4ALXA

Crystal structure of ls-achbp complexed with the potent nachr antagonist dhbe
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
210
structure length
210
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE BINDING PROTEIN
publication title Crystal Structure of Lymnaea Stagnalis Achbp Complexed with the Potent Nachr Antagonist Dh-Betab-E Suggests a Unique Mode of Antagonism
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein
total genus 52
structure length 210
sequence length 210
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4alxA00
2XNTA 5CO5A 2XNVA 3P50A 4AFHA 4EZ1A 3ZDHA 3C84A 2XQ8A 5AFHA 4QH5A 4QH4A 4ZZBA 3TLUA 2PH9A 2XYSA 3SIOA 4HQPA 2Y58A 5HCJA 4HFDA 3UU3A 3UQ7A 3UUBA 5HEGA 2XQ4A 5BP0A 5LXBA 2Y56A 2BJ0A 5BRXA 5HEHA 2BYQA 5AFJA 2BR8A 5SYOA 3RI5A 3SQ9A 3TLVA 3P4WA 5IUXA 1UW6A 1I9BA 2ZJVA 4IREA 3ZKRA 4ALXA 4ZK4A 4AFTA 4F8HA 3SH1A 2WZYA 4HFHA 3SQ6A 2Y57A 4ZK1A 2BG9A 3WTLA 4Z91A 3PEOA 3U8LA 4TNVA 5AFLA 3LSVA 4UM1A 2X00A 2XZ5A 3WTOA 4QH1A 4UXUA 3WTKA 4COFA 4HFBA 4AFGA 5CFBA 5HEOA 2W8GA 2W8FA 3EI0A 2WNJA 3JAEA 4IL4A 5AFKA 2YMEA 5KE4A 2Y54A 5J5FA 3WTNA 4DBMA 3TLWA 4A98A 4QACA 2C9TA 4BFQA 3UU4A 2BG9C 2XQ6A 2QC1B 2XQ9A 4NPPA 3WTHA 3GUAA 1UX2A 4X5TA 3ZDGA 3JAFA 4LMLA 4XK9A 4PIRA 4ZR6A 4XHEA 4ILAA 4TWFA 2YKSA 3RHWA 2BG9B 5HEUA 5JMEA 4ILCA 5HCMA 4UM3P 3UU6A 5TVCA 2Y7YA 4IL9A 3RQUA 3T4MA 2BYSA 4QABA 5J0ZA 2BR7A 3U8NA 3WTJA 5KZUA 4UM3A 5BW2A 3U8MA 4HFEA 5LG3A 3JADA 5AFMA 3TLTA 2BYPA 4TWHA 3UU8A 5HEJA 2XYTA 2WNCA 2XQ5A 4ZJTA 2BYNA 4D01A 3PMZA 4FRRA 4BQTA 4HFIA 3UU5A 5AINA 3UQ4A 4TNWA 4ZZCA 4WV9A 3RIFA 5J5IA 2YOEA 4LMJA 2WNLA 2YN6A 3WIPA 1UV6A 2XQ3A 4Z90A 3WTMA 5FJVA 2XNUA 2BG9E 2UZ6A 3RQWA 2X00D 3U8KA 2XZ6A 4TWDA 4NZBA 4HFCA 2XQ7A 4ZJSA 5L4HA 4B5DA 5J5HA 3U8JA 4ZRUA 2BYRA 2YMDA 3TLSA 3IGQA 4QAAA 5J5GA 5AFMB 5L47A 2VL0A 2ZJUA 2PGZA 3EHZA 3EAMA 4LMKA 4A97A 4UM3S 3RIAA 2WN9A 4ILBA 5L4EA 3WTIA 5AFNA 3C79A 2XQAA 4UY2A
chains in the Genus database with same CATH superfamily
2XNTA 5CO5A 2XNVA 3P50A 4AFHA 4EZ1A 3ZDHA 3C84A 2XQ8A 5AFHA 4QH5A 4QH4A 4ZZBA 3TLUA 2PH9A 2XYSA 3SIOA 4HQPA 2Y58A 5HCJA 4HFDA 3UU3A 3UQ7A 3UUBA 5HEGA 2XQ4A 5BP0A 5LXBA 2Y56A 2BJ0A 5BRXA 5HEHA 2BYQA 5AFJA 2BR8A 5SYOA 3RI5A 3SQ9A 3TLVA 3P4WA 5IUXA 1UW6A 1I9BA 2ZJVA 4IREA 3ZKRA 4ALXA 4ZK4A 4AFTA 4F8HA 3SH1A 2WZYA 4HFHA 3SQ6A 2Y57A 4ZK1A 2BG9A 3WTLA 4Z91A 3PEOA 3U8LA 4TNVA 5AFLA 3LSVA 4UM1A 2X00A 2XZ5A 3WTOA 4QH1A 4UXUA 3WTKA 4COFA 4HFBA 4AFGA 5CFBA 5HEOA 2W8GA 2W8FA 3EI0A 2WNJA 3JAEA 4IL4A 5AFKA 2YMEA 5KE4A 2Y54A 5J5FA 3WTNA 4DBMA 3TLWA 4A98A 4QACA 2C9TA 4BFQA 3UU4A 2BG9C 2XQ6A 2QC1B 2XQ9A 4NPPA 3WTHA 3GUAA 1UX2A 4X5TA 3ZDGA 3JAFA 4LMLA 4XK9A 4PIRA 4ZR6A 4XHEA 4ILAA 4TWFA 2YKSA 3RHWA 2BG9B 5HEUA 5JMEA 4ILCA 5HCMA 4UM3P 3UU6A 5TVCA 2Y7YA 4IL9A 3RQUA 3T4MA 2BYSA 4QABA 5J0ZA 2BR7A 3U8NA 3WTJA 5KZUA 4UM3A 5BW2A 3U8MA 4HFEA 5LG3A 3JADA 5AFMA 3TLTA 2BYPA 4TWHA 3UU8A 5HEJA 2XYTA 2WNCA 2XQ5A 4ZJTA 2BYNA 4D01A 3PMZA 4FRRA 4BQTA 4HFIA 3UU5A 5AINA 3UQ4A 4TNWA 4ZZCA 4WV9A 3RIFA 5J5IA 2YOEA 4LMJA 2WNLA 2YN6A 3WIPA 1UV6A 2XQ3A 4Z90A 3WTMA 5FJVA 2XNUA 2BG9E 2UZ6A 3RQWA 2X00D 3U8KA 2XZ6A 4TWDA 4NZBA 4HFCA 2XQ7A 4ZJSA 5L4HA 4B5DA 5J5HA 3U8JA 4ZRUA 2BYRA 2YMDA 3TLSA 3IGQA 4QAAA 5J5GA 5AFMB 5L47A 2VL0A 2ZJUA 2PGZA 3EHZA 3EAMA 4LMKA 4A97A 4UM3S 3RIAA 2WN9A 4ILBA 5L4EA 3WTIA 5AFNA 3C79A 2XQAA 4UY2A
chains in the Genus database with same CATH topology
2XNTA 5CO5A 2XNVA 3P50A 4AFHA 4EZ1A 3ZDHA 3C84A 2XQ8A 5AFHA 4QH5A 4QH4A 4ZZBA 3TLUA 2PH9A 2XYSA 3SIOA 4HQPA 2Y58A 5HCJA 4HFDA 3UU3A 3UQ7A 3UUBA 5HEGA 2XQ4A 5BP0A 5LXBA 2Y56A 2BJ0A 5BRXA 5HEHA 2BYQA 5AFJA 2BR8A 5SYOA 3RI5A 3SQ9A 3TLVA 3P4WA 5IUXA 1UW6A 1I9BA 2ZJVA 4IREA 3ZKRA 4ALXA 4ZK4A 4AFTA 4F8HA 3SH1A 2WZYA 4HFHA 3SQ6A 2Y57A 4ZK1A 2BG9A 3WTLA 4Z91A 3PEOA 3U8LA 4TNVA 5AFLA 3LSVA 4UM1A 2X00A 2XZ5A 3WTOA 4QH1A 4UXUA 3WTKA 4COFA 4HFBA 4AFGA 5CFBA 5HEOA 2W8GA 2W8FA 3EI0A 2WNJA 3JAEA 4IL4A 5AFKA 2YMEA 5KE4A 2Y54A 5J5FA 3WTNA 4DBMA 3TLWA 4A98A 4QACA 2C9TA 4BFQA 3UU4A 2BG9C 2XQ6A 2QC1B 2XQ9A 4NPPA 3WTHA 3GUAA 1UX2A 4X5TA 3ZDGA 3JAFA 4LMLA 4XK9A 4PIRA 4ZR6A 4XHEA 4ILAA 4TWFA 2YKSA 3RHWA 2BG9B 5HEUA 5JMEA 4ILCA 5HCMA 4UM3P 3UU6A 5TVCA 2Y7YA 4IL9A 3RQUA 3T4MA 2BYSA 4QABA 5J0ZA 2BR7A 3U8NA 3WTJA 5KZUA 4UM3A 5BW2A 3U8MA 4HFEA 5LG3A 3JADA 5AFMA 3TLTA 2BYPA 4TWHA 3UU8A 5HEJA 2XYTA 2WNCA 2XQ5A 4ZJTA 2BYNA 4D01A 3PMZA 4FRRA 4BQTA 4HFIA 3UU5A 5AINA 3UQ4A 4TNWA 4ZZCA 4WV9A 3RIFA 5J5IA 2YOEA 4LMJA 2WNLA 2YN6A 3WIPA 1UV6A 2XQ3A 4Z90A 3WTMA 5FJVA 2XNUA 2BG9E 2UZ6A 3RQWA 2X00D 3U8KA 2XZ6A 4TWDA 4NZBA 4HFCA 2XQ7A 4ZJSA 5L4HA 4B5DA 5J5HA 3U8JA 4ZRUA 2BYRA 2YMDA 3TLSA 3IGQA 4QAAA 5J5GA 5AFMB 5L47A 2VL0A 2ZJUA 2PGZA 3EHZA 3EAMA 4LMKA 4A97A 4UM3S 3RIAA 2WN9A 4ILBA 5L4EA 3WTIA 5AFNA 3C79A 2XQAA 4UY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XNT A;  5CO5 A;  2XNV A;  3P50 A;  4AFH A;  4EZ1 A;  3ZDH A;  3C84 A;  2XQ8 A;  5AFH A;  4QH5 A;  4QH4 A;  4ZZB A;  3TLU A;  2PH9 A;  2XYS A;  3SIO A;  4HQP A;  2Y58 A;  5HCJ A;  4HFD A;  3UU3 A;  3UQ7 A;  3UUB A;  5HEG A;  2XQ4 A;  5BP0 A;  5LXB A;  2Y56 A;  2BJ0 A;  5BRX A;  5HEH A;  2BYQ A;  5AFJ A;  2BR8 A;  5SYO A;  3RI5 A;  3SQ9 A;  3TLV A;  3P4W A;  5IUX A;  1UW6 A;  1I9B A;  2ZJV A;  4IRE A;  3ZKR A;  4ALX A;  4ZK4 A;  4AFT A;  4F8H A;  3SH1 A;  2WZY A;  4HFH A;  3SQ6 A;  2Y57 A;  4ZK1 A;  2BG9 A;  3WTL A;  4Z91 A;  3PEO A;  3U8L A;  4TNV A;  5AFL A;  3LSV A;  4UM1 A;  2X00 A;  2XZ5 A;  3WTO A;  4QH1 A;  4UXU A;  3WTK A;  4COF A;  4HFB A;  4AFG A;  5CFB A;  5HEO A;  2W8G A;  2W8F A;  3EI0 A;  2WNJ A;  3JAE A;  4IL4 A;  5AFK A;  2YME A;  5KE4 A;  2Y54 A;  5J5F A;  3WTN A;  4DBM A;  3TLW A;  4A98 A;  4QAC A;  2C9T A;  4BFQ A;  3UU4 A;  2BG9 C;  2XQ6 A;  2QC1 B;  2XQ9 A;  4NPP A;  3WTH A;  3GUA A;  1UX2 A;  4X5T A;  3ZDG A;  3JAF A;  4LML A;  4XK9 A;  4PIR A;  4ZR6 A;  4XHE A;  4ILA A;  4TWF A;  2YKS A;  3RHW A;  2BG9 B;  5HEU A;  5JME A;  4ILC A;  5HCM A;  4UM3 P;  3UU6 A;  5TVC A;  2Y7Y A;  4IL9 A;  3RQU A;  3T4M A;  2BYS A;  4QAB A;  5J0Z A;  2BR7 A;  3U8N A;  3WTJ A;  5KZU A;  4UM3 A;  5BW2 A;  3U8M A;  4HFE A;  5LG3 A;  3JAD A;  5AFM A;  3TLT A;  2BYP A;  4TWH A;  3UU8 A;  5HEJ A;  2XYT A;  2WNC A;  2XQ5 A;  4ZJT A;  2BYN A;  4D01 A;  3PMZ A;  4FRR A;  4BQT A;  4HFI A;  3UU5 A;  5AIN A;  3UQ4 A;  4TNW A;  4ZZC A;  4WV9 A;  3RIF A;  5J5I A;  2YOE A;  4LMJ A;  2WNL A;  2YN6 A;  3WIP A;  1UV6 A;  2XQ3 A;  4Z90 A;  3WTM A;  5FJV A;  2XNU A;  2BG9 E;  2UZ6 A;  3RQW A;  2X00 D;  3U8K A;  2XZ6 A;  4TWD A;  4NZB A;  4HFC A;  2XQ7 A;  4ZJS A;  5L4H A;  4B5D A;  5J5H A;  3U8J A;  4ZRU A;  2BYR A;  2YMD A;  3TLS A;  3IGQ A;  4QAA A;  5J5G A;  5AFM B;  5L47 A;  2VL0 A;  2ZJU A;  2PGZ A;  3EHZ A;  3EAM A;  4LMK A;  4A97 A;  4UM3 S;  3RIA A;  2WN9 A;  4ILB A;  5L4E A;  3WTI A;  5AFN A;  3C79 A;  2XQA A;  4UY2 A; 
#chains in the Genus database with same CATH topology
 2XNT A;  5CO5 A;  2XNV A;  3P50 A;  4AFH A;  4EZ1 A;  3ZDH A;  3C84 A;  2XQ8 A;  5AFH A;  4QH5 A;  4QH4 A;  4ZZB A;  3TLU A;  2PH9 A;  2XYS A;  3SIO A;  4HQP A;  2Y58 A;  5HCJ A;  4HFD A;  3UU3 A;  3UQ7 A;  3UUB A;  5HEG A;  2XQ4 A;  5BP0 A;  5LXB A;  2Y56 A;  2BJ0 A;  5BRX A;  5HEH A;  2BYQ A;  5AFJ A;  2BR8 A;  5SYO A;  3RI5 A;  3SQ9 A;  3TLV A;  3P4W A;  5IUX A;  1UW6 A;  1I9B A;  2ZJV A;  4IRE A;  3ZKR A;  4ALX A;  4ZK4 A;  4AFT A;  4F8H A;  3SH1 A;  2WZY A;  4HFH A;  3SQ6 A;  2Y57 A;  4ZK1 A;  2BG9 A;  3WTL A;  4Z91 A;  3PEO A;  3U8L A;  4TNV A;  5AFL A;  3LSV A;  4UM1 A;  2X00 A;  2XZ5 A;  3WTO A;  4QH1 A;  4UXU A;  3WTK A;  4COF A;  4HFB A;  4AFG A;  5CFB A;  5HEO A;  2W8G A;  2W8F A;  3EI0 A;  2WNJ A;  3JAE A;  4IL4 A;  5AFK A;  2YME A;  5KE4 A;  2Y54 A;  5J5F A;  3WTN A;  4DBM A;  3TLW A;  4A98 A;  4QAC A;  2C9T A;  4BFQ A;  3UU4 A;  2BG9 C;  2XQ6 A;  2QC1 B;  2XQ9 A;  4NPP A;  3WTH A;  3GUA A;  1UX2 A;  4X5T A;  3ZDG A;  3JAF A;  4LML A;  4XK9 A;  4PIR A;  4ZR6 A;  4XHE A;  4ILA A;  4TWF A;  2YKS A;  3RHW A;  2BG9 B;  5HEU A;  5JME A;  4ILC A;  5HCM A;  4UM3 P;  3UU6 A;  5TVC A;  2Y7Y A;  4IL9 A;  3RQU A;  3T4M A;  2BYS A;  4QAB A;  5J0Z A;  2BR7 A;  3U8N A;  3WTJ A;  5KZU A;  4UM3 A;  5BW2 A;  3U8M A;  4HFE A;  5LG3 A;  3JAD A;  5AFM A;  3TLT A;  2BYP A;  4TWH A;  3UU8 A;  5HEJ A;  2XYT A;  2WNC A;  2XQ5 A;  4ZJT A;  2BYN A;  4D01 A;  3PMZ A;  4FRR A;  4BQT A;  4HFI A;  3UU5 A;  5AIN A;  3UQ4 A;  4TNW A;  4ZZC A;  4WV9 A;  3RIF A;  5J5I A;  2YOE A;  4LMJ A;  2WNL A;  2YN6 A;  3WIP A;  1UV6 A;  2XQ3 A;  4Z90 A;  3WTM A;  5FJV A;  2XNU A;  2BG9 E;  2UZ6 A;  3RQW A;  2X00 D;  3U8K A;  2XZ6 A;  4TWD A;  4NZB A;  4HFC A;  2XQ7 A;  4ZJS A;  5L4H A;  4B5D A;  5J5H A;  3U8J A;  4ZRU A;  2BYR A;  2YMD A;  3TLS A;  3IGQ A;  4QAA A;  5J5G A;  5AFM B;  5L47 A;  2VL0 A;  2ZJU A;  2PGZ A;  3EHZ A;  3EAM A;  4LMK A;  4A97 A;  4UM3 S;  3RIA A;  2WN9 A;  4ILB A;  5L4E A;  3WTI A;  5AFN A;  3C79 A;  2XQA A;  4UY2 A; 
#chains in the Genus database with same CATH homology
 2XNT A;  5CO5 A;  2XNV A;  3P50 A;  4AFH A;  4EZ1 A;  3ZDH A;  3C84 A;  2XQ8 A;  5AFH A;  4QH5 A;  4QH4 A;  4ZZB A;  3TLU A;  2PH9 A;  2XYS A;  3SIO A;  4HQP A;  2Y58 A;  5HCJ A;  4HFD A;  3UU3 A;  3UQ7 A;  3UUB A;  5HEG A;  2XQ4 A;  5BP0 A;  5LXB A;  2Y56 A;  2BJ0 A;  5BRX A;  5HEH A;  2BYQ A;  5AFJ A;  2BR8 A;  5SYO A;  3RI5 A;  3SQ9 A;  3TLV A;  3P4W A;  5IUX A;  1UW6 A;  1I9B A;  2ZJV A;  4IRE A;  3ZKR A;  4ALX A;  4ZK4 A;  4AFT A;  4F8H A;  3SH1 A;  2WZY A;  4HFH A;  3SQ6 A;  2Y57 A;  4ZK1 A;  2BG9 A;  3WTL A;  4Z91 A;  3PEO A;  3U8L A;  4TNV A;  5AFL A;  3LSV A;  4UM1 A;  2X00 A;  2XZ5 A;  3WTO A;  4QH1 A;  4UXU A;  3WTK A;  4COF A;  4HFB A;  4AFG A;  5CFB A;  5HEO A;  2W8G A;  2W8F A;  3EI0 A;  2WNJ A;  3JAE A;  4IL4 A;  5AFK A;  2YME A;  5KE4 A;  2Y54 A;  5J5F A;  3WTN A;  4DBM A;  3TLW A;  4A98 A;  4QAC A;  2C9T A;  4BFQ A;  3UU4 A;  2BG9 C;  2XQ6 A;  2QC1 B;  2XQ9 A;  4NPP A;  3WTH A;  3GUA A;  1UX2 A;  4X5T A;  3ZDG A;  3JAF A;  4LML A;  4XK9 A;  4PIR A;  4ZR6 A;  4XHE A;  4ILA A;  4TWF A;  2YKS A;  3RHW A;  2BG9 B;  5HEU A;  5JME A;  4ILC A;  5HCM A;  4UM3 P;  3UU6 A;  5TVC A;  2Y7Y A;  4IL9 A;  3RQU A;  3T4M A;  2BYS A;  4QAB A;  5J0Z A;  2BR7 A;  3U8N A;  3WTJ A;  5KZU A;  4UM3 A;  5BW2 A;  3U8M A;  4HFE A;  5LG3 A;  3JAD A;  5AFM A;  3TLT A;  2BYP A;  4TWH A;  3UU8 A;  5HEJ A;  2XYT A;  2WNC A;  2XQ5 A;  4ZJT A;  2BYN A;  4D01 A;  3PMZ A;  4FRR A;  4BQT A;  4HFI A;  3UU5 A;  5AIN A;  3UQ4 A;  4TNW A;  4ZZC A;  4WV9 A;  3RIF A;  5J5I A;  2YOE A;  4LMJ A;  2WNL A;  2YN6 A;  3WIP A;  1UV6 A;  2XQ3 A;  4Z90 A;  3WTM A;  5FJV A;  2XNU A;  2BG9 E;  2UZ6 A;  3RQW A;  2X00 D;  3U8K A;  2XZ6 A;  4TWD A;  4NZB A;  4HFC A;  2XQ7 A;  4ZJS A;  5L4H A;  4B5D A;  5J5H A;  3U8J A;  4ZRU A;  2BYR A;  2YMD A;  3TLS A;  3IGQ A;  4QAA A;  5J5G A;  5AFM B;  5L47 A;  2VL0 A;  2ZJU A;  2PGZ A;  3EHZ A;  3EAM A;  4LMK A;  4A97 A;  4UM3 S;  3RIA A;  2WN9 A;  4ILB A;  5L4E A;  3WTI A;  5AFN A;  3C79 A;  2XQA A;  4UY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...