4ALXA

Crystal structure of ls-achbp complexed with the potent nachr antagonist dhbe
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
210
structure length
210
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Lymnaea Stagnalis Achbp Complexed with the Potent Nachr Antagonist Dh-Betab-E Suggests a Unique Mode of Antagonism
pubmed doi rcsb
molecule keywords ACETYLCHOLINE BINDING PROTEIN
molecule tags Acetylcholine-binding protein
source organism Lymnaea stagnalis
total genus 52
structure length 210
sequence length 210
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4alxA00
5LG3A 2WNJA 1UX2A 2WZYA 3JAFA 4QAAA 2Y7YA 5LXBA 3UU4A 2BR8A 2UZ6A 4TNVA 3T4MA 4HFCA 3UU6A 3UQ4A 4LMLA 4QACA 4ALXA 4ZR6A 5AFMA 1UW6A 3WTHA 2WNLA 2XZ5A 2XQAA 4TWFA 3SIOA 4ZZBA 2XQ9A 2XQ4A 3SQ6A 5IUXA 2ZJUA 4A97A 3PEOA 4QH1A 5AINA 5AFMB 2YKSA 3WTLA 2BG9A 2C9TA 3RHWA 5KZUA 3RQUA 2XNUA 5J5GA 4LMJA 3U8NA 4UM1A 3C84A 4HFBA 1I9BA 3EAMA 2BJ0A 2ZJVA 4QH5A 2Y54A 4ZJSA 2XQ8A 5AFKA 4XK9A 4UM3A 3ZKRA 5HCMA 2XQ3A 2WNCA 2Y56A 2VL0A 5BRXA 4D01A 4F8HA 5AFHA 3P50A 3WTJA 3WTKA 3JADA 4NPPA 4UM3S 2Y58A 4QH4A 4ZZCA 5HEJA 4X5TA 2X00D 5AFJA 5JMEA 2W8GA 3WTMA 4IREA 4HFIA 2X00A 3SH1A 4HFEA 5AFNA 2BYSA 3U8JA 4Z91A 4ZJTA 3PMZA 2Y57A 4TWHA 2BYRA 2BG9B 3C79A 4HQPA 4EZ1A 4TWDA 4A98A 5BP0A 5BW2A 4ILAA 4WV9A 3TLWA 4BFQA 4QABA 4HFHA 2YOEA 4COFA 2YMEA 5J5IA 4XHEA 4AFGA 2BG9E 5J5FA 2BG9C 2XNVA 3TLUA 3TLTA 3UU5A 5HEGA 4FRRA 5SYOA 1UV6A 2XYTA 3UUBA 3P4WA 3UU3A 2W8FA 4HFDA 3U8LA 5L47A 2BYNA 3WTIA 5HEUA 4ZK4A 3UU8A 3TLSA 4PIRA 4DBMA 2XQ5A 2PGZA 4AFTA 2YMDA 4ZK1A 3EHZA 2BYQA 5FJVA 2BR7A 3GUAA 5CFBA 4IL9A 3IGQA 3TLVA 3JAEA 4AFHA 4Z90A 5HEOA 5KE4A 3LSVA 4ILBA 2BYPA 4ILCA 2XYSA 4IL4A 5L4HA 3SQ9A 2QC1B 3U8KA 4BQTA 3ZDHA 4UXUA 2WN9A 3U8MA 2YN6A 4ZRUA 5TVCA 4UM3P 4B5DA 3UQ7A 3EI0A 4UY2A 2XZ6A 5CO5A 3RIFA 3RIAA 5HEHA 3WIPA 3WTOA 5AFLA 3RQWA 4NZBA 2PH9A 5L4EA 3WTNA 3ZDGA 5HCJA 5J0ZA 2XQ7A 4TNWA 3RI5A 5J5HA 4LMKA 2XQ6A 2XNTA
chains in the Genus database with same CATH superfamily
5LG3A 2WNJA 1UX2A 2WZYA 3JAFA 4QAAA 2Y7YA 5LXBA 3UU4A 2BR8A 2UZ6A 4TNVA 3T4MA 4HFCA 3UU6A 3UQ4A 4LMLA 4QACA 4ALXA 4ZR6A 5AFMA 1UW6A 3WTHA 2WNLA 2XZ5A 2XQAA 4TWFA 3SIOA 4ZZBA 2XQ9A 2XQ4A 3SQ6A 5IUXA 2ZJUA 4A97A 3PEOA 4QH1A 5AINA 5AFMB 2YKSA 3WTLA 2BG9A 2C9TA 3RHWA 5KZUA 3RQUA 2XNUA 5J5GA 4LMJA 3U8NA 4UM1A 3C84A 4HFBA 1I9BA 3EAMA 2BJ0A 2ZJVA 4QH5A 2Y54A 4ZJSA 2XQ8A 5AFKA 4XK9A 4UM3A 3ZKRA 5HCMA 2XQ3A 2WNCA 2Y56A 2VL0A 5BRXA 4D01A 4F8HA 5AFHA 3P50A 3WTJA 3WTKA 3JADA 4NPPA 4UM3S 2Y58A 4QH4A 4ZZCA 5HEJA 4X5TA 2X00D 5AFJA 5JMEA 2W8GA 3WTMA 4IREA 4HFIA 2X00A 3SH1A 4HFEA 5AFNA 2BYSA 3U8JA 4Z91A 4ZJTA 3PMZA 2Y57A 4TWHA 2BYRA 2BG9B 3C79A 4HQPA 4EZ1A 4TWDA 4A98A 5BP0A 5BW2A 4ILAA 4WV9A 3TLWA 4BFQA 4QABA 4HFHA 2YOEA 4COFA 2YMEA 5J5IA 4XHEA 4AFGA 2BG9E 5J5FA 2BG9C 2XNVA 3TLUA 3TLTA 3UU5A 5HEGA 4FRRA 5SYOA 1UV6A 2XYTA 3UUBA 3P4WA 3UU3A 2W8FA 4HFDA 3U8LA 5L47A 2BYNA 3WTIA 5HEUA 4ZK4A 3UU8A 3TLSA 4PIRA 4DBMA 2XQ5A 2PGZA 4AFTA 2YMDA 4ZK1A 3EHZA 2BYQA 5FJVA 2BR7A 3GUAA 5CFBA 4IL9A 3IGQA 3TLVA 3JAEA 4AFHA 4Z90A 5HEOA 5KE4A 3LSVA 4ILBA 2BYPA 4ILCA 2XYSA 4IL4A 5L4HA 3SQ9A 2QC1B 3U8KA 4BQTA 3ZDHA 4UXUA 2WN9A 3U8MA 2YN6A 4ZRUA 5TVCA 4UM3P 4B5DA 3UQ7A 3EI0A 4UY2A 2XZ6A 5CO5A 3RIFA 3RIAA 5HEHA 3WIPA 3WTOA 5AFLA 3RQWA 4NZBA 2PH9A 5L4EA 3WTNA 3ZDGA 5HCJA 5J0ZA 2XQ7A 4TNWA 3RI5A 5J5HA 4LMKA 2XQ6A 2XNTA
chains in the Genus database with same CATH topology
5LG3A 2WNJA 1UX2A 2WZYA 3JAFA 4QAAA 2Y7YA 5LXBA 3UU4A 2BR8A 2UZ6A 4TNVA 3T4MA 4HFCA 3UU6A 3UQ4A 4LMLA 4QACA 4ALXA 4ZR6A 5AFMA 1UW6A 3WTHA 2WNLA 2XZ5A 2XQAA 4TWFA 3SIOA 4ZZBA 2XQ9A 2XQ4A 3SQ6A 5IUXA 2ZJUA 4A97A 3PEOA 4QH1A 5AINA 5AFMB 2YKSA 3WTLA 2BG9A 2C9TA 3RHWA 5KZUA 3RQUA 2XNUA 5J5GA 4LMJA 3U8NA 4UM1A 3C84A 4HFBA 1I9BA 3EAMA 2BJ0A 2ZJVA 4QH5A 2Y54A 4ZJSA 2XQ8A 5AFKA 4XK9A 4UM3A 3ZKRA 5HCMA 2XQ3A 2WNCA 2Y56A 2VL0A 5BRXA 4D01A 4F8HA 5AFHA 3P50A 3WTJA 3WTKA 3JADA 4NPPA 4UM3S 2Y58A 4QH4A 4ZZCA 5HEJA 4X5TA 2X00D 5AFJA 5JMEA 2W8GA 3WTMA 4IREA 4HFIA 2X00A 3SH1A 4HFEA 5AFNA 2BYSA 3U8JA 4Z91A 4ZJTA 3PMZA 2Y57A 4TWHA 2BYRA 2BG9B 3C79A 4HQPA 4EZ1A 4TWDA 4A98A 5BP0A 5BW2A 4ILAA 4WV9A 3TLWA 4BFQA 4QABA 4HFHA 2YOEA 4COFA 2YMEA 5J5IA 4XHEA 4AFGA 2BG9E 5J5FA 2BG9C 2XNVA 3TLUA 3TLTA 3UU5A 5HEGA 4FRRA 5SYOA 1UV6A 2XYTA 3UUBA 3P4WA 3UU3A 2W8FA 4HFDA 3U8LA 5L47A 2BYNA 3WTIA 5HEUA 4ZK4A 3UU8A 3TLSA 4PIRA 4DBMA 2XQ5A 2PGZA 4AFTA 2YMDA 4ZK1A 3EHZA 2BYQA 5FJVA 2BR7A 3GUAA 5CFBA 4IL9A 3IGQA 3TLVA 3JAEA 4AFHA 4Z90A 5HEOA 5KE4A 3LSVA 4ILBA 2BYPA 4ILCA 2XYSA 4IL4A 5L4HA 3SQ9A 2QC1B 3U8KA 4BQTA 3ZDHA 4UXUA 2WN9A 3U8MA 2YN6A 4ZRUA 5TVCA 4UM3P 4B5DA 3UQ7A 3EI0A 4UY2A 2XZ6A 5CO5A 3RIFA 3RIAA 5HEHA 3WIPA 3WTOA 5AFLA 3RQWA 4NZBA 2PH9A 5L4EA 3WTNA 3ZDGA 5HCJA 5J0ZA 2XQ7A 4TNWA 3RI5A 5J5HA 4LMKA 2XQ6A 2XNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LG3 A;  2WNJ A;  1UX2 A;  2WZY A;  3JAF A;  4QAA A;  2Y7Y A;  5LXB A;  3UU4 A;  2BR8 A;  2UZ6 A;  4TNV A;  3T4M A;  4HFC A;  3UU6 A;  3UQ4 A;  4LML A;  4QAC A;  4ALX A;  4ZR6 A;  5AFM A;  1UW6 A;  3WTH A;  2WNL A;  2XZ5 A;  2XQA A;  4TWF A;  3SIO A;  4ZZB A;  2XQ9 A;  2XQ4 A;  3SQ6 A;  5IUX A;  2ZJU A;  4A97 A;  3PEO A;  4QH1 A;  5AIN A;  5AFM B;  2YKS A;  3WTL A;  2BG9 A;  2C9T A;  3RHW A;  5KZU A;  3RQU A;  2XNU A;  5J5G A;  4LMJ A;  3U8N A;  4UM1 A;  3C84 A;  4HFB A;  1I9B A;  3EAM A;  2BJ0 A;  2ZJV A;  4QH5 A;  2Y54 A;  4ZJS A;  2XQ8 A;  5AFK A;  4XK9 A;  4UM3 A;  3ZKR A;  5HCM A;  2XQ3 A;  2WNC A;  2Y56 A;  2VL0 A;  5BRX A;  4D01 A;  4F8H A;  5AFH A;  3P50 A;  3WTJ A;  3WTK A;  3JAD A;  4NPP A;  4UM3 S;  2Y58 A;  4QH4 A;  4ZZC A;  5HEJ A;  4X5T A;  2X00 D;  5AFJ A;  5JME A;  2W8G A;  3WTM A;  4IRE A;  4HFI A;  2X00 A;  3SH1 A;  4HFE A;  5AFN A;  2BYS A;  3U8J A;  4Z91 A;  4ZJT A;  3PMZ A;  2Y57 A;  4TWH A;  2BYR A;  2BG9 B;  3C79 A;  4HQP A;  4EZ1 A;  4TWD A;  4A98 A;  5BP0 A;  5BW2 A;  4ILA A;  4WV9 A;  3TLW A;  4BFQ A;  4QAB A;  4HFH A;  2YOE A;  4COF A;  2YME A;  5J5I A;  4XHE A;  4AFG A;  2BG9 E;  5J5F A;  2BG9 C;  2XNV A;  3TLU A;  3TLT A;  3UU5 A;  5HEG A;  4FRR A;  5SYO A;  1UV6 A;  2XYT A;  3UUB A;  3P4W A;  3UU3 A;  2W8F A;  4HFD A;  3U8L A;  5L47 A;  2BYN A;  3WTI A;  5HEU A;  4ZK4 A;  3UU8 A;  3TLS A;  4PIR A;  4DBM A;  2XQ5 A;  2PGZ A;  4AFT A;  2YMD A;  4ZK1 A;  3EHZ A;  2BYQ A;  5FJV A;  2BR7 A;  3GUA A;  5CFB A;  4IL9 A;  3IGQ A;  3TLV A;  3JAE A;  4AFH A;  4Z90 A;  5HEO A;  5KE4 A;  3LSV A;  4ILB A;  2BYP A;  4ILC A;  2XYS A;  4IL4 A;  5L4H A;  3SQ9 A;  2QC1 B;  3U8K A;  4BQT A;  3ZDH A;  4UXU A;  2WN9 A;  3U8M A;  2YN6 A;  4ZRU A;  5TVC A;  4UM3 P;  4B5D A;  3UQ7 A;  3EI0 A;  4UY2 A;  2XZ6 A;  5CO5 A;  3RIF A;  3RIA A;  5HEH A;  3WIP A;  3WTO A;  5AFL A;  3RQW A;  4NZB A;  2PH9 A;  5L4E A;  3WTN A;  3ZDG A;  5HCJ A;  5J0Z A;  2XQ7 A;  4TNW A;  3RI5 A;  5J5H A;  4LMK A;  2XQ6 A;  2XNT A; 
#chains in the Genus database with same CATH topology
 5LG3 A;  2WNJ A;  1UX2 A;  2WZY A;  3JAF A;  4QAA A;  2Y7Y A;  5LXB A;  3UU4 A;  2BR8 A;  2UZ6 A;  4TNV A;  3T4M A;  4HFC A;  3UU6 A;  3UQ4 A;  4LML A;  4QAC A;  4ALX A;  4ZR6 A;  5AFM A;  1UW6 A;  3WTH A;  2WNL A;  2XZ5 A;  2XQA A;  4TWF A;  3SIO A;  4ZZB A;  2XQ9 A;  2XQ4 A;  3SQ6 A;  5IUX A;  2ZJU A;  4A97 A;  3PEO A;  4QH1 A;  5AIN A;  5AFM B;  2YKS A;  3WTL A;  2BG9 A;  2C9T A;  3RHW A;  5KZU A;  3RQU A;  2XNU A;  5J5G A;  4LMJ A;  3U8N A;  4UM1 A;  3C84 A;  4HFB A;  1I9B A;  3EAM A;  2BJ0 A;  2ZJV A;  4QH5 A;  2Y54 A;  4ZJS A;  2XQ8 A;  5AFK A;  4XK9 A;  4UM3 A;  3ZKR A;  5HCM A;  2XQ3 A;  2WNC A;  2Y56 A;  2VL0 A;  5BRX A;  4D01 A;  4F8H A;  5AFH A;  3P50 A;  3WTJ A;  3WTK A;  3JAD A;  4NPP A;  4UM3 S;  2Y58 A;  4QH4 A;  4ZZC A;  5HEJ A;  4X5T A;  2X00 D;  5AFJ A;  5JME A;  2W8G A;  3WTM A;  4IRE A;  4HFI A;  2X00 A;  3SH1 A;  4HFE A;  5AFN A;  2BYS A;  3U8J A;  4Z91 A;  4ZJT A;  3PMZ A;  2Y57 A;  4TWH A;  2BYR A;  2BG9 B;  3C79 A;  4HQP A;  4EZ1 A;  4TWD A;  4A98 A;  5BP0 A;  5BW2 A;  4ILA A;  4WV9 A;  3TLW A;  4BFQ A;  4QAB A;  4HFH A;  2YOE A;  4COF A;  2YME A;  5J5I A;  4XHE A;  4AFG A;  2BG9 E;  5J5F A;  2BG9 C;  2XNV A;  3TLU A;  3TLT A;  3UU5 A;  5HEG A;  4FRR A;  5SYO A;  1UV6 A;  2XYT A;  3UUB A;  3P4W A;  3UU3 A;  2W8F A;  4HFD A;  3U8L A;  5L47 A;  2BYN A;  3WTI A;  5HEU A;  4ZK4 A;  3UU8 A;  3TLS A;  4PIR A;  4DBM A;  2XQ5 A;  2PGZ A;  4AFT A;  2YMD A;  4ZK1 A;  3EHZ A;  2BYQ A;  5FJV A;  2BR7 A;  3GUA A;  5CFB A;  4IL9 A;  3IGQ A;  3TLV A;  3JAE A;  4AFH A;  4Z90 A;  5HEO A;  5KE4 A;  3LSV A;  4ILB A;  2BYP A;  4ILC A;  2XYS A;  4IL4 A;  5L4H A;  3SQ9 A;  2QC1 B;  3U8K A;  4BQT A;  3ZDH A;  4UXU A;  2WN9 A;  3U8M A;  2YN6 A;  4ZRU A;  5TVC A;  4UM3 P;  4B5D A;  3UQ7 A;  3EI0 A;  4UY2 A;  2XZ6 A;  5CO5 A;  3RIF A;  3RIA A;  5HEH A;  3WIP A;  3WTO A;  5AFL A;  3RQW A;  4NZB A;  2PH9 A;  5L4E A;  3WTN A;  3ZDG A;  5HCJ A;  5J0Z A;  2XQ7 A;  4TNW A;  3RI5 A;  5J5H A;  4LMK A;  2XQ6 A;  2XNT A; 
#chains in the Genus database with same CATH homology
 5LG3 A;  2WNJ A;  1UX2 A;  2WZY A;  3JAF A;  4QAA A;  2Y7Y A;  5LXB A;  3UU4 A;  2BR8 A;  2UZ6 A;  4TNV A;  3T4M A;  4HFC A;  3UU6 A;  3UQ4 A;  4LML A;  4QAC A;  4ALX A;  4ZR6 A;  5AFM A;  1UW6 A;  3WTH A;  2WNL A;  2XZ5 A;  2XQA A;  4TWF A;  3SIO A;  4ZZB A;  2XQ9 A;  2XQ4 A;  3SQ6 A;  5IUX A;  2ZJU A;  4A97 A;  3PEO A;  4QH1 A;  5AIN A;  5AFM B;  2YKS A;  3WTL A;  2BG9 A;  2C9T A;  3RHW A;  5KZU A;  3RQU A;  2XNU A;  5J5G A;  4LMJ A;  3U8N A;  4UM1 A;  3C84 A;  4HFB A;  1I9B A;  3EAM A;  2BJ0 A;  2ZJV A;  4QH5 A;  2Y54 A;  4ZJS A;  2XQ8 A;  5AFK A;  4XK9 A;  4UM3 A;  3ZKR A;  5HCM A;  2XQ3 A;  2WNC A;  2Y56 A;  2VL0 A;  5BRX A;  4D01 A;  4F8H A;  5AFH A;  3P50 A;  3WTJ A;  3WTK A;  3JAD A;  4NPP A;  4UM3 S;  2Y58 A;  4QH4 A;  4ZZC A;  5HEJ A;  4X5T A;  2X00 D;  5AFJ A;  5JME A;  2W8G A;  3WTM A;  4IRE A;  4HFI A;  2X00 A;  3SH1 A;  4HFE A;  5AFN A;  2BYS A;  3U8J A;  4Z91 A;  4ZJT A;  3PMZ A;  2Y57 A;  4TWH A;  2BYR A;  2BG9 B;  3C79 A;  4HQP A;  4EZ1 A;  4TWD A;  4A98 A;  5BP0 A;  5BW2 A;  4ILA A;  4WV9 A;  3TLW A;  4BFQ A;  4QAB A;  4HFH A;  2YOE A;  4COF A;  2YME A;  5J5I A;  4XHE A;  4AFG A;  2BG9 E;  5J5F A;  2BG9 C;  2XNV A;  3TLU A;  3TLT A;  3UU5 A;  5HEG A;  4FRR A;  5SYO A;  1UV6 A;  2XYT A;  3UUB A;  3P4W A;  3UU3 A;  2W8F A;  4HFD A;  3U8L A;  5L47 A;  2BYN A;  3WTI A;  5HEU A;  4ZK4 A;  3UU8 A;  3TLS A;  4PIR A;  4DBM A;  2XQ5 A;  2PGZ A;  4AFT A;  2YMD A;  4ZK1 A;  3EHZ A;  2BYQ A;  5FJV A;  2BR7 A;  3GUA A;  5CFB A;  4IL9 A;  3IGQ A;  3TLV A;  3JAE A;  4AFH A;  4Z90 A;  5HEO A;  5KE4 A;  3LSV A;  4ILB A;  2BYP A;  4ILC A;  2XYS A;  4IL4 A;  5L4H A;  3SQ9 A;  2QC1 B;  3U8K A;  4BQT A;  3ZDH A;  4UXU A;  2WN9 A;  3U8M A;  2YN6 A;  4ZRU A;  5TVC A;  4UM3 P;  4B5D A;  3UQ7 A;  3EI0 A;  4UY2 A;  2XZ6 A;  5CO5 A;  3RIF A;  3RIA A;  5HEH A;  3WIP A;  3WTO A;  5AFL A;  3RQW A;  4NZB A;  2PH9 A;  5L4E A;  3WTN A;  3ZDG A;  5HCJ A;  5J0Z A;  2XQ7 A;  4TNW A;  3RI5 A;  5J5H A;  4LMK A;  2XQ6 A;  2XNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...