTA 5LMUT 1SUMB 3RF1A 2XQ6A 3O1JA 3C98B 2CBJA 4QXCB 1O3XA 2IW5B 1XMQT 3OPCA 4QACA 3ZYMA 1WRDA 2XQ5A 3MXZA 3WTNA 3I0QA 4X64T 5J2TE 1BR4A 5AQRB 2CRBA 3KVAA 3FZMB 4PNIA 3MACA 5AQJB 1BR0A 3U8JA 2BG9A 2K5BB 1VOMA 2N9DA 4HWIB 4NIQA 1MIVA 3C79A 4GIWA 2MOZA 4H9PC 2BYSA 4H9SE 3P4SA 5CA1E 2XYTA 2V5CA 3O9XA 5LBQB 3GUAA 5J5GA 1N34T 3C51A 3G06A 5JH7E 5ETWA 3FBZA 3WTHA 3GWHA 2RP4A 3B5MA 3L09A 5AINA 2KT9A 4JI3T 2XNUA 1ZP0A 2PJQA 3RYHE 4DUZT 5A1LA 5AQFB 3EUHA 1HR0T 3QOFA 2ZM2A 2QYWA 3N2OA 4HN9A 2BYNA 2J4GA 1FMVA 3ZKRA 3ZSSA 3Q9DA 4HGAA 3O1IA 5LXBA 2V6YB 3CQXC 4U2YA 3DP7A 3LBXA 4L5GA 1UK5A 1MNEA 1W09A 1HG2A 2D0TA 2RPAA 2WY2A 1AJ3A 3C4WA 4EOZB 4F6RC 4HEAA 3KBUA 5GONE 2FJDA 4YSZA 4NXNT 2IDOB 3LFMA 3MA9A 5IYZE 5HXCA 2VKHA 4NPPA 3UU8A 2BG9E 4ZZCA 5M4YA 1QSDA 3C64A 5FNVE 2W61A 5ABFB 3UT5E 5JDQA 3UTKA 4PAGA 3ZMZB 4HFDA 4BJNA 4ZK1A 3SRZA 2XSAA 3ZDHA 4UV9B 2ES0A 3VHLA 2WS3A 3FB2A 2VB6A 4JI1T 1UUSA 3K8PC 3ESLA 1HFAA 5LHHB 1BR1A 5HCMA 4WZXA 4WBNE 2UXBT 5IHYA 5L3DB 3ZN0B 4L0RA 1R8IA 3RIUA 1W0BA 4YSXA 5BMVE 4CI1B 3ZYKA 2WDVA 4WV9A 3T8OA 1QLBA 3AECA 3RHWA 4HQPA 2KNDA 1Y64B 4Z90A 2Y48B 2CM0A 5J1GA 4UR9A 5FKYA 3ANWB 2DI4A 5DQVA 3FBLA 2LSJA 5BW2A 2BBHA 4L9IA 5AQSB 2B76A 3DTOA 5H6QB 2W2UA 2VKJA 1VRBA 4ZRUA 4DR6T 2WWVA 4ZOLE 5HEGA 3PDYA 2WMOA 4WYVA 5JVDE 4BA9A 5JDMA 4IDNA 3IHRA 4HKAA 2ZM0A 5JREA 1SA0E 5LNKA 4JEHB 4U72A 4PW8A 4X62T 3H3AA 4CN6A 4UM1A 3KVBA 4LF9T 2JQHA 4ILUA 4ZZBA 2BS3A 5F8PA 2QC1B 4DR2T 2EHOC 2R6GF 5FVLA 2KZ7B 3EAMA 2WZIA 2QGSA 5FYMA 5FXWA 2V8SV 3SQ6A 3WTIA 2YU2A 4IT4A 2D9DA 3P4QA 1XNRT 2V7KA 1M62A 4GKJT 3TLUA 2CXLA 5C8YE 4H9OC 4U31A 4EZ4A 3Q5EA 5AFMA 3TLSA 3VU7H 4F8HA 3FZHB 4YJ2E 4KBMB 4B3TT 1YD8G 1D0YA 2QVAA 4ZEYA 5L4EA 2IAKA 2LKHA 3RYCE 1G73A 4NXMT 3MZKB 3N2KE 2Y58A 3KV5A 3AA6B 1MMDA 2XZ5A 2LM9A 2BR7A 3NZPA 2K9AA 2ZMAA 3ZPOA 5AQIB 2A3DA 4GK5E 2BYQA 3RRWA 3N9LA 4CI3B 5LHIB 3UUMA 3WTKA 2DHRA 4YFSA 2X66A 4PFPA 2JIWA 2X0YA 3DJBA 4TV8E 5CO5A 5AQNB 2B1EA 2H7VC 4AKGA 4LFBT 2LM2A 1NENA 5EZYE 4AFHA 3FZFB 1U5PA 2LLYA 3B13A 2E9XD 5AQTB 4X66T 2XNTA 5DJQC 2I59A 4YHJA 4P0AA 2IC6A 2M67A 2KINB 4E7ZA 2BKNA 1BR2A 2KLQA 3Q2MA 2UU9T 1YKEB 1UX4A 4UM3A 2XZEA 1KNRA 3WTJA 4ISSA 3Q5WA 3ONXA 3AEGA 4H63H 2V5DA 2HPJA 3AAIA 5KZUA 4A97A 4N78D 3MJXA 3HR0A 3ZMSB 5CA0E 5EK3A 2X67A 3RQWA 2NTYA 4IDQA 5CGMA 4OYKA 4QWNB 4G63A 4UELA 3PUXF 4EEBA 2BG9B 4DV0T 5LMNT 1OEDB 2LOPA 1YQ3A 2OA5A 2K3WA 2UZ6A 2X9HA 3ETVA 2WP9A 3AA7B 4WBOA 4AQFA 2E9XB 4DV2T 2XHEB 2Y8DA 3EI0A 3NRYA 3SS1A 1MIYA 3TKLB 4A98A 3ZC0A 2KSRA 4EXTA 3M65A 5AFLA 3UQ4A 2VVNA 2EHOD 2VKDA 5JR9C 4DVDA 2X9WA 5AQGB 2WWUA 4BJMA 1QUUA 1J5WA 2CXFA 3ZYLA 4O2AE 4IDZA 3RKOA 3KV4A 3N9PA 1Z0PA 4DR3T 4ERRA 3U8MA 4OHFA 1GQEA 4TV9E 3M3ZB 2WU2A 4H9NC 1NEKA 3ONJA 2NWBA 3HI2A 1J5ET 2L3LA 2MYSA 5L3EB 3FZKB 3L39A 3UU6A 4UVCB 3BQLA 2E9XA 3RIFA 4HFHA 3J9X1 2W0GA 2LSYA 2JPFA 4K0UA 5J2UE 4D01A 2YEVC 4KMCA 4TX5A 3LK42 4IE0A 4FI5A 4COFA 3O4XE 4ZJTA 5E0OA 2VURA 4TWDA 3KV9A 2XPKA 3N9MA 5SYOA 4P0BA 1D1BA 3AXJB 3FXEB 3WAJA 3CK6A 5LG4A 3V5SA 2J62A 3UU3A 1UGOA 2V26A 4I55E 5AFJA 3ABVA 3L3PA 4IE6A 5HAXA 3SOLA 1FIOA 4HFEA 3HL6A 4TWHA 4Z8XA 2MAWA 1EZ3A 4U74A 1G8XA 4HFIA 5FY7A 1T8BA 2BKPA 2YKSA 5CJ5A 1VCTA 1XDPA 4OYJA 1XMOT 3KDSE 5TAOA 5EK4A 3AE8A 2V1DB 3OBVE 5AFMB 2WCAA 5AQQB 1E7PA 5LXTE 4HFBA 4DV5T 3I0OA 5L47A 4DV3T 2NW9A 3PU3A 3SIOA 2XAFB 4EB6E 3ZEFB 3WI3A 5L3FB 3QUJA 2WU5A 3E0ZA 4QH5A 3BQIA 4DV1T 3SWHA 3WTOA 4CQIA 2Q9QC 4AXPA 2DLRA 3PEOA 2RA1A 2K24A 3UFGA 3CMLA 5DQWA 3X1DA 2LT3A 1WR6A 4JI2T 5LA6E 4KUMB 3H37A 4U2ZA 4QAAA 2XTLA 2WZYA 4E7SA 2VQFT 5FY1A 2LSGA 1H7CA 4MHCA 2X0LB 4CZZB 3ZMUB 4A5XA 1IZNB 4KP3C 2JJ9A 3JADA 4YXDA 3O1HA 2UUCT 4AKLA 2L9QA 3OYZA 1T72A 4AI6A 4FRRA 4KI0F 4YLHA 3PUAA 1ZEEA 3AE5A 1HX1B 5JDNA 4B3ST 3PU8A 3JAFA 3AE6A 5HEHA 1D0ZA 3N5LA 2ZM6T 5LBMA 4X20E 2ZJVA 3OYXA 5LGTB 4YTMA 2X9YA 2J47A 4PK4A 2WB5A 4TWFA 3BK9A 3ETUA 3NRXA 3UULA 3R84B 4GYSA 3Q5DA 3H3MA 2IUBA 3RX6A 4TNWA 1XWMA 4XAXB 5L2LA 4QXBB 2E5LT 3F31A 4DO0A 5C3JA 1KF6A 3T1YT 4BQTA 3I9WA 1SHZC 2ZM8A 3P50A 4ZI3D 4B6XA 3OJAA 2CE7A 4JEUB 4ZK4A 2F4VT 5BP0A 2UUAT 4EYYR 4KX6A 3UUBA 3KFWX 1T7SA 3B57A 3BQKA 2DWKA 2LRLA 2FJBA 5LP6E 2VL8A 1FMWA 2NOXA 2HHHT 4FJOA 2WNCA 4IL9A 2XM1A 3QC9A 2PFVA 4U33A 5KE4A 3I1AA 1IAPA 2V6YA 1X79A 4AKHA 1S35A 2G0UA 4AIUA 5AFUL 5LCYA 3P4PA 3IEEA 5AQPB 2BS4A 2IC9A 2PTFA 2WDQA 4AKRB 3PUZF 2BKOA 2BZBA 2ZJUA 1WLXA 1I94T 2LRKA 4NUVA 3C50A 2MTQA 3AEEA 1B7TA 3NZQA 3AA0B 4DBQA 5LHGB 3ZJ1A 4HFVA 4P09A 4WNKA 1D1CA 2PH9A 2JMHA 5AQVB 4IGUA 4DIDB 2WM9A 4H63V 5EK2A 3D0TA 2UXCT 4JI4T 3ZT5A 4LF6T 2H89A 2IHR1 4ZI3C 3LG7A 2FUPA 4B3RT 5AQHB 2W4XA 3LJCA 4JUYA 5KXJA 3NKZA 4LF4T 1LVFA 2WMNA 1WR0A 2E9XC 2YMDA 3WAKA 2OV9A 3HKDE 4ADZA 4EYUA 4HWHA 3EVYA 1ZV4X 2M6BA 3CQGB 1UV6A 5LGNB 4DMWA 4UF0B 3UUXB 4WW0A 1D0XA 3VRAA 3ZMTB 5HXEA 3QB5K 4ILAA 4UF0A 2W67A 2JQ9A 3RIAA 4ASKA 2C5KT 5BR8T 3U8NA 1UX2A 2N1GA 3AE1A 4IIJE 3IF8B 3W15B 2CHOA 2YU1A 3NVOA 3I9YA 3GN5A 3ANWA 2XQYA 1NWMX 3P7IA 4GYRA 1HF8A 1OEDC 4AQFC 4YY3T 1MMGA 4DMVA 3PUVF 2BG9C 3KBTA 2XQ7A 4TZ4C 2BR8A 2P9BA 2X9XA 1T98A 5J5IA 4DV7T 2Y7YA 2CWYA 2W62A 2KWHA 4TN7B 4V1Av 2V7JA 2J1DG 2X51A 4CI2B 5DABA 2IIUA 3P8CD 2X0HA 2YK0A 2WNJA 4NZBA 3VR9A 2CHNA 2FBWA 3C4XA 5CB4E 1FJGT 2A2FX 3LBXB 3AB3B 3ZCIA 3L8RA 3PUWF 1HNXT 2UUBT 4YTPA 3LSVA 5JR9A 1OWAA 1KNZA 1KNPA 4PJLA 2H88A 5ABFA 2BVLA 3PUQA 5LJNA 4EV6A 3WTLA 2OLTA 2Q9QA 3S4UA 4ZXLA 2KMFA 4JV5T 4ALXA 2XQ3A 3K1SA 4DV4T 2D0UA 3N9OA 4DNDA 3SQ9A 3HKCE 4EEDA 1JNRA 2CCQA 3EDVA 3NBXX 1LVKA 3P4WA 4I43B 4Q25A 4UM3S 4LF8T 4QXHB 3AVSA 3U8KA 5AFHA 4G2AA 2Y56A 4H9RC 1IJ5A 2ZLYA 2JMKA 5LOVE 4MALA 2LOSA 3AA1B 3AAAB 3AEDA 3UUNA 5BRXA 2NP9A 4C91A 2A9UA 2PG8A 3AE9A 3C4ZA 4DR4T 4UIGA 2WDRA 1WFDA 4X1YE 3CWZB 1W0AA 3QB5A 4QX8B 2Q9QB 1ZKEA 2ACZA 3PJAA 2LHRA 4U3CA 2NW8A 2XQ9A 2C5IT 2LEHA 4MFRA 4U7IA 4YJ3E 3E22E 1NAFA 2A72A 2MBGA 3TLTA 4AFGA 3WIPA 2DWGA 3KV6A 4ZS2A 4X1IE 5FMNA 2ODUA 2UXDT 5J0ZA 2YDRA 3R6NA 4OFZA 1YKHB 2XAJB 3A7MA 4LFCT 4AKIA 1OEDA 2EHOA 2LSIA 4O4JE 2XUEA 1MMNA 3CPZA 3LK2B 3AE7A 2E5VA 3RRCA 4LF7T 3FXDB 2XQ4A 3P4RA 3ZLIA 2YDSA 2Y6XA 1UURA 2XQAA 1XZYA 2YINA 3RIUC 3MK7C 3HA4A 2VKOA 1HG5A 4UXNB 2X68A 1XDOA 4DR1T 3E08A 3RC8A 2LKGA 2Q9QD 3PMZA 4PK5A 4CXWA 5JDLA 3C84A 1N36T 3EHZA 1W9RA 1I9BA 2CA5A 4ISTA 3TLWA 3OVUA 2PBIA 2I0MA 2QA7A 4ILCA 3RH3A 1YQ4A 4ZS3A 1HX8A 5AFKA 1IBKT 5FXXA 4HWFA 4A56A 4AFTA 4HE8A 4EIWA 3RI5A 5HXSA 4GOUA 2AE9A 4J2CA 5IWAT 4CN1A 3PUGA 4I0UA 4LMKA 4QHOA 4YSYA 5ABHA 3N2GE 3JC6C 2XNVA 1LKXA 4HWDA 2VWAA 3N9NA 5JRCA 4OK0A 3HKEE 3VKGA 1XNQT 2DNXA 5TVCA 4UV8B 4PFOA 2VQET 2YOEA 1KFYA 3AEBA 2ODVA 4OX9T 2FJEA 5JMEA 5CFBA 3VKHA 4IDPA 3CIRA 4PJMA 3T4MA 2KXPB 1KEYA 3EDUA 5JDFA 5JDHA 3JC6D 4JI0T 5AFNA 2WAUA 5AQUB 1S94A 4YHHT 4DBRA 1US7B 3ZC1A 2BYPA 3RYFE 2EHOB 1N33T 4QX7B 1E1HB 4LMJA 5J5HA 4Z91A 5ABEA 3WTMA 3PV0F 3RYIE 3AAEB 3AXJA 3CX8B 4ILBA 2XYSA 5FXZA 5FVKA 2XQ8A 4DUYT 4UY2A 5FJVA 3UU4A 4JI6T 3FZLB 2W66A 5F5WA 4IL4A 5HXHA 5HCJA 3QK6A 4YT0A 1WYCA 5LB7B 2HN2A 3PUSA 3PJAJ 3RGLA 2LSKA 4JLEA 3OKQA 4ZR6A 5JTGA 2UXXB 2BS2A 4JBWF 1JNZA 1V9DA 5JDGA 4CXYA 2WNLA 4XHEA 1MMAA 2E8IA 4UM3P 4AQYT 4UVAB 4X65T 3UU5A 2WN9A 1HNZT 4U7YA 2WBLA 3UFEA 2HPLA 4XK9A 2C0SA 2W8FA 2XSBA 2WSSV 4C90A 5FL1A 1L0VA 2DL1A 2JRKA 4ANJA 5LJMA 5F3JA 3CKDA 2D2SA 3ZDGA 2MPKA 3ONLC 3AVRA 2NTXA 1OEDE 2WZHA 3PE0A 4UXUA 1D1AA 3ZMVB 4TNVA 2DCFA 5ABGA 2UXNB 1HS7A 4HFCA 3RQUA 3ZCJA 4I4TE 3IBPA 2CPTA 3ZT6A 1UX5A 2BDEA 3PURA 4LMLA 5JQGE 2C5JA 2E2AA 1IJ6A 2Z6EA 4IREA 3N9QA 4EGWA 5IUXA 5L3GB 4I50E 2CMRA 3AEFA 2CXDA 2NR4A 1IBLT 1MNDA 1Y01A 3J7Yq 2W00A 3AE4A 1UCUA 3A5XA 2CLYB 4KHPT 3IA3A 2KWIB 2K48A 3A8YC 5JRCB 2CEAA 4P1NA 3V5UA 4LFAT 2L8KA 3F2EA 1UW6A 1ZHCA 4O8SA 2N2NA 5HEOA 1FEWA 2H7OA 4LF5T 4O4HE 3K3OA 1J1JA 1KK7A 4B5DA 3K3QC 5HWXA 4CXXA 4UEMA 3TLVA 2BJ0A 1ZOYA 1HNWT 4AQGA 1Z8UA 3LK3B 1E2AA 5HEJA 2JQQA 3RC3A 1MIWA 4ZI7E 4HTEA 4IDOA 3UQ7A 5L3CB 2BYRA 4ZJSA 1HCIA 2XZ6A 2X00D 3AE2A 2I6HA 3U3IA 2PGZA 4XBFB 5HEUA 2BBJA 3JCFA 2LHNA 4TUYE 2Y54A 5H6RB 4X1KE 4K0KT 3HKBE 4H9QC 1DU2A 2FJAA 2BVMA 1YW0A 5AQKB 2XAQB 3RKGA 4IE7A 4BAYB 4QKNA 2YMEA 3ZN1B 3CX7B 2H3RA 4M1PA 2YDQA 4EZHA 4EAHA 3K3NA 4UVBB 5LGUB 1U4QA 2V6XA 4PJNA 4X5TA 4MBQA 4PK6A 5FP3A 1N32T 4NUUA 2Y57A 5KMGP 4ZI2C 3F57A 4QH1A 3MKDA 2CLYC 3SFEA 4O4IE 2ACXA 3OTOT 3SH1A 2XASB 3VRBA 3QNUA 2VL0A 2QRXA
chains in the Genus database with same CATH topology
5AFHA 1OEDE 3U8MA 1OEDC 3TLUA 4UXUA 2BYRA 2W8GA 2LKGA 4TNVA 2BYPA 2Y56A 4QH4A 5HCMA 2ZJVA 3PMZA 4ZJSA 5AFMB 2BG9C 4UM3A 4HFCA 3RQUA 2XZ6A 4PIRA 3WTJA 2X00D 3C84A 4HFBA 2XQ7A 3TLSA 5AFMA 3EHZA 1I9BA 2BR8A 4F8HA 2BYNA 5L47A 4LMLA 4LMJA 5J5IA 5J5HA 4EZ1A 4Z91A 2Y7YA 2PGZA 4WV9A 5BRXA 3WTMA 2ZJUA 5HEUA 4A97A 5KZUA 3TLWA 4IREA 5IUXA 3RHWA 4HQPA 4TWFA 3ZKRA 4QABA 3SIOA 2Y54A 4Z90A 4ILCA 3UU6A 3IGQA 5L4EA 5L4HA 3RIFA 5AFKA 2LKHA 4HFHA 5LXBA 4QH5A 3RQWA 4ILBA 2PH9A 2XQ6A 4AFTA 2M6IA 2XYSA 2XQ8A 2XQ9A 4TNWA 4UY2A 5FJVA 3UU4A 3WTOA 2Y58A 2WNJA 4NZBA 4D01A 5BW2A 3RI5A 3PEOA 2BG9B 2XZ5A 2BR7A 4IL4A 5HCJA 4QACA 4COFA 4BQTA 4BFQA 4ZJTA 1OEDB 2XQ5A 4TWDA 2X00A 3TLTA 3P50A 3WTNA 2UZ6A 5SYOA 4ZRUA 2BYQA 5LG3A 4AFGA 2YMEA 3LSVA 4LMKA 3WIPA 4NPPA 3UU8A 3WTKA 5HEGA 2YMDA 2BG9E 4ZK4A 4QAAA 1UW6A 4ZR6A 4ZZCA 5HEOA 5BP0A 3EI0A 2WZYA 2XNVA 5J0ZA 2WNLA 4A98A 4XHEA 2M6BA 3U8JA 2BG9A 3UU3A 1UV6A 4UM3P 3UUBA 3WTLA 2KSRA 5AFLA 3UQ4A 5CO5A 5AFJA 3JAEA 5TVCA 3C79A 4B5DA 2YOEA 1OEDA 4X5TA 3UU5A 2WN9A 4HFEA 2BYSA 2XYTA 5JMEA 4ILAA 2C9TA 3TLVA 2LM2A 4ALXA 2XQ3A 4UM1A 4TWHA 3JADA 5CFBA 3GUAA 4XK9A 4DBMA 2W8FA 2Y57A 5J5GA 4AFHA 4HFDA 2MAWA 2BJ0A 4ZZBA 3T4MA 4ZK1A 2YN6A 3SQ9A 2LLYA 2XQ4A 3RIAA 3U8NA 1UX2A 4QH1A 5J5FA 3WTHA 4FRRA 4HFIA 3ZDHA 2QC1B 2XNTA 2WNCA 2XQAA 5AINA 4IL9A 3EAMA 5AFNA 3SH1A 5HEJA 5KE4A 3P4WA 4UM3S 3U8LA 2YKSA 2XNUA 3ZDGA 2VL0A 3U8KA 3JAFA 3SQ6A 5HEHA 3UQ7A 3WTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFH A;  1OED E;  3U8M A;  1OED C;  3TLU A;  4UXU A;  2BYR A;  2W8G A;  2LKG A;  4TNV A;  2BYP A;  2Y56 A;  4QH4 A;  5HCM A;  2ZJV A;  3PMZ A;  4ZJS A;  5AFM B;  2BG9 C;  4UM3 A;  4HFC A;  3RQU A;  2XZ6 A;  4PIR A;  3WTJ A;  2X00 D;  3C84 A;  4HFB A;  2XQ7 A;  3TLS A;  5AFM A;  3EHZ A;  1I9B A;  2BR8 A;  4F8H A;  2BYN A;  5L47 A;  4LML A;  4LMJ A;  5J5I A;  5J5H A;  4EZ1 A;  4Z91 A;  2Y7Y A;  2PGZ A;  4WV9 A;  5BRX A;  3WTM A;  2ZJU A;  5HEU A;  4A97 A;  5KZU A;  3TLW A;  4IRE A;  5IUX A;  3RHW A;  4HQP A;  4TWF A;  3ZKR A;  4QAB A;  3SIO A;  2Y54 A;  4Z90 A;  4ILC A;  3UU6 A;  3IGQ A;  5L4E A;  5L4H A;  3RIF A;  5AFK A;  2LKH A;  4HFH A;  5LXB A;  4QH5 A;  3RQW A;  4ILB A;  2PH9 A;  2XQ6 A;  4AFT A;  2M6I A;  2XYS A;  2XQ8 A;  2XQ9 A;  4TNW A;  4UY2 A;  5FJV A;  3UU4 A;  3WTO A;  2Y58 A;  2WNJ A;  4NZB A;  4D01 A;  5BW2 A;  3RI5 A;  3PEO A;  2BG9 B;  2XZ5 A;  2BR7 A;  4IL4 A;  5HCJ A;  4QAC A;  4COF A;  4BQT A;  4BFQ A;  4ZJT A;  1OED B;  2XQ5 A;  4TWD A;  2X00 A;  3TLT A;  3P50 A;  3WTN A;  2UZ6 A;  5SYO A;  4ZRU A;  2BYQ A;  5LG3 A;  4AFG A;  2YME A;  3LSV A;  4LMK A;  3WIP A;  4NPP A;  3UU8 A;  3WTK A;  5HEG A;  2YMD A;  2BG9 E;  4ZK4 A;  4QAA A;  1UW6 A;  4ZR6 A;  4ZZC A;  5HEO A;  5BP0 A;  3EI0 A;  2WZY A;  2XNV A;  5J0Z A;  2WNL A;  4A98 A;  4XHE A;  2M6B A;  3U8J A;  2BG9 A;  3UU3 A;  1UV6 A;  4UM3 P;  3UUB A;  3WTL A;  2KSR A;  5AFL A;  3UQ4 A;  5CO5 A;  5AFJ A;  3JAE A;  5TVC A;  3C79 A;  4B5D A;  2YOE A;  1OED A;  4X5T A;  3UU5 A;  2WN9 A;  4HFE A;  2BYS A;  2XYT A;  5JME A;  4ILA A;  2C9T A;  3TLV A;  2LM2 A;  4ALX A;  2XQ3 A;  4UM1 A;  4TWH A;  3JAD A;  5CFB A;  3GUA A;  4XK9 A;  4DBM A;  2W8F A;  2Y57 A;  5J5G A;  4AFH A;  4HFD A;  2MAW A;  2BJ0 A;  4ZZB A;  3T4M A;  4ZK1 A;  2YN6 A;  3SQ9 A;  2LLY A;  2XQ4 A;  3RIA A;  3U8N A;  1UX2 A;  4QH1 A;  5J5F A;  3WTH A;  4FRR A;  4HFI A;  3ZDH A;  2QC1 B;  2XNT A;  2WNC A;  2XQA A;  5AIN A;  4IL9 A;  3EAM A;  5AFN A;  3SH1 A;  5HEJ A;  5KE4 A;  3P4W A;  4UM3 S;  3U8L A;  2YKS A;  2XNU A;  3ZDG A;  2VL0 A;  3U8K A;  3JAF A;  3SQ6 A;  5HEH A;  3UQ7 A;  3WTI A; 
#chains in the Genus database with same CATH topology
 3ZT7 A;  3GA8 A;  1YXR A;  4O2B E;  2W8G A;  4AIS A;  4QH4 A;  4PIR A;  4KHZ F;  3AEA A;  1OXZ A;  2IML A;  2D5U A;  3EAB A;  1HTJ F;  2AXD S;  3SFD A;  2V7I A;  4IE5 A;  4XZC A;  3GN5 B;  5HYA A;  2XY8 B;  5FY0 A;  4JI7 T;  3NWI A;  3IGQ A;  5HXR A;  2XAH B;  3PUY F;  5L4H A;  5KDM C;  4YTN A;  2CBI A;  3T1H T;  3VR8 A;  2XJ7 A;  4DV6 T;  3PTR B;  2M6I A;  1I6Z A;  1WYB A;  2VK9 A;  2WQY A;  2LE8 A;  2HH7 A;  3RPU A;  3CX6 B;  3AE3 A;  4IE4 A;  1WCR A;  5ADX L;  4ZHQ E;  4BFQ A;  1SE7 A;  3U78 A;  5KX5 E;  2X00 A;  5LG3 A;  2V7L A;  3LDQ B;  3GMI A;  4DR7 T;  5L3B B;  3KIN B;  2VVS A;  3RLF F;  1VCS A;  5LYJ E;  4HWC A;  4DR5 T;  3FHN A;  4JYA T;  3JAE A;  2CWO A;  4B3M T;  4JI8 T;  4IHJ E;  2LJL A;  5AQL B;  2C9T A;  4JI5 T;  4DBM A;  2HN1 A;  2YN6 A;  5FL0 A;  3Q5X A;  2JQK A;  3ZJ2 A;  5J5F A;  5HWY A;  1X9B A;  3U8L A;  2SPC A;  2W63 A;  2NW7 A;  2XM2 A;  4MLK A;  4ZI2 D;  1IBM T;  5FXV A;  1M7K A;  1CUN A;  2V7M A;  4GKK T;  2XAG B;  1CHU A;  4GK0 E;  2VAS A;  1LRZ A;  4PJJ A;  5AQO B;  3CQC B;  5C2T A;  5AQM B;  4EZ1 A;  4O4L E;  2GK9 A;  5JR9 B;  4QAB A;  3CVR A;  4CN4 A;  3ZST A;  5LMU T;  1SUM B;  3RF1 A;  2XQ6 A;  3O1J A;  3C98 B;  2CBJ A;  4QXC B;  1O3X A;  2IW5 B;  1XMQ T;  3OPC A;  4QAC A;  3ZYM A;  1WRD A;  2XQ5 A;  3MXZ A;  3WTN A;  3I0Q A;  4X64 T;  5J2T E;  1BR4 A;  5AQR B;  2CRB A;  3KVA A;  3FZM B;  4PNI A;  3MAC A;  5AQJ B;  1BR0 A;  3U8J A;  2BG9 A;  2K5B B;  1VOM A;  2N9D A;  4HWI B;  4NIQ A;  1MIV A;  3C79 A;  4GIW A;  2MOZ A;  4H9P C;  2BYS A;  4H9S E;  3P4S A;  5CA1 E;  2XYT A;  2V5C A;  3O9X A;  5LBQ B;  3GUA A;  5J5G A;  1N34 T;  3C51 A;  3G06 A;  5JH7 E;  5ETW A;  3FBZ A;  3WTH A;  3GWH A;  2RP4 A;  3B5M A;  3L09 A;  5AIN A;  2KT9 A;  4JI3 T;  2XNU A;  1ZP0 A;  2PJQ A;  3RYH E;  4DUZ T;  5A1L A;  5AQF B;  3EUH A;  1HR0 T;  3QOF A;  2ZM2 A;  2QYW A;  3N2O A;  4HN9 A;  2BYN A;  2J4G A;  1FMV A;  3ZKR A;  3ZSS A;  3Q9D A;  4HGA A;  3O1I A;  5LXB A;  2V6Y B;  3CQX C;  4U2Y A;  3DP7 A;  3LBX A;  4L5G A;  1UK5 A;  1MNE A;  1W09 A;  1HG2 A;  2D0T A;  2RPA A;  2WY2 A;  1AJ3 A;  3C4W A;  4EOZ B;  4F6R C;  4HEA A;  3KBU A;  5GON E;  2FJD A;  4YSZ A;  4NXN T;  2IDO B;  3LFM A;  3MA9 A;  5IYZ E;  5HXC A;  2VKH A;  4NPP A;  3UU8 A;  2BG9 E;  4ZZC A;  5M4Y A;  1QSD A;  3C64 A;  5FNV E;  2W61 A;  5ABF B;  3UT5 E;  5JDQ A;  3UTK A;  4PAG A;  3ZMZ B;  4HFD A;  4BJN A;  4ZK1 A;  3SRZ A;  2XSA A;  3ZDH A;  4UV9 B;  2ES0 A;  3VHL A;  2WS3 A;  3FB2 A;  2VB6 A;  4JI1 T;  1UUS A;  3K8P C;  3ESL A;  1HFA A;  5LHH B;  1BR1 A;  5HCM A;  4WZX A;  4WBN E;  2UXB T;  5IHY A;  5L3D B;  3ZN0 B;  4L0R A;  1R8I A;  3RIU A;  1W0B A;  4YSX A;  5BMV E;  4CI1 B;  3ZYK A;  2WDV A;  4WV9 A;  3T8O A;  1QLB A;  3AEC A;  3RHW A;  4HQP A;  2KND A;  1Y64 B;  4Z90 A;  2Y48 B;  2CM0 A;  5J1G A;  4UR9 A;  5FKY A;  3ANW B;  2DI4 A;  5DQV A;  3FBL A;  2LSJ A;  5BW2 A;  2BBH A;  4L9I A;  5AQS B;  2B76 A;  3DTO A;  5H6Q B;  2W2U A;  2VKJ A;  1VRB A;  4ZRU A;  4DR6 T;  2WWV A;  4ZOL E;  5HEG A;  3PDY A;  2WMO A;  4WYV A;  5JVD E;  4BA9 A;  5JDM A;  4IDN A;  3IHR A;  4HKA A;  2ZM0 A;  5JRE A;  1SA0 E;  5LNK A;  4JEH B;  4U72 A;  4PW8 A;  4X62 T;  3H3A A;  4CN6 A;  4UM1 A;  3KVB A;  4LF9 T;  2JQH A;  4ILU A;  4ZZB A;  2BS3 A;  5F8P A;  2QC1 B;  4DR2 T;  2EHO C;  2R6G F;  5FVL A;  2KZ7 B;  3EAM A;  2WZI A;  2QGS A;  5FYM A;  5FXW A;  2V8S V;  3SQ6 A;  3WTI A;  2YU2 A;  4IT4 A;  2D9D A;  3P4Q A;  1XNR T;  2V7K A;  1M62 A;  4GKJ T;  3TLU A;  2CXL A;  5C8Y E;  4H9O C;  4U31 A;  4EZ4 A;  3Q5E A;  5AFM A;  3TLS A;  3VU7 H;  4F8H A;  3FZH B;  4YJ2 E;  4KBM B;  4B3T T;  1YD8 G;  1D0Y A;  2QVA A;  4ZEY A;  5L4E A;  2IAK A;  2LKH A;  3RYC E;  1G73 A;  4NXM T;  3MZK B;  3N2K E;  2Y58 A;  3KV5 A;  3AA6 B;  1MMD A;  2XZ5 A;  2LM9 A;  2BR7 A;  3NZP A;  2K9A A;  2ZMA A;  3ZPO A;  5AQI B;  2A3D A;  4GK5 E;  2BYQ A;  3RRW A;  3N9L A;  4CI3 B;  5LHI B;  3UUM A;  3WTK A;  2DHR A;  4YFS A;  2X66 A;  4PFP A;  2JIW A;  2X0Y A;  3DJB A;  4TV8 E;  5CO5 A;  5AQN B;  2B1E A;  2H7V C;  4AKG A;  4LFB T;  2LM2 A;  1NEN A;  5EZY E;  4AFH A;  3FZF B;  1U5P A;  2LLY A;  3B13 A;  2E9X D;  5AQT B;  4X66 T;  2XNT A;  5DJQ C;  2I59 A;  4YHJ A;  4P0A A;  2IC6 A;  2M67 A;  2KIN B;  4E7Z A;  2BKN A;  1BR2 A;  2KLQ A;  3Q2M A;  2UU9 T;  1YKE B;  1UX4 A;  4UM3 A;  2XZE A;  1KNR A;  3WTJ A;  4ISS A;  3Q5W A;  3ONX A;  3AEG A;  4H63 H;  2V5D A;  2HPJ A;  3AAI A;  5KZU A;  4A97 A;  4N78 D;  3MJX A;  3HR0 A;  3ZMS B;  5CA0 E;  5EK3 A;  2X67 A;  3RQW A;  2NTY A;  4IDQ A;  5CGM A;  4OYK A;  4QWN B;  4G63 A;  4UEL A;  3PUX F;  4EEB A;  2BG9 B;  4DV0 T;  5LMN T;  1OED B;  2LOP A;  1YQ3 A;  2OA5 A;  2K3W A;  2UZ6 A;  2X9H A;  3ETV A;  2WP9 A;  3AA7 B;  4WBO A;  4AQF A;  2E9X B;  4DV2 T;  2XHE B;  2Y8D A;  3EI0 A;  3NRY A;  3SS1 A;  1MIY A;  3TKL B;  4A98 A;  3ZC0 A;  2KSR A;  4EXT A;  3M65 A;  5AFL A;  3UQ4 A;  2VVN A;  2EHO D;  2VKD A;  5JR9 C;  4DVD A;  2X9W A;  5AQG B;  2WWU A;  4BJM A;  1QUU A;  1J5W A;  2CXF A;  3ZYL A;  4O2A E;  4IDZ A;  3RKO A;  3KV4 A;  3N9P A;  1Z0P A;  4DR3 T;  4ERR A;  3U8M A;  4OHF A;  1GQE A;  4TV9 E;  3M3Z B;  2WU2 A;  4H9N C;  1NEK A;  3ONJ A;  2NWB A;  3HI2 A;  1J5E T;  2L3L A;  2MYS A;  5L3E B;  3FZK B;  3L39 A;  3UU6 A;  4UVC B;  3BQL A;  2E9X A;  3RIF A;  4HFH A;  3J9X 1;  2W0G A;  2LSY A;  2JPF A;  4K0U A;  5J2U E;  4D01 A;  2YEV C;  4KMC A;  4TX5 A;  3LK4 2;  4IE0 A;  4FI5 A;  4COF A;  3O4X E;  4ZJT A;  5E0O A;  2VUR A;  4TWD A;  3KV9 A;  2XPK A;  3N9M A;  5SYO A;  4P0B A;  1D1B A;  3AXJ B;  3FXE B;  3WAJ A;  3CK6 A;  5LG4 A;  3V5S A;  2J62 A;  3UU3 A;  1UGO A;  2V26 A;  4I55 E;  5AFJ A;  3ABV A;  3L3P A;  4IE6 A;  5HAX A;  3SOL A;  1FIO A;  4HFE A;  3HL6 A;  4TWH A;  4Z8X A;  2MAW A;  1EZ3 A;  4U74 A;  1G8X A;  4HFI A;  5FY7 A;  1T8B A;  2BKP A;  2YKS A;  5CJ5 A;  1VCT A;  1XDP A;  4OYJ A;  1XMO T;  3KDS E;  5TAO A;  5EK4 A;  3AE8 A;  2V1D B;  3OBV E;  5AFM B;  2WCA A;  5AQQ B;  1E7P A;  5LXT E;  4HFB A;  4DV5 T;  3I0O A;  5L47 A;  4DV3 T;  2NW9 A;  3PU3 A;  3SIO A;  2XAF B;  4EB6 E;  3ZEF B;  3WI3 A;  5L3F B;  3QUJ A;  2WU5 A;  3E0Z A;  4QH5 A;  3BQI A;  4DV1 T;  3SWH A;  3WTO A;  4CQI A;  2Q9Q C;  4AXP A;  2DLR A;  3PEO A;  2RA1 A;  2K24 A;  3UFG A;  3CML A;  5DQW A;  3X1D A;  2LT3 A;  1WR6 A;  4JI2 T;  5LA6 E;  4KUM B;  3H37 A;  4U2Z A;  4QAA A;  2XTL A;  2WZY A;  4E7S A;  2VQF T;  5FY1 A;  2LSG A;  1H7C A;  4MHC A;  2X0L B;  4CZZ B;  3ZMU B;  4A5X A;  1IZN B;  4KP3 C;  2JJ9 A;  3JAD A;  4YXD A;  3O1H A;  2UUC T;  4AKL A;  2L9Q A;  3OYZ A;  1T72 A;  4AI6 A;  4FRR A;  4KI0 F;  4YLH A;  3PUA A;  1ZEE A;  3AE5 A;  1HX1 B;  5JDN A;  4B3S T;  3PU8 A;  3JAF A;  3AE6 A;  5HEH A;  1D0Z A;  3N5L A;  2ZM6 T;  5LBM A;  4X20 E;  2ZJV A;  3OYX A;  5LGT B;  4YTM A;  2X9Y A;  2J47 A;  4PK4 A;  2WB5 A;  4TWF A;  3BK9 A;  3ETU A;  3NRX A;  3UUL A;  3R84 B;  4GYS A;  3Q5D A;  3H3M A;  2IUB A;  3RX6 A;  4TNW A;  1XWM A;  4XAX B;  5L2L A;  4QXB B;  2E5L T;  3F31 A;  4DO0 A;  5C3J A;  1KF6 A;  3T1Y T;  4BQT A;  3I9W A;  1SHZ C;  2ZM8 A;  3P50 A;  4ZI3 D;  4B6X A;  3OJA A;  2CE7 A;  4JEU B;  4ZK4 A;  2F4V T;  5BP0 A;  2UUA T;  4EYY R;  4KX6 A;  3UUB A;  3KFW X;  1T7S A;  3B57 A;  3BQK A;  2DWK A;  2LRL A;  2FJB A;  5LP6 E;  2VL8 A;  1FMW A;  2NOX A;  2HHH T;  4FJO A;  2WNC A;  4IL9 A;  2XM1 A;  3QC9 A;  2PFV A;  4U33 A;  5KE4 A;  3I1A A;  1IAP A;  2V6Y A;  1X79 A;  4AKH A;  1S35 A;  2G0U A;  4AIU A;  5AFU L;  5LCY A;  3P4P A;  3IEE A;  5AQP B;  2BS4 A;  2IC9 A;  2PTF A;  2WDQ A;  4AKR B;  3PUZ F;  2BKO A;  2BZB A;  2ZJU A;  1WLX A;  1I94 T;  2LRK A;  4NUV A;  3C50 A;  2MTQ A;  3AEE A;  1B7T A;  3NZQ A;  3AA0 B;  4DBQ A;  5LHG B;  3ZJ1 A;  4HFV A;  4P09 A;  4WNK A;  1D1C A;  2PH9 A;  2JMH A;  5AQV B;  4IGU A;  4DID B;  2WM9 A;  4H63 V;  5EK2 A;  3D0T A;  2UXC T;  4JI4 T;  3ZT5 A;  4LF6 T;  2H89 A;  2IHR 1;  4ZI3 C;  3LG7 A;  2FUP A;  4B3R T;  5AQH B;  2W4X A;  3LJC A;  4JUY A;  5KXJ A;  3NKZ A;  4LF4 T;  1LVF A;  2WMN A;  1WR0 A;  2E9X C;  2YMD A;  3WAK A;  2OV9 A;  3HKD E;  4ADZ A;  4EYU A;  4HWH A;  3EVY A;  1ZV4 X;  2M6B A;  3CQG B;  1UV6 A;  5LGN B;  4DMW A;  4UF0 B;  3UUX B;  4WW0 A;  1D0X A;  3VRA A;  3ZMT B;  5HXE A;  3QB5 K;  4ILA A;  4UF0 A;  2W67 A;  2JQ9 A;  3RIA A;  4ASK A;  2C5K T;  5BR8 T;  3U8N A;  1UX2 A;  2N1G A;  3AE1 A;  4IIJ E;  3IF8 B;  3W15 B;  2CHO A;  2YU1 A;  3NVO A;  3I9Y A;  3GN5 A;  3ANW A;  2XQY A;  1NWM X;  3P7I A;  4GYR A;  1HF8 A;  1OED C;  4AQF C;  4YY3 T;  1MMG A;  4DMV A;  3PUV F;  2BG9 C;  3KBT A;  2XQ7 A;  4TZ4 C;  2BR8 A;  2P9B A;  2X9X A;  1T98 A;  5J5I A;  4DV7 T;  2Y7Y A;  2CWY A;  2W62 A;  2KWH A;  4TN7 B;  4V1A v;  2V7J A;  2J1D G;  2X51 A;  4CI2 B;  5DAB A;  2IIU A;  3P8C D;  2X0H A;  2YK0 A;  2WNJ A;  4NZB A;  3VR9 A;  2CHN A;  2FBW A;  3C4X A;  5CB4 E;  1FJG T;  2A2F X;  3LBX B;  3AB3 B;  3ZCI A;  3L8R A;  3PUW F;  1HNX T;  2UUB T;  4YTP A;  3LSV A;  5JR9 A;  1OWA A;  1KNZ A;  1KNP A;  4PJL A;  2H88 A;  5ABF A;  2BVL A;  3PUQ A;  5LJN A;  4EV6 A;  3WTL A;  2OLT A;  2Q9Q A;  3S4U A;  4ZXL A;  2KMF A;  4JV5 T;  4ALX A;  2XQ3 A;  3K1S A;  4DV4 T;  2D0U A;  3N9O A;  4DND A;  3SQ9 A;  3HKC E;  4EED A;  1JNR A;  2CCQ A;  3EDV A;  3NBX X;  1LVK A;  3P4W A;  4I43 B;  4Q25 A;  4UM3 S;  4LF8 T;  4QXH B;  3AVS A;  3U8K A;  5AFH A;  4G2A A;  2Y56 A;  4H9R C;  1IJ5 A;  2ZLY A;  2JMK A;  5LOV E;  4MAL A;  2LOS A;  3AA1 B;  3AAA B;  3AED A;  3UUN A;  5BRX A;  2NP9 A;  4C91 A;  2A9U A;  2PG8 A;  3AE9 A;  3C4Z A;  4DR4 T;  4UIG A;  2WDR A;  1WFD A;  4X1Y E;  3CWZ B;  1W0A A;  3QB5 A;  4QX8 B;  2Q9Q B;  1ZKE A;  2ACZ A;  3PJA A;  2LHR A;  4U3C A;  2NW8 A;  2XQ9 A;  2C5I T;  2LEH A;  4MFR A;  4U7I A;  4YJ3 E;  3E22 E;  1NAF A;  2A72 A;  2MBG A;  3TLT A;  4AFG A;  3WIP A;  2DWG A;  3KV6 A;  4ZS2 A;  4X1I E;  5FMN A;  2ODU A;  2UXD T;  5J0Z A;  2YDR A;  3R6N A;  4OFZ A;  1YKH B;  2XAJ B;  3A7M A;  4LFC T;  4AKI A;  1OED A;  2EHO A;  2LSI A;  4O4J E;  2XUE A;  1MMN A;  3CPZ A;  3LK2 B;  3AE7 A;  2E5V A;  3RRC A;  4LF7 T;  3FXD B;  2XQ4 A;  3P4R A;  3ZLI A;  2YDS A;  2Y6X A;  1UUR A;  2XQA A;  1XZY A;  2YIN A;  3RIU C;  3MK7 C;  3HA4 A;  2VKO A;  1HG5 A;  4UXN B;  2X68 A;  1XDO A;  4DR1 T;  3E08 A;  3RC8 A;  2LKG A;  2Q9Q D;  3PMZ A;  4PK5 A;  4CXW A;  5JDL A;  3C84 A;  1N36 T;  3EHZ A;  1W9R A;  1I9B A;  2CA5 A;  4IST A;  3TLW A;  3OVU A;  2PBI A;  2I0M A;  2QA7 A;  4ILC A;  3RH3 A;  1YQ4 A;  4ZS3 A;  1HX8 A;  5AFK A;  1IBK T;  5FXX A;  4HWF A;  4A56 A;  4AFT A;  4HE8 A;  4EIW A;  3RI5 A;  5HXS A;  4GOU A;  2AE9 A;  4J2C A;  5IWA T;  4CN1 A;  3PUG A;  4I0U A;  4LMK A;  4QHO A;  4YSY A;  5ABH A;  3N2G E;  3JC6 C;  2XNV A;  1LKX A;  4HWD A;  2VWA A;  3N9N A;  5JRC A;  4OK0 A;  3HKE E;  3VKG A;  1XNQ T;  2DNX A;  5TVC A;  4UV8 B;  4PFO A;  2VQE T;  2YOE A;  1KFY A;  3AEB A;  2ODV A;  4OX9 T;  2FJE A;  5JME A;  5CFB A;  3VKH A;  4IDP A;  3CIR A;  4PJM A;  3T4M A;  2KXP B;  1KEY A;  3EDU A;  5JDF A;  5JDH A;  3JC6 D;  4JI0 T;  5AFN A;  2WAU A;  5AQU B;  1S94 A;  4YHH T;  4DBR A;  1US7 B;  3ZC1 A;  2BYP A;  3RYF E;  2EHO B;  1N33 T;  4QX7 B;  1E1H B;  4LMJ A;  5J5H A;  4Z91 A;  5ABE A;  3WTM A;  3PV0 F;  3RYI E;  3AAE B;  3AXJ A;  3CX8 B;  4ILB A;  2XYS A;  5FXZ A;  5FVK A;  2XQ8 A;  4DUY T;  4UY2 A;  5FJV A;  3UU4 A;  4JI6 T;  3FZL B;  2W66 A;  5F5W A;  4IL4 A;  5HXH A;  5HCJ A;  3QK6 A;  4YT0 A;  1WYC A;  5LB7 B;  2HN2 A;  3PUS A;  3PJA J;  3RGL A;  2LSK A;  4JLE A;  3OKQ A;  4ZR6 A;  5JTG A;  2UXX B;  2BS2 A;  4JBW F;  1JNZ A;  1V9D A;  5JDG A;  4CXY A;  2WNL A;  4XHE A;  1MMA A;  2E8I A;  4UM3 P;  4AQY T;  4UVA B;  4X65 T;  3UU5 A;  2WN9 A;  1HNZ T;  4U7Y A;  2WBL A;  3UFE A;  2HPL A;  4XK9 A;  2C0S A;  2W8F A;  2XSB A;  2WSS V;  4C90 A;  5FL1 A;  1L0V A;  2DL1 A;  2JRK A;  4ANJ A;  5LJM A;  5F3J A;  3CKD A;  2D2S A;  3ZDG A;  2MPK A;  3ONL C;  3AVR A;  2NTX A;  1OED E;  2WZH A;  3PE0 A;  4UXU A;  1D1A A;  3ZMV B;  4TNV A;  2DCF A;  5ABG A;  2UXN B;  1HS7 A;  4HFC A;  3RQU A;  3ZCJ A;  4I4T E;  3IBP A;  2CPT A;  3ZT6 A;  1UX5 A;  2BDE A;  3PUR A;  4LML A;  5JQG E;  2C5J A;  2E2A A;  1IJ6 A;  2Z6E A;  4IRE A;  3N9Q A;  4EGW A;  5IUX A;  5L3G B;  4I50 E;  2CMR A;  3AEF A;  2CXD A;  2NR4 A;  1IBL T;  1MND A;  1Y01 A;  3J7Y q;  2W00 A;  3AE4 A;  1UCU A;  3A5X A;  2CLY B;  4KHP T;  3IA3 A;  2KWI B;  2K48 A;  3A8Y C;  5JRC B;  2CEA A;  4P1N A;  3V5U A;  4LFA T;  2L8K A;  3F2E A;  1UW6 A;  1ZHC A;  4O8S A;  2N2N A;  5HEO A;  1FEW A;  2H7O A;  4LF5 T;  4O4H E;  3K3O A;  1J1J A;  1KK7 A;  4B5D A;  3K3Q C;  5HWX A;  4CXX A;  4UEM A;  3TLV A;  2BJ0 A;  1ZOY A;  1HNW T;  4AQG A;  1Z8U A;  3LK3 B;  1E2A A;  5HEJ A;  2JQQ A;  3RC3 A;  1MIW A;  4ZI7 E;  4HTE A;  4IDO A;  3UQ7 A;  5L3C B;  2BYR A;  4ZJS A;  1HCI A;  2XZ6 A;  2X00 D;  3AE2 A;  2I6H A;  3U3I A;  2PGZ A;  4XBF B;  5HEU A;  2BBJ A;  3JCF A;  2LHN A;  4TUY E;  2Y54 A;  5H6R B;  4X1K E;  4K0K T;  3HKB E;  4H9Q C;  1DU2 A;  2FJA A;  2BVM A;  1YW0 A;  5AQK B;  2XAQ B;  3RKG A;  4IE7 A;  4BAY B;  4QKN A;  2YME A;  3ZN1 B;  3CX7 B;  2H3R A;  4M1P A;  2YDQ A;  4EZH A;  4EAH A;  3K3N A;  4UVB B;  5LGU B;  1U4Q A;  2V6X A;  4PJN A;  4X5T A;  4MBQ A;  4PK6 A;  5FP3 A;  1N32 T;  4NUU A;  2Y57 A;  5KMG P;  4ZI2 C;  3F57 A;  4QH1 A;  3MKD A;  2CLY C;  3SFE A;  4O4I E;  2ACX A;  3OTO T;  3SH1 A;  2XAS B;  3VRB A;  3QNU A;  2VL0 A;  2QRX A; 
#chains in the Genus database with same CATH homology
 5AFH A;  1OED E;  3U8M A;  1OED C;  3TLU A;  4UXU A;  2BYR A;  2W8G A;  2LKG A;  4TNV A;  2BYP A;  2Y56 A;  4QH4 A;  5HCM A;  2ZJV A;  3PMZ A;  4ZJS A;  5AFM B;  2BG9 C;  4UM3 A;  4HFC A;  3RQU A;  2XZ6 A;  4PIR A;  3WTJ A;  2X00 D;  3C84 A;  4HFB A;  2XQ7 A;  3TLS A;  5AFM A;  3EHZ A;  1I9B A;  2BR8 A;  4F8H A;  2BYN A;  5L47 A;  4LML A;  4LMJ A;  5J5I A;  5J5H A;  4EZ1 A;  4Z91 A;  2Y7Y A;  2PGZ A;  4WV9 A;  5BRX A;  3WTM A;  2ZJU A;  5HEU A;  4A97 A;  5KZU A;  3TLW A;  4IRE A;  5IUX A;  3RHW A;  4HQP A;  4TWF A;  3ZKR A;  4QAB A;  3SIO A;  2Y54 A;  4Z90 A;  4ILC A;  3UU6 A;  3IGQ A;  5L4E A;  5L4H A;  3RIF A;  5AFK A;  2LKH A;  4HFH A;  5LXB A;  4QH5 A;  3RQW A;  4ILB A;  2PH9 A;  2XQ6 A;  4AFT A;  2M6I A;  2XYS A;  2XQ8 A;  2XQ9 A;  4TNW A;  4UY2 A;  5FJV A;  3UU4 A;  3WTO A;  2Y58 A;  2WNJ A;  4NZB A;  4D01 A;  5BW2 A;  3RI5 A;  3PEO A;  2BG9 B;  2XZ5 A;  2BR7 A;  4IL4 A;  5HCJ A;  4QAC A;  4COF A;  4BQT A;  4BFQ A;  4ZJT A;  1OED B;  2XQ5 A;  4TWD A;  2X00 A;  3TLT A;  3P50 A;  3WTN A;  2UZ6 A;  5SYO A;  4ZRU A;  2BYQ A;  5LG3 A;  4AFG A;  2YME A;  3LSV A;  4LMK A;  3WIP A;  4NPP A;  3UU8 A;  3WTK A;  5HEG A;  2YMD A;  2BG9 E;  4ZK4 A;  4QAA A;  1UW6 A;  4ZR6 A;  4ZZC A;  5HEO A;  5BP0 A;  3EI0 A;  2WZY A;  2XNV A;  5J0Z A;  2WNL A;  4A98 A;  4XHE A;  2M6B A;  3U8J A;  2BG9 A;  3UU3 A;  1UV6 A;  4UM3 P;  3UUB A;  3WTL A;  2KSR A;  5AFL A;  3UQ4 A;  5CO5 A;  5AFJ A;  3JAE A;  5TVC A;  3C79 A;  4B5D A;  2YOE A;  1OED A;  4X5T A;  3UU5 A;  2WN9 A;  4HFE A;  2BYS A;  2XYT A;  5JME A;  4ILA A;  2C9T A;  3TLV A;  2LM2 A;  4ALX A;  2XQ3 A;  4UM1 A;  4TWH A;  3JAD A;  5CFB A;  3GUA A;  4XK9 A;  4DBM A;  2W8F A;  2Y57 A;  5J5G A;  4AFH A;  4HFD A;  2MAW A;  2BJ0 A;  4ZZB A;  3T4M A;  4ZK1 A;  2YN6 A;  3SQ9 A;  2LLY A;  2XQ4 A;  3RIA A;  3U8N A;  1UX2 A;  4QH1 A;  5J5F A;  3WTH A;  4FRR A;  4HFI A;  3ZDH A;  2QC1 B;  2XNT A;  2WNC A;  2XQA A;  5AIN A;  4IL9 A;  3EAM A;  5AFN A;  3SH1 A;  5HEJ A;  5KE4 A;  3P4W A;  4UM3 S;  3U8L A;  2YKS A;  2XNU A;  3ZDG A;  2VL0 A;  3U8K A;  3JAF A;  3SQ6 A;  5HEH A;  3UQ7 A;  3WTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...