4QH1A

The glic pentameric ligand-gated ion channel (wild-type) in complex with bromoacetate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh1A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh1A01
3RQUA 2BG9B 2XZ6A 2BR7A 3TLWA 3UU4A 2XZ5A 4QH4A 3UU6A 2ZJUA 4ZRUA 2YMEA 3WTIA 4ZZCA 5AFJA 2WNLA 5TVCA 4ILCA 4Z91A 5L47A 5JMEA 4A98A 3TLUA 3UQ7A 2XQ8A 2X00D 2WZYA 2X00A 3P50A 5KE4A 2Y57A 3GUAA 3EAMA 4BFQA 4ZR6A 3WIPA 3RIFA 4AFGA 3P4WA 2Y54A 5AFMB 3JAEA 4HFHA 4TWFA 3U8MA 4NPPA 1OEDC 3SIOA 2BG9C 5AFHA 2UZ6A 3TLVA 2M6IA 5LXBA 5L4EA 2MAWA 2WN9A 5J5FA 2BG9A 2XNTA 2WNCA 4UM3P 2KSRA 4IREA 3ZKRA 5AFMA 2XYSA 2Y58A 4ZJTA 3T4MA 3RIAA 2BYNA 4PIRA 5BRXA 2PGZA 3IGQA 3ZDHA 2BYRA 2C9TA 4ALXA 4B5DA 5L4HA 4X5TA 2XYTA 2ZJVA 2Y7YA 3WTMA 4DBMA 4ILAA 5AFKA 2YOEA 4A97A 5BW2A 5SYOA 2BJ0A 5HEJA 5AFNA 4F8HA 5HEUA 3WTKA 2M6BA 3C79A 3TLTA 3RQWA 5HEHA 4HFBA 5BP0A 4UM1A 2BR8A 4NZBA 2XQ9A 4LMLA 2LKGA 2QC1B 1I9BA 4QABA 3UU3A 4HQPA 4AFHA 2YKSA 2XQ5A 4HFEA 5AINA 1UX2A 2XQ6A 4IL9A 5J5IA 3UUBA 5HCJA 2VL0A 3RHWA 4UM3A 5J0ZA 3UU8A 3SH1A 4ZK4A 2W8GA 3RI5A 1UV6A 2PH9A 4EZ1A 1OEDE 2BG9E 2XQ3A 2WNJA 3UQ4A 3TLSA 3EI0A 3JAFA 5CFBA 3EHZA 2XNUA 3WTLA 5HEOA 2BYQA 4ZK1A 4TNWA 5HEGA 1OEDA 2YN6A 5LG3A 5CO5A 4QAAA 5HCMA 4IL4A 4Z90A 3C84A 3WTNA 4ZZBA 3U8NA 4HFCA 3WTOA 5AFLA 4ZJSA 3SQ6A 4FRRA 4WV9A 4LMKA 4LMJA 2LM2A 2XQAA 5J5HA 3ZDGA 4D01A 4QH5A 1OEDB 2Y56A 2XQ7A 4HFIA 4UY2A 4BQTA 4COFA 2XQ4A 4QACA 4UM3S 2BYPA 3U8LA 3JADA 3WTHA 3UU5A 2LLYA 2BYSA 4AFTA 4XHEA 5IUXA 4QH1A 4TNVA 1UW6A 5FJVA 5J5GA 3U8JA 3PMZA 2W8FA 2LKHA 4XK9A 2YMDA 4TWHA 3PEOA 4UXUA 3WTJA 2XNVA 3SQ9A 3U8KA 4HFDA 4TWDA 4ILBA 3LSVA 5KZUA
chains in the Genus database with same CATH superfamily
5GONE 2IC6A 4ZZCA 5L47A 4ILUA 3TLUA 4B3RT 4QXBB 2XJ7A 3MK7C 5JRCA 2HN1A 5FY0A 2M67A 2WDVA 3B5MA 1KK7A 3AEBA 2CMRA 4ERRA 2WNCA 4G63A 4PJLA 2WU2A 2XYSA 1X9BA 3RIAA 3RYFE 1Y64B 4WBOA 3WTMA 1IAPA 2CWYA 5HEUA 2M6BA 4P09A 3C79A 5AQIB 5BP0A 4LFCT 3RC3A 3ETUA 4L0RA 2WBLA 3ZMZB 4JBWF 3ZMUB 4PK5A 2PTFA 4UXNB 2V7LA 4HE8A 1I94T 3RIUC 4MBQA 3ZYMA 1HG5A 4HWIB 5FVLA 2BZBA 1U4QA 2C5JA 5KMGP 4ZZBA 4H9NC 1E1HB 4CN1A 1SA0E 1CHUA 1MIWA 5J5HA 2SPCA 4QH5A 3VR9A 4COFA 5ABEA 5LHGB 2B76A 2W0GA 3L3PA 1YD8G 2BYSA 2K48A 3OYZA 4YFSA 3BQLA 3ZCJA 5BR8T 4UXUA 4AKLA 4IE0A 4ILBA 3ZMTB 5IHYA 4PNIA 3UU4A 2HN2A 3CMLA 4DUYT 2IDOB 3MJXA 1SHZC 4LFBT 3ZC0A 2JIWA 1WFDA 4A5XA 2WAUA 1HX1B 5AQRB 3N9LA 2XUEA 3NWIA 3CKDA 2ZM8A 2ZJVA 4ILAA 4KI0F 5SYOA 4F8HA 4IGUA 5LMNT 3N9MA 2VL8A 1T7SA 4GYSA 4TN7B 2CWOA 2XQ5A 3R6NA 4HWFA 2WDRA 3GMIA 4N78D 4PJJA 1UV6A 3LK3B 4EZ1A 2XQ3A 4GYRA 3RLFF 3TLSA 3OTOT 5LXTE 4ZK1A 5ABGA 2YINA 4O4LE 2DHRA 3ZYLA 4X62T 1GQEA 4CXXA 2LSIA 3AECA 3EVYA 1EZ3A 3JADA 3PTRB 3UU5A 5HXHA 2LM9A 1ZP0A 2D0UA 2UUCT 1WLXA 4DBQA 1VOMA 4AI6A 4CI1B 3U8KA 3Q2MA 2V7JA 3KBTA 4TZ4C 2ODVA 5AQSB 4QHOA 2B1EA 3CX7B 5HXSA 2Q9QA 4JI1T 5JMEA 3UQ7A 3FBLA 3Q9DA 5LGUB 3OYXA 3HKDE 3JAEA 5ABFA 3PUSA 2NW7A 3U8MA 2WP9A 3EABA 2E8IA 5AFHA 2AXDS 5L3FB 3BQKA 1ZHCA 2X9HA 1LVFA 1W09A 2GK9A 2JMKA 2W62A 1ZEEA 2KLQA 2Y6XA 2LSKA 2D0TA 1X79A 3B57A 1UX2A 4GKJT 2HHHT 3ZT5A 5J5IA 3O1IA 1Z0PA 3SRZA 2LE8A 2I6HA 4ZI2D 3ZPOA 3SOLA 2CBJA 2LOSA 3C4ZA 5CB4E 3ZMSB 4UELA 2FUPA 4UVBB 5HCMA 2V8SV 2IHR1 3FXEB 2JQHA 3LBXA 3PURA 1UUSA 3VHLA 3O4XE 2V26A 2RP4A 4QX8B 4YY3T 4K0KT 2XNVA 2CRBA 4AQYT 4NXNT 5L3CB 3IEEA 2W8GA 4AQFA 3L39A 5JDQA 2Y8DA 5KDMC 4Z91A 3ZCIA 2KXPB 2WZYA 2XQ8A 3AVSA 3KVBA 4HWHA 2BVLA 2J4GA 3QB5A 4UR9A 3RIFA 3P4WA 2PBIA 4NPPA 1XZYA 2UZ6A 4EB6E 4CN4A 3FZFB 3T4MA 2OLTA 2XASB 4IDOA 2NWBA 3ZLIA 4OK0A 4YTMA 5EK3A 2VQFT 1BR1A 2ZLYA 5HEJA 5ETWA 5AQQB 5L2LA 5F8PA 2BR8A 2D2SA 2DWKA 4QABA 2HPJA 4HTEA 5HXEA 4JLEA 1JNRA 1IBKT 2W61A 2RPAA 3K3QC 2XAQB 5CGMA 3RX6A 4UEMA 2WWVA 5CFBA 4AKGA 1BR4A 4C90A 4UV8B 1HX8A 2NW9A 2OA5A 2EHOA 5LP6E 2W00A 3C84A 4HKAA 2CBIA 3Q5WA 2XAHB 4MFRA 5LCYA 3N9QA 4YT0A 1HFAA 5FJVA 4ZXLA 3NRYA 4IDPA 3ONJA 3ZJ2A 4QWNB 2DWGA 4A98A 2X00D 3VRAA 2X9WA 5FMNA 2QYWA 4HEAA 2A3DA 2V7KA 4ZI7E 3AE1A 4H9PC 2BG9A 4LF7T 4MALA 2X9YA 4ZS3A 4ZJTA 2C5IT 2LEHA 1QSDA 4ALXA 4CQIA 1D1BA 3P7IA 2DLRA 5EK4A 3MXZA 4ADZA 1YKEB 4B3TT 5JDMA 4HFEA 2X0YA 4UV9B 4IDNA 4KHZF 2VL0A 4PFPA 4ZK4A 2PJQA 2LOPA 3ZSTA 1OEDE 1W9RA 5DQVA 4EV6A 4BJMA 3RKGA 5DABA 2IW5B 2E9XC 3PU8A 4B3ST 3ZDGA 2N1GA 2BS2A 3E08A 3PUQA 5LGNB 4DVDA 3WTHA 2WS3A 5LJNA 3JCFA 3CQXC 3P8CD 1MMDA 5F5WA 1R8IA 3AE4A 3M65A 5AQFB 5L3BB 3EHZA 2XSAA 2MOZA 2H3RA 4MHCA 3UU6A 5AFJA 4ILCA 2UXXB 1UURA 2WCAA 1J5WA 3FZHB 3C98B 3H3AA 3HL6A 2WSSV 3P50A 2Y57A 4AFGA 2H88A 4YJ3E 2YU2A 3HR0A 3AEGA 1HNXT 5CA1E 1N34T 1YXRA 4H9QC 4JI4T 2C0SA 4X1IE 1XMOT 2CM0A 2PGZA 2YDRA 3IGQA 2BYRA 3ZDHA 1NENA 3AA0B 4B5DA 5AFKA 3RIUA 3RRWA 3ZC1A 3TLTA 3AA7B 3GWHA 1MMNA 1BR2A 1V9DA 4ASKA 4EYUA 3UUMA 2XQ6A 5H6RB 1WR6A 5HCJA 3RHWA 5J2UE 1S94A 4DV7T 2YEVC 3OBVE 3RKOA 3WTLA 1US7B 4DV2T 4EEDA 4TNWA 4V1Av 4BJNA 3WTNA 1XMQT 4FRRA 2LSJA 3LK2B 3UUXB 2I0MA 2J47A 4QH1A 3UFGA 4TNVA 5L3GB 5LB7B 3AB3B 3FZKB 3AXJB 4H63H 2VWAA 4O4IE 5AQJB 1HF8A 4LF9T 3WTJA 2F4VT 2H7VC 2Z6EA 3HKEE 3P4SA 4Z8XA 3PUYF 5AQTB 3ZEFB 2X00A 4TX5A 3EAMA 3ZJ1A 5LBQB 4DR5T 2VKOA 4O4JE 2BG9C 4X64T 5L4EA 5C3JA 2WDQA 2WM9A 4KHPT 4JI7T 2LHRA 3A5XA 3EDVA 2C9TA 5FXZA 2MBGA 1QLBA 4AIUA 3PUGA 3ZT7A 2LKGA 4DR3T 4ZOLE 5AINA 3UUBA 3C64A 3QK6A 5EZYE 3SH1A 3K3NA 2VVNA 4WNKA 2ACZA 4X1KE 2VB6A 4CN6A 1AJ3A 2LRLA 4F6RC 5HEGA 2KNDA 5JH7E 1XWMA 4H63V 2K24A 2LM2A 3K8PC 2OV9A 4ZS2A 4MLKA 4NXMT 2JQKA 4LF5T 1HS7A 3CK6A 5DJQC 5LNKA 4X20E 5HXRA 2QRXA 4JI0T 5FXVA 1D0XA 2C5KT 5BMVE 2XY8B 2BR7A 4XBFB 2A9UA 2X51A 2E5LT 3GN5A 1DU2A 5FL0A 2NTXA 3AAEB 5LMUT 3GUAA 3HI2A 3W15B 5AFMB 4TWFA 4OYKA 3SIOA 4WW0A 4FJOA 3KBUA 5LXBA 4OHFA 5LHHB 3VKHA 3PUXF 2J62A 3AEEA 4FI5A 4IDQA 4IE7A 3LJCA 4JI2T 4PIRA 2DCFA 2LJLA 3ANWA 3VKGA 4DBMA 3N9OA 3CX8B 2R6GF 4U31A 2NW8A 4UM1A 4NZBA 4AQFC 5JDNA 5LA6E 3HA4A 2DNXA 5J0ZA 4OYJA 3PJAJ 3UQ4A 5LHIB 3EI0A 2CXFA 4A56A 2XSBA 4XAXB 2V6YA 2XM2A 4DBRA 3UULA 3AAIA 4ZI2C 2QVAA 2W66A 4LMJA 5H6QB 4IE4A 4U7YA 2BYPA 3U8LA 4AFTA 4IE6A 1KNPA 2MTQA 4UIGA 3U3IA 2XM1A 2W63A 3PUAA 2CE7A 4TWDA 3RQUA 1LVKA 3NRXA 4U33A 1Y01A 4ZRUA 3V5SA 4IE5A 3K1SA 2X66A 3F31A 3I1AA 2H7OA 3L09A 2IIUA 2RA1A 4ZR6A 4DMVA 4ZEYA 4YTPA 2X0LB 3AEAA 5LOVE 1SE7A 3T1YT 2VKDA 2JJ9A 3I0QA 3LBXB 1IZNB 2VK9A 4P0AA 1IBMT 2XYTA 2A72A 4GOUA 5AQPB 2PG8A 2Q9QC 1HNZT 5AQUB 4AKHA 3LDQB 1FMVA 3WAJA 2WWUA 4AFHA 4TV9E 1I6ZA 2UUBT 4KUMB 3UU8A 3CQCB 3KV9A 2V1DB 2BG9E 2ES0A 2DI4A 5IWAT 3PDYA 3PUZF 4NUUA 2CLYC 2CXLA 2YN6A 4ZI3C 3AE7A 2KMFA 2Q9QD 4EZ4A 3RYIE 3VRBA 1N33T 4ZJSA 2XQAA 3IBPA 1OEDB 4DR7T 3AE2A 1T8BA 2V7IA 1UGOA 1ZV4X 3B13A 5ABFB 5AQGB 4GIWA 3EUHA 2WMNA 1KNZA 5JREA 4XK9A 4TWHA 3SQ9A 4U72A 2BVMA 3G06A 2BG9B 2XZ6A 4HN9A 4O2BE 3ZYKA 1S35A 3E22E 1WYCA 2IUBA 4U2YA 3EDUA 3WIPA 3O9XA 2Y54A 4HFHA 4PJNA 1OEDC 4U74A 2YU1A 3TLVA 2M6IA 2CPTA 3T8OA 2Y48B 2JRKA 3OJAA 3ZKRA 4EOZB 1UX4A 3N5LA 4H9RC 5FVKA 1QUUA 1D0YA 2E9XB 4UF0A 2VASA 3F57A 3UU3A 2YKSA 4OX9T 2EHOD 2V7MA 3VU7H 3FZLB 5M4YA 2ZM2A 2BKOA 4I50E 3FXDB 2ZMAA 4H9SE 1G73A 3AA6B 5LG3A 5CO5A 3WI3A 4O4HE 3JC6D 2UXCT 4E7SA 5AQNB 4D01A 1Z8UA 3PUVF 2NR4A 1B7TA 5HWXA 1M62A 3GN5B 1HTJF 3NKZA 4ANJA 5DQWA 1MMAA 4EEBA 4GKKT 4DR2T 1SUMB 2E2AA 3ANWB 4J2CA 3Q5DA 1BR0A 4AISA 4L9IA 4YHHT 4UF0B 2YMEA 1J1JA 2X67A 3HKCE 4ISTA 1FJGT 3MZKB 2KINB 3AE3A 4X66T 2ZM6T 3PV0F 3NBXX 1E2AA 4AQGA 4YSZA 2K5BB 2V5DA 1FMWA 2MAWA 4I4TE 2K9AA 4UM3P 1MIVA 2KWIB 1W0BA 2IAKA 3AA1B 2BKPA 2G0UA 4KBMB 4DUZT 4DV5T 3UFEA 4H9OC 3AEDA 5LGTB 2KT9A 2JQQA 5FP3A 1WR0A 4PW8A 1G8XA 2UXNB 1MNEA 2XQ9A 4XZCA 4HQPA 3IHRA 4DV6T 3C4XA 3K3OA 4DV3T 4CI2B 2PH9A 1KNRA 5JTGA 2XNUA 1NEKA 3MACA 3QC9A 4HGAA 5AQVB 2YDSA 4QAAA 3R84B 4IL4A 5FY1A 3J7Yq 2BKNA 5LG4A 5JDFA 4I0UA 5TAOA 1ZOYA 3H3MA 3RC8A 4EYYR 4HFIA 4JYAT 4ZI3D 3E0ZA 2LSGA 2ACXA 2MPKA 4QXHB 1E7PA 5L3EB 2WB5A 4JI3T 3U8JA 2YMDA 4CZZB 2UU9T 1KF6A 4HFDA 5JVDE 4CXWA 5KZUA 3MKDA 5ADXL 1T72A 2ZJUA 3WTIA 5TVCA 2V5CA 3RYCE 1T98A 5JQGE 3QNUA 3CPZA 1YKHB 5KE4A 4BFQA 1CUNA 2FJEA 3PJAA 5FYMA 2UXBT 4JEHB 3X1DA 4I55E 3ZN0B 5AQHB 5J5FA 2D9DA 3C4WA 4AXPA 4AKIA 4IREA 1VCSA 1O3XA 3AE9A 4YXDA 5L4HA 4KMCA 2YOEA 4A97A 2BBJA 3ONLC 3RRCA 3AAAB 2JQ9A 4L5GA 3A7MA 3JC6C 4DR1T 4JUYA 3L8RA 3P4RA 2A2FX 1WYBA 5E0OA 4M1PA 4EGWA 1FIOA 1KEYA 4E7ZA 2PFVA 4BAYB 4PK6A 2JMHA 1OEDA 1OWAA 3HKBE 3LFMA 2EHOC 3DJBA 3ZT6A 5JDGA 3AE8A 4HFCA 2ODUA 5HAXA 3F2EA 4DV4T 4U3CA 1WRDA 2XQ4A 3J9X1 3S4UA 5LJMA 2XAJB 4XHEA 3KDSE 5HYAA 4YTNA 3ESLA 2L8KA 4Q25A 5FL1A 2KWHA 2CEAA 2W2UA 5LBMA 3TLWA 2XZ5A 2NP9A 2JPFA 2LT3A 1XDOA 3MA9A 1IJ5A 1LRZA 4CXYA 2BS3A 2E5VA 4OFZA 3FBZA 1VRBA 4AKRB 1XNRT 3T1HT 5AFMA 2Y58A 5J2TE 2YK0A 2VKHA 2VKJA 5KXJA 3NZPA 2UXDT 3WTKA 4IT4A 2D5UA 2UUAT 4YSYA 5AFUL 5FKYA 4TV8E 2XTLA 2H89A 2X9XA 4IL9A 4P1NA 5ABHA 1H7CA 3OKQA 3N9PA 4NUVA 4WYVA 3KVAA 2BDEA 2XQYA 4G2AA 4DMWA 4ISSA 2I59A 2W4XA 4DNDA 4BA9A 4GK5E 2HH7A 2WZIA 5LYJE 2CLYB 5FNVE 3AE5A 5AFLA 1UCUA 4I43B 3SFEA 5F3JA 2XQ7A 4HWCA 4BQTA 4QACA 2QA7A 2X68A 5AQKB 3RYHE 1XDPA 2LHNA 2VVSA 4KP3C 3PMZA 3UTKA 2W8FA 4LFAT 5HXCA 3UT5E 3DP7A 3SWHA 1D1CA 4QKNA 2LSYA 2VURA 4QH4A 3SS1A 2WNLA 3IA3A 3PE0A 5JR9B 3N2OA 3KINB 3O1HA 3N2GE 4EZHA 2YDQA 2XAFB 1WCRA 2IMLA 4LF8T 4YJ2E 5CA0E 3CX6B 5JR9A 2V6YB 2EHOB 3AVRA 4LF6T 3FB2A 2WN9A 3ZMVB 2LRKA 3PUWF 1HNWT 2WY2A 3KV5A 4DO0A 1W0AA 4PK4A 4UVAB 2BS4A 4X5TA 2Y7YA 4PJMA 3UUNA 5BW2A 2BJ0A 3AE6A 2IC9A 3RQWA 4HFBA 2FBWA 1D0ZA 4LMLA 3V5UA 3DTOA 3CIRA 2NTYA 2BBHA 3RF1A 3LK42 4B3MT 2WNJA 5AQOB 4QXCB 4O8SA 2L3LA 4JI6T 3P4QA 4NIQA 4LF4T 3ZSSA 5CJ5A 4JV5T 1U5PA 5A1LA 5HWYA 3RH3A 3WTOA 4HFVA 3SQ6A 4WV9A 4JI8T 5AQMB 1XNQT 3NZQA 4UY2A 2AE9A 4UM3S 1HCIA 5JDLA 2ZM0A 2LLYA 1N36T 1YQ4A 2LKHA 1NAFA 5J5GA 5JDHA 5AQLB 2WQYA 3PU3A 2WZHA 1ZKEA 2MYSA 3OVUA 1HR0T 4WBNE 5JRCB 4DIDB 3QUJA 3KV6A 2QGSA 4EIWA 1M7KA 4YLHA 3M3ZB 2NOXA 3AEFA 3KFWX 2XNTA 4X65T 4TUYE 1JNZA 4P0BA 4EXTA 5C2TA 5C8YE 1MIYA 3QB5K 5KX5E 2CA5A 1IBLT 1HG2A 4DR4T 1J5ET 2QC1B 5FY7A 2HPLA 3D0TA 1YW0A 1L0VA 2WMOA 1MNDA 3C51A 5FXXA 2FJBA 3I9WA 3AXJA 3TKLB 2CHNA 4U2ZA 2KZ7B 3RI5A 3I0OA 4O2AE 4PAGA 4C91A 2FJDA 4DV0T 3JAFA 2BYQA 3ZN1B 3N9NA 4X1YE 3P4PA 2E9XA 3LG7A 4UVCB 2N2NA 4Z90A 5IYZE 2CXDA 3Q5EA 4YSXA 1LKXA 3RGLA 5JR9C 4JI5T 3OPCA 2Q9QB 3WAKA 4DV1T 1D1AA 1YQ3A 1OXZA 5IUXA 4GK0E 1UW6A 2W67A 5FXWA 1IJ6A 3CWZB 3PEOA 5J1GA 3C50A 3LSVA 2WU5A 4KX6A 3FHNA 3GA8A 1FEWA 2V6XA 2N9DA 2XPKA 2VQET 3N2KE 1UK5A 1MMGA 3KV4A 3BQIA 2KSRA 4YHJA 2BYNA 3QOFA 5BRXA 4B6XA 4DR6T 1UX5A 2XZEA 3BK9A 4IHJE 4PFOA 5AFNA 2CCQA 4HWDA 2P9BA 5HEHA 1VCTA 3A8YC 4QX7B 3Q5XA 1I9BA 3VR8A 4WZXA 4UM3A 3O1JA 2E9XD 3I9YA 4K0UA 3NVOA 3CVRA 3ONXA 2FJAA 4CI3B 5HEOA 1NWMX 2J1DG 2L9QA 4EAHA 3SFDA 3U8NA 5EK2A 3RPUA 1N32T 4LMKA 4IIJE 5L3DB 2XAGB 2Y56A 3IF8B 2DL1A 4U7IA 3ETVA 4JEUB 2CHOA 2K3WA 3H37A 4IDZA 3ABVA 3CQGB 3U78A 4ZHQE 3FZMB 2X0HA 1KFYA 2XHEB
chains in the Genus database with same CATH topology
3RQUA 2BG9B 2XZ6A 2BR7A 3TLWA 3UU4A 2XZ5A 4QH4A 3UU6A 2ZJUA 4ZRUA 2YMEA 3WTIA 4ZZCA 5AFJA 2WNLA 5TVCA 4ILCA 4Z91A 5L47A 5JMEA 4A98A 3TLUA 3UQ7A 2XQ8A 2X00D 2WZYA 2X00A 3P50A 5KE4A 2Y57A 3GUAA 3EAMA 4BFQA 4ZR6A 3WIPA 3RIFA 4AFGA 3P4WA 2Y54A 5AFMB 3JAEA 4HFHA 4TWFA 3U8MA 4NPPA 1OEDC 3SIOA 2BG9C 5AFHA 2UZ6A 3TLVA 2M6IA 5LXBA 5L4EA 2MAWA 2WN9A 5J5FA 2BG9A 2XNTA 2WNCA 4UM3P 2KSRA 4IREA 3ZKRA 5AFMA 2XYSA 2Y58A 4ZJTA 3T4MA 3RIAA 2BYNA 4PIRA 5BRXA 2PGZA 3IGQA 3ZDHA 2BYRA 2C9TA 4ALXA 4B5DA 5L4HA 4X5TA 2XYTA 2ZJVA 2Y7YA 3WTMA 4DBMA 4ILAA 5AFKA 2YOEA 4A97A 5BW2A 5SYOA 2BJ0A 5HEJA 5AFNA 4F8HA 5HEUA 3WTKA 2M6BA 3C79A 3TLTA 3RQWA 5HEHA 4HFBA 5BP0A 4UM1A 2BR8A 4NZBA 2XQ9A 4LMLA 2LKGA 2QC1B 1I9BA 4QABA 3UU3A 4HQPA 4AFHA 2YKSA 2XQ5A 4HFEA 5AINA 1UX2A 2XQ6A 4IL9A 5J5IA 3UUBA 5HCJA 2VL0A 3RHWA 4UM3A 5J0ZA 3UU8A 3SH1A 4ZK4A 2W8GA 3RI5A 1UV6A 2PH9A 4EZ1A 1OEDE 2BG9E 2XQ3A 2WNJA 3UQ4A 3TLSA 3EI0A 3JAFA 5CFBA 3EHZA 2XNUA 3WTLA 5HEOA 2BYQA 4ZK1A 4TNWA 5HEGA 1OEDA 2YN6A 5LG3A 5CO5A 4QAAA 5HCMA 4IL4A 4Z90A 3C84A 3WTNA 4ZZBA 3U8NA 4HFCA 3WTOA 5AFLA 4ZJSA 3SQ6A 4FRRA 4WV9A 4LMKA 4LMJA 2LM2A 2XQAA 5J5HA 3ZDGA 4D01A 4QH5A 1OEDB 2Y56A 2XQ7A 4HFIA 4UY2A 4BQTA 4COFA 2XQ4A 4QACA 4UM3S 2BYPA 3U8LA 3JADA 3WTHA 3UU5A 2LLYA 2BYSA 4AFTA 4XHEA 5IUXA 4QH1A 4TNVA 1UW6A 5FJVA 5J5GA 3U8JA 3PMZA 2W8FA 2LKHA 4XK9A 2YMDA 4TWHA 3PEOA 4UXUA 3WTJA 2XNVA 3SQ9A 3U8KA 4HFDA 4TWDA 4ILBA 3LSVA 5KZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQU A;  2BG9 B;  2XZ6 A;  2BR7 A;  3TLW A;  3UU4 A;  2XZ5 A;  4QH4 A;  3UU6 A;  2ZJU A;  4ZRU A;  2YME A;  3WTI A;  4ZZC A;  5AFJ A;  2WNL A;  5TVC A;  4ILC A;  4Z91 A;  5L47 A;  5JME A;  4A98 A;  3TLU A;  3UQ7 A;  2XQ8 A;  2X00 D;  2WZY A;  2X00 A;  3P50 A;  5KE4 A;  2Y57 A;  3GUA A;  3EAM A;  4BFQ A;  4ZR6 A;  3WIP A;  3RIF A;  4AFG A;  3P4W A;  2Y54 A;  5AFM B;  3JAE A;  4HFH A;  4TWF A;  3U8M A;  4NPP A;  1OED C;  3SIO A;  2BG9 C;  5AFH A;  2UZ6 A;  3TLV A;  2M6I A;  5LXB A;  5L4E A;  2MAW A;  2WN9 A;  5J5F A;  2BG9 A;  2XNT A;  2WNC A;  4UM3 P;  2KSR A;  4IRE A;  3ZKR A;  5AFM A;  2XYS A;  2Y58 A;  4ZJT A;  3T4M A;  3RIA A;  2BYN A;  4PIR A;  5BRX A;  2PGZ A;  3IGQ A;  3ZDH A;  2BYR A;  2C9T A;  4ALX A;  4B5D A;  5L4H A;  4X5T A;  2XYT A;  2ZJV A;  2Y7Y A;  3WTM A;  4DBM A;  4ILA A;  5AFK A;  2YOE A;  4A97 A;  5BW2 A;  5SYO A;  2BJ0 A;  5HEJ A;  5AFN A;  4F8H A;  5HEU A;  3WTK A;  2M6B A;  3C79 A;  3TLT A;  3RQW A;  5HEH A;  4HFB A;  5BP0 A;  4UM1 A;  2BR8 A;  4NZB A;  2XQ9 A;  4LML A;  2LKG A;  2QC1 B;  1I9B A;  4QAB A;  3UU3 A;  4HQP A;  4AFH A;  2YKS A;  2XQ5 A;  4HFE A;  5AIN A;  1UX2 A;  2XQ6 A;  4IL9 A;  5J5I A;  3UUB A;  5HCJ A;  2VL0 A;  3RHW A;  4UM3 A;  5J0Z A;  3UU8 A;  3SH1 A;  4ZK4 A;  2W8G A;  3RI5 A;  1UV6 A;  2PH9 A;  4EZ1 A;  1OED E;  2BG9 E;  2XQ3 A;  2WNJ A;  3UQ4 A;  3TLS A;  3EI0 A;  3JAF A;  5CFB A;  3EHZ A;  2XNU A;  3WTL A;  5HEO A;  2BYQ A;  4ZK1 A;  4TNW A;  5HEG A;  1OED A;  2YN6 A;  5LG3 A;  5CO5 A;  4QAA A;  5HCM A;  4IL4 A;  4Z90 A;  3C84 A;  3WTN A;  4ZZB A;  3U8N A;  4HFC A;  3WTO A;  5AFL A;  4ZJS A;  3SQ6 A;  4FRR A;  4WV9 A;  4LMK A;  4LMJ A;  2LM2 A;  2XQA A;  5J5H A;  3ZDG A;  4D01 A;  4QH5 A;  1OED B;  2Y56 A;  2XQ7 A;  4HFI A;  4UY2 A;  4BQT A;  4COF A;  2XQ4 A;  4QAC A;  4UM3 S;  2BYP A;  3U8L A;  3JAD A;  3WTH A;  3UU5 A;  2LLY A;  2BYS A;  4AFT A;  4XHE A;  5IUX A;  4QH1 A;  4TNV A;  1UW6 A;  5FJV A;  5J5G A;  3U8J A;  3PMZ A;  2W8F A;  2LKH A;  4XK9 A;  2YMD A;  4TWH A;  3PEO A;  4UXU A;  3WTJ A;  2XNV A;  3SQ9 A;  3U8K A;  4HFD A;  4TWD A;  4ILB A;  3LSV A;  5KZU A; 
#chains in the Genus database with same CATH topology
 5GON E;  2IC6 A;  4ZZC A;  5L47 A;  4ILU A;  3TLU A;  4B3R T;  4QXB B;  2XJ7 A;  3MK7 C;  5JRC A;  2HN1 A;  5FY0 A;  2M67 A;  2WDV A;  3B5M A;  1KK7 A;  3AEB A;  2CMR A;  4ERR A;  2WNC A;  4G63 A;  4PJL A;  2WU2 A;  2XYS A;  1X9B A;  3RIA A;  3RYF E;  1Y64 B;  4WBO A;  3WTM A;  1IAP A;  2CWY A;  5HEU A;  2M6B A;  4P09 A;  3C79 A;  5AQI B;  5BP0 A;  4LFC T;  3RC3 A;  3ETU A;  4L0R A;  2WBL A;  3ZMZ B;  4JBW F;  3ZMU B;  4PK5 A;  2PTF A;  4UXN B;  2V7L A;  4HE8 A;  1I94 T;  3RIU C;  4MBQ A;  3ZYM A;  1HG5 A;  4HWI B;  5FVL A;  2BZB A;  1U4Q A;  2C5J A;  5KMG P;  4ZZB A;  4H9N C;  1E1H B;  4CN1 A;  1SA0 E;  1CHU A;  1MIW A;  5J5H A;  2SPC A;  4QH5 A;  3VR9 A;  4COF A;  5ABE A;  5LHG B;  2B76 A;  2W0G A;  3L3P A;  1YD8 G;  2BYS A;  2K48 A;  3OYZ A;  4YFS A;  3BQL A;  3ZCJ A;  5BR8 T;  4UXU A;  4AKL A;  4IE0 A;  4ILB A;  3ZMT B;  5IHY A;  4PNI A;  3UU4 A;  2HN2 A;  3CML A;  4DUY T;  2IDO B;  3MJX A;  1SHZ C;  4LFB T;  3ZC0 A;  2JIW A;  1WFD A;  4A5X A;  2WAU A;  1HX1 B;  5AQR B;  3N9L A;  2XUE A;  3NWI A;  3CKD A;  2ZM8 A;  2ZJV A;  4ILA A;  4KI0 F;  5SYO A;  4F8H A;  4IGU A;  5LMN T;  3N9M A;  2VL8 A;  1T7S A;  4GYS A;  4TN7 B;  2CWO A;  2XQ5 A;  3R6N A;  4HWF A;  2WDR A;  3GMI A;  4N78 D;  4PJJ A;  1UV6 A;  3LK3 B;  4EZ1 A;  2XQ3 A;  4GYR A;  3RLF F;  3TLS A;  3OTO T;  5LXT E;  4ZK1 A;  5ABG A;  2YIN A;  4O4L E;  2DHR A;  3ZYL A;  4X62 T;  1GQE A;  4CXX A;  2LSI A;  3AEC A;  3EVY A;  1EZ3 A;  3JAD A;  3PTR B;  3UU5 A;  5HXH A;  2LM9 A;  1ZP0 A;  2D0U A;  2UUC T;  1WLX A;  4DBQ A;  1VOM A;  4AI6 A;  4CI1 B;  3U8K A;  3Q2M A;  2V7J A;  3KBT A;  4TZ4 C;  2ODV A;  5AQS B;  4QHO A;  2B1E A;  3CX7 B;  5HXS A;  2Q9Q A;  4JI1 T;  5JME A;  3UQ7 A;  3FBL A;  3Q9D A;  5LGU B;  3OYX A;  3HKD E;  3JAE A;  5ABF A;  3PUS A;  2NW7 A;  3U8M A;  2WP9 A;  3EAB A;  2E8I A;  5AFH A;  2AXD S;  5L3F B;  3BQK A;  1ZHC A;  2X9H A;  1LVF A;  1W09 A;  2GK9 A;  2JMK A;  2W62 A;  1ZEE A;  2KLQ A;  2Y6X A;  2LSK A;  2D0T A;  1X79 A;  3B57 A;  1UX2 A;  4GKJ T;  2HHH T;  3ZT5 A;  5J5I A;  3O1I A;  1Z0P A;  3SRZ A;  2LE8 A;  2I6H A;  4ZI2 D;  3ZPO A;  3SOL A;  2CBJ A;  2LOS A;  3C4Z A;  5CB4 E;  3ZMS B;  4UEL A;  2FUP A;  4UVB B;  5HCM A;  2V8S V;  2IHR 1;  3FXE B;  2JQH A;  3LBX A;  3PUR A;  1UUS A;  3VHL A;  3O4X E;  2V26 A;  2RP4 A;  4QX8 B;  4YY3 T;  4K0K T;  2XNV A;  2CRB A;  4AQY T;  4NXN T;  5L3C B;  3IEE A;  2W8G A;  4AQF A;  3L39 A;  5JDQ A;  2Y8D A;  5KDM C;  4Z91 A;  3ZCI A;  2KXP B;  2WZY A;  2XQ8 A;  3AVS A;  3KVB A;  4HWH A;  2BVL A;  2J4G A;  3QB5 A;  4UR9 A;  3RIF A;  3P4W A;  2PBI A;  4NPP A;  1XZY A;  2UZ6 A;  4EB6 E;  4CN4 A;  3FZF B;  3T4M A;  2OLT A;  2XAS B;  4IDO A;  2NWB A;  3ZLI A;  4OK0 A;  4YTM A;  5EK3 A;  2VQF T;  1BR1 A;  2ZLY A;  5HEJ A;  5ETW A;  5AQQ B;  5L2L A;  5F8P A;  2BR8 A;  2D2S A;  2DWK A;  4QAB A;  2HPJ A;  4HTE A;  5HXE A;  4JLE A;  1JNR A;  1IBK T;  2W61 A;  2RPA A;  3K3Q C;  2XAQ B;  5CGM A;  3RX6 A;  4UEM A;  2WWV A;  5CFB A;  4AKG A;  1BR4 A;  4C90 A;  4UV8 B;  1HX8 A;  2NW9 A;  2OA5 A;  2EHO A;  5LP6 E;  2W00 A;  3C84 A;  4HKA A;  2CBI A;  3Q5W A;  2XAH B;  4MFR A;  5LCY A;  3N9Q A;  4YT0 A;  1HFA A;  5FJV A;  4ZXL A;  3NRY A;  4IDP A;  3ONJ A;  3ZJ2 A;  4QWN B;  2DWG A;  4A98 A;  2X00 D;  3VRA A;  2X9W A;  5FMN A;  2QYW A;  4HEA A;  2A3D A;  2V7K A;  4ZI7 E;  3AE1 A;  4H9P C;  2BG9 A;  4LF7 T;  4MAL A;  2X9Y A;  4ZS3 A;  4ZJT A;  2C5I T;  2LEH A;  1QSD A;  4ALX A;  4CQI A;  1D1B A;  3P7I A;  2DLR A;  5EK4 A;  3MXZ A;  4ADZ A;  1YKE B;  4B3T T;  5JDM A;  4HFE A;  2X0Y A;  4UV9 B;  4IDN A;  4KHZ F;  2VL0 A;  4PFP A;  4ZK4 A;  2PJQ A;  2LOP A;  3ZST A;  1OED E;  1W9R A;  5DQV A;  4EV6 A;  4BJM A;  3RKG A;  5DAB A;  2IW5 B;  2E9X C;  3PU8 A;  4B3S T;  3ZDG A;  2N1G A;  2BS2 A;  3E08 A;  3PUQ A;  5LGN B;  4DVD A;  3WTH A;  2WS3 A;  5LJN A;  3JCF A;  3CQX C;  3P8C D;  1MMD A;  5F5W A;  1R8I A;  3AE4 A;  3M65 A;  5AQF B;  5L3B B;  3EHZ A;  2XSA A;  2MOZ A;  2H3R A;  4MHC A;  3UU6 A;  5AFJ A;  4ILC A;  2UXX B;  1UUR A;  2WCA A;  1J5W A;  3FZH B;  3C98 B;  3H3A A;  3HL6 A;  2WSS V;  3P50 A;  2Y57 A;  4AFG A;  2H88 A;  4YJ3 E;  2YU2 A;  3HR0 A;  3AEG A;  1HNX T;  5CA1 E;  1N34 T;  1YXR A;  4H9Q C;  4JI4 T;  2C0S A;  4X1I E;  1XMO T;  2CM0 A;  2PGZ A;  2YDR A;  3IGQ A;  2BYR A;  3ZDH A;  1NEN A;  3AA0 B;  4B5D A;  5AFK A;  3RIU A;  3RRW A;  3ZC1 A;  3TLT A;  3AA7 B;  3GWH A;  1MMN A;  1BR2 A;  1V9D A;  4ASK A;  4EYU A;  3UUM A;  2XQ6 A;  5H6R B;  1WR6 A;  5HCJ A;  3RHW A;  5J2U E;  1S94 A;  4DV7 T;  2YEV C;  3OBV E;  3RKO A;  3WTL A;  1US7 B;  4DV2 T;  4EED A;  4TNW A;  4V1A v;  4BJN A;  3WTN A;  1XMQ T;  4FRR A;  2LSJ A;  3LK2 B;  3UUX B;  2I0M A;  2J47 A;  4QH1 A;  3UFG A;  4TNV A;  5L3G B;  5LB7 B;  3AB3 B;  3FZK B;  3AXJ B;  4H63 H;  2VWA A;  4O4I E;  5AQJ B;  1HF8 A;  4LF9 T;  3WTJ A;  2F4V T;  2H7V C;  2Z6E A;  3HKE E;  3P4S A;  4Z8X A;  3PUY F;  5AQT B;  3ZEF B;  2X00 A;  4TX5 A;  3EAM A;  3ZJ1 A;  5LBQ B;  4DR5 T;  2VKO A;  4O4J E;  2BG9 C;  4X64 T;  5L4E A;  5C3J A;  2WDQ A;  2WM9 A;  4KHP T;  4JI7 T;  2LHR A;  3A5X A;  3EDV A;  2C9T A;  5FXZ A;  2MBG A;  1QLB A;  4AIU A;  3PUG A;  3ZT7 A;  2LKG A;  4DR3 T;  4ZOL E;  5AIN A;  3UUB A;  3C64 A;  3QK6 A;  5EZY E;  3SH1 A;  3K3N A;  2VVN A;  4WNK A;  2ACZ A;  4X1K E;  2VB6 A;  4CN6 A;  1AJ3 A;  2LRL A;  4F6R C;  5HEG A;  2KND A;  5JH7 E;  1XWM A;  4H63 V;  2K24 A;  2LM2 A;  3K8P C;  2OV9 A;  4ZS2 A;  4MLK A;  4NXM T;  2JQK A;  4LF5 T;  1HS7 A;  3CK6 A;  5DJQ C;  5LNK A;  4X20 E;  5HXR A;  2QRX A;  4JI0 T;  5FXV A;  1D0X A;  2C5K T;  5BMV E;  2XY8 B;  2BR7 A;  4XBF B;  2A9U A;  2X51 A;  2E5L T;  3GN5 A;  1DU2 A;  5FL0 A;  2NTX A;  3AAE B;  5LMU T;  3GUA A;  3HI2 A;  3W15 B;  5AFM B;  4TWF A;  4OYK A;  3SIO A;  4WW0 A;  4FJO A;  3KBU A;  5LXB A;  4OHF A;  5LHH B;  3VKH A;  3PUX F;  2J62 A;  3AEE A;  4FI5 A;  4IDQ A;  4IE7 A;  3LJC A;  4JI2 T;  4PIR A;  2DCF A;  2LJL A;  3ANW A;  3VKG A;  4DBM A;  3N9O A;  3CX8 B;  2R6G F;  4U31 A;  2NW8 A;  4UM1 A;  4NZB A;  4AQF C;  5JDN A;  5LA6 E;  3HA4 A;  2DNX A;  5J0Z A;  4OYJ A;  3PJA J;  3UQ4 A;  5LHI B;  3EI0 A;  2CXF A;  4A56 A;  2XSB A;  4XAX B;  2V6Y A;  2XM2 A;  4DBR A;  3UUL A;  3AAI A;  4ZI2 C;  2QVA A;  2W66 A;  4LMJ A;  5H6Q B;  4IE4 A;  4U7Y A;  2BYP A;  3U8L A;  4AFT A;  4IE6 A;  1KNP A;  2MTQ A;  4UIG A;  3U3I A;  2XM1 A;  2W63 A;  3PUA A;  2CE7 A;  4TWD A;  3RQU A;  1LVK A;  3NRX A;  4U33 A;  1Y01 A;  4ZRU A;  3V5S A;  4IE5 A;  3K1S A;  2X66 A;  3F31 A;  3I1A A;  2H7O A;  3L09 A;  2IIU A;  2RA1 A;  4ZR6 A;  4DMV A;  4ZEY A;  4YTP A;  2X0L B;  3AEA A;  5LOV E;  1SE7 A;  3T1Y T;  2VKD A;  2JJ9 A;  3I0Q A;  3LBX B;  1IZN B;  2VK9 A;  4P0A A;  1IBM T;  2XYT A;  2A72 A;  4GOU A;  5AQP B;  2PG8 A;  2Q9Q C;  1HNZ T;  5AQU B;  4AKH A;  3LDQ B;  1FMV A;  3WAJ A;  2WWU A;  4AFH A;  4TV9 E;  1I6Z A;  2UUB T;  4KUM B;  3UU8 A;  3CQC B;  3KV9 A;  2V1D B;  2BG9 E;  2ES0 A;  2DI4 A;  5IWA T;  3PDY A;  3PUZ F;  4NUU A;  2CLY C;  2CXL A;  2YN6 A;  4ZI3 C;  3AE7 A;  2KMF A;  2Q9Q D;  4EZ4 A;  3RYI E;  3VRB A;  1N33 T;  4ZJS A;  2XQA A;  3IBP A;  1OED B;  4DR7 T;  3AE2 A;  1T8B A;  2V7I A;  1UGO A;  1ZV4 X;  3B13 A;  5ABF B;  5AQG B;  4GIW A;  3EUH A;  2WMN A;  1KNZ A;  5JRE A;  4XK9 A;  4TWH A;  3SQ9 A;  4U72 A;  2BVM A;  3G06 A;  2BG9 B;  2XZ6 A;  4HN9 A;  4O2B E;  3ZYK A;  1S35 A;  3E22 E;  1WYC A;  2IUB A;  4U2Y A;  3EDU A;  3WIP A;  3O9X A;  2Y54 A;  4HFH A;  4PJN A;  1OED C;  4U74 A;  2YU1 A;  3TLV A;  2M6I A;  2CPT A;  3T8O A;  2Y48 B;  2JRK A;  3OJA A;  3ZKR A;  4EOZ B;  1UX4 A;  3N5L A;  4H9R C;  5FVK A;  1QUU A;  1D0Y A;  2E9X B;  4UF0 A;  2VAS A;  3F57 A;  3UU3 A;  2YKS A;  4OX9 T;  2EHO D;  2V7M A;  3VU7 H;  3FZL B;  5M4Y A;  2ZM2 A;  2BKO A;  4I50 E;  3FXD B;  2ZMA A;  4H9S E;  1G73 A;  3AA6 B;  5LG3 A;  5CO5 A;  3WI3 A;  4O4H E;  3JC6 D;  2UXC T;  4E7S A;  5AQN B;  4D01 A;  1Z8U A;  3PUV F;  2NR4 A;  1B7T A;  5HWX A;  1M62 A;  3GN5 B;  1HTJ F;  3NKZ A;  4ANJ A;  5DQW A;  1MMA A;  4EEB A;  4GKK T;  4DR2 T;  1SUM B;  2E2A A;  3ANW B;  4J2C A;  3Q5D A;  1BR0 A;  4AIS A;  4L9I A;  4YHH T;  4UF0 B;  2YME A;  1J1J A;  2X67 A;  3HKC E;  4IST A;  1FJG T;  3MZK B;  2KIN B;  3AE3 A;  4X66 T;  2ZM6 T;  3PV0 F;  3NBX X;  1E2A A;  4AQG A;  4YSZ A;  2K5B B;  2V5D A;  1FMW A;  2MAW A;  4I4T E;  2K9A A;  4UM3 P;  1MIV A;  2KWI B;  1W0B A;  2IAK A;  3AA1 B;  2BKP A;  2G0U A;  4KBM B;  4DUZ T;  4DV5 T;  3UFE A;  4H9O C;  3AED A;  5LGT B;  2KT9 A;  2JQQ A;  5FP3 A;  1WR0 A;  4PW8 A;  1G8X A;  2UXN B;  1MNE A;  2XQ9 A;  4XZC A;  4HQP A;  3IHR A;  4DV6 T;  3C4X A;  3K3O A;  4DV3 T;  4CI2 B;  2PH9 A;  1KNR A;  5JTG A;  2XNU A;  1NEK A;  3MAC A;  3QC9 A;  4HGA A;  5AQV B;  2YDS A;  4QAA A;  3R84 B;  4IL4 A;  5FY1 A;  3J7Y q;  2BKN A;  5LG4 A;  5JDF A;  4I0U A;  5TAO A;  1ZOY A;  3H3M A;  3RC8 A;  4EYY R;  4HFI A;  4JYA T;  4ZI3 D;  3E0Z A;  2LSG A;  2ACX A;  2MPK A;  4QXH B;  1E7P A;  5L3E B;  2WB5 A;  4JI3 T;  3U8J A;  2YMD A;  4CZZ B;  2UU9 T;  1KF6 A;  4HFD A;  5JVD E;  4CXW A;  5KZU A;  3MKD A;  5ADX L;  1T72 A;  2ZJU A;  3WTI A;  5TVC A;  2V5C A;  3RYC E;  1T98 A;  5JQG E;  3QNU A;  3CPZ A;  1YKH B;  5KE4 A;  4BFQ A;  1CUN A;  2FJE A;  3PJA A;  5FYM A;  2UXB T;  4JEH B;  3X1D A;  4I55 E;  3ZN0 B;  5AQH B;  5J5F A;  2D9D A;  3C4W A;  4AXP A;  4AKI A;  4IRE A;  1VCS A;  1O3X A;  3AE9 A;  4YXD A;  5L4H A;  4KMC A;  2YOE A;  4A97 A;  2BBJ A;  3ONL C;  3RRC A;  3AAA B;  2JQ9 A;  4L5G A;  3A7M A;  3JC6 C;  4DR1 T;  4JUY A;  3L8R A;  3P4R A;  2A2F X;  1WYB A;  5E0O A;  4M1P A;  4EGW A;  1FIO A;  1KEY A;  4E7Z A;  2PFV A;  4BAY B;  4PK6 A;  2JMH A;  1OED A;  1OWA A;  3HKB E;  3LFM A;  2EHO C;  3DJB A;  3ZT6 A;  5JDG A;  3AE8 A;  4HFC A;  2ODU A;  5HAX A;  3F2E A;  4DV4 T;  4U3C A;  1WRD A;  2XQ4 A;  3J9X 1;  3S4U A;  5LJM A;  2XAJ B;  4XHE A;  3KDS E;  5HYA A;  4YTN A;  3ESL A;  2L8K A;  4Q25 A;  5FL1 A;  2KWH A;  2CEA A;  2W2U A;  5LBM A;  3TLW A;  2XZ5 A;  2NP9 A;  2JPF A;  2LT3 A;  1XDO A;  3MA9 A;  1IJ5 A;  1LRZ A;  4CXY A;  2BS3 A;  2E5V A;  4OFZ A;  3FBZ A;  1VRB A;  4AKR B;  1XNR T;  3T1H T;  5AFM A;  2Y58 A;  5J2T E;  2YK0 A;  2VKH A;  2VKJ A;  5KXJ A;  3NZP A;  2UXD T;  3WTK A;  4IT4 A;  2D5U A;  2UUA T;  4YSY A;  5AFU L;  5FKY A;  4TV8 E;  2XTL A;  2H89 A;  2X9X A;  4IL9 A;  4P1N A;  5ABH A;  1H7C A;  3OKQ A;  3N9P A;  4NUV A;  4WYV A;  3KVA A;  2BDE A;  2XQY A;  4G2A A;  4DMW A;  4ISS A;  2I59 A;  2W4X A;  4DND A;  4BA9 A;  4GK5 E;  2HH7 A;  2WZI A;  5LYJ E;  2CLY B;  5FNV E;  3AE5 A;  5AFL A;  1UCU A;  4I43 B;  3SFE A;  5F3J A;  2XQ7 A;  4HWC A;  4BQT A;  4QAC A;  2QA7 A;  2X68 A;  5AQK B;  3RYH E;  1XDP A;  2LHN A;  2VVS A;  4KP3 C;  3PMZ A;  3UTK A;  2W8F A;  4LFA T;  5HXC A;  3UT5 E;  3DP7 A;  3SWH A;  1D1C A;  4QKN A;  2LSY A;  2VUR A;  4QH4 A;  3SS1 A;  2WNL A;  3IA3 A;  3PE0 A;  5JR9 B;  3N2O A;  3KIN B;  3O1H A;  3N2G E;  4EZH A;  2YDQ A;  2XAF B;  1WCR A;  2IML A;  4LF8 T;  4YJ2 E;  5CA0 E;  3CX6 B;  5JR9 A;  2V6Y B;  2EHO B;  3AVR A;  4LF6 T;  3FB2 A;  2WN9 A;  3ZMV B;  2LRK A;  3PUW F;  1HNW T;  2WY2 A;  3KV5 A;  4DO0 A;  1W0A A;  4PK4 A;  4UVA B;  2BS4 A;  4X5T A;  2Y7Y A;  4PJM A;  3UUN A;  5BW2 A;  2BJ0 A;  3AE6 A;  2IC9 A;  3RQW A;  4HFB A;  2FBW A;  1D0Z A;  4LML A;  3V5U A;  3DTO A;  3CIR A;  2NTY A;  2BBH A;  3RF1 A;  3LK4 2;  4B3M T;  2WNJ A;  5AQO B;  4QXC B;  4O8S A;  2L3L A;  4JI6 T;  3P4Q A;  4NIQ A;  4LF4 T;  3ZSS A;  5CJ5 A;  4JV5 T;  1U5P A;  5A1L A;  5HWY A;  3RH3 A;  3WTO A;  4HFV A;  3SQ6 A;  4WV9 A;  4JI8 T;  5AQM B;  1XNQ T;  3NZQ A;  4UY2 A;  2AE9 A;  4UM3 S;  1HCI A;  5JDL A;  2ZM0 A;  2LLY A;  1N36 T;  1YQ4 A;  2LKH A;  1NAF A;  5J5G A;  5JDH A;  5AQL B;  2WQY A;  3PU3 A;  2WZH A;  1ZKE A;  2MYS A;  3OVU A;  1HR0 T;  4WBN E;  5JRC B;  4DID B;  3QUJ A;  3KV6 A;  2QGS A;  4EIW A;  1M7K A;  4YLH A;  3M3Z B;  2NOX A;  3AEF A;  3KFW X;  2XNT A;  4X65 T;  4TUY E;  1JNZ A;  4P0B A;  4EXT A;  5C2T A;  5C8Y E;  1MIY A;  3QB5 K;  5KX5 E;  2CA5 A;  1IBL T;  1HG2 A;  4DR4 T;  1J5E T;  2QC1 B;  5FY7 A;  2HPL A;  3D0T A;  1YW0 A;  1L0V A;  2WMO A;  1MND A;  3C51 A;  5FXX A;  2FJB A;  3I9W A;  3AXJ A;  3TKL B;  2CHN A;  4U2Z A;  2KZ7 B;  3RI5 A;  3I0O A;  4O2A E;  4PAG A;  4C91 A;  2FJD A;  4DV0 T;  3JAF A;  2BYQ A;  3ZN1 B;  3N9N A;  4X1Y E;  3P4P A;  2E9X A;  3LG7 A;  4UVC B;  2N2N A;  4Z90 A;  5IYZ E;  2CXD A;  3Q5E A;  4YSX A;  1LKX A;  3RGL A;  5JR9 C;  4JI5 T;  3OPC A;  2Q9Q B;  3WAK A;  4DV1 T;  1D1A A;  1YQ3 A;  1OXZ A;  5IUX A;  4GK0 E;  1UW6 A;  2W67 A;  5FXW A;  1IJ6 A;  3CWZ B;  3PEO A;  5J1G A;  3C50 A;  3LSV A;  2WU5 A;  4KX6 A;  3FHN A;  3GA8 A;  1FEW A;  2V6X A;  2N9D A;  2XPK A;  2VQE T;  3N2K E;  1UK5 A;  1MMG A;  3KV4 A;  3BQI A;  2KSR A;  4YHJ A;  2BYN A;  3QOF A;  5BRX A;  4B6X A;  4DR6 T;  1UX5 A;  2XZE A;  3BK9 A;  4IHJ E;  4PFO A;  5AFN A;  2CCQ A;  4HWD A;  2P9B A;  5HEH A;  1VCT A;  3A8Y C;  4QX7 B;  3Q5X A;  1I9B A;  3VR8 A;  4WZX A;  4UM3 A;  3O1J A;  2E9X D;  3I9Y A;  4K0U A;  3NVO A;  3CVR A;  3ONX A;  2FJA A;  4CI3 B;  5HEO A;  1NWM X;  2J1D G;  2L9Q A;  4EAH A;  3SFD A;  3U8N A;  5EK2 A;  3RPU A;  1N32 T;  4LMK A;  4IIJ E;  5L3D B;  2XAG B;  2Y56 A;  3IF8 B;  2DL1 A;  4U7I A;  3ETV A;  4JEU B;  2CHO A;  2K3W A;  3H37 A;  4IDZ A;  3ABV A;  3CQG B;  3U78 A;  4ZHQ E;  3FZM B;  2X0H A;  1KFY A;  2XHE B; 
#chains in the Genus database with same CATH homology
 3RQU A;  2BG9 B;  2XZ6 A;  2BR7 A;  3TLW A;  3UU4 A;  2XZ5 A;  4QH4 A;  3UU6 A;  2ZJU A;  4ZRU A;  2YME A;  3WTI A;  4ZZC A;  5AFJ A;  2WNL A;  5TVC A;  4ILC A;  4Z91 A;  5L47 A;  5JME A;  4A98 A;  3TLU A;  3UQ7 A;  2XQ8 A;  2X00 D;  2WZY A;  2X00 A;  3P50 A;  5KE4 A;  2Y57 A;  3GUA A;  3EAM A;  4BFQ A;  4ZR6 A;  3WIP A;  3RIF A;  4AFG A;  3P4W A;  2Y54 A;  5AFM B;  3JAE A;  4HFH A;  4TWF A;  3U8M A;  4NPP A;  1OED C;  3SIO A;  2BG9 C;  5AFH A;  2UZ6 A;  3TLV A;  2M6I A;  5LXB A;  5L4E A;  2MAW A;  2WN9 A;  5J5F A;  2BG9 A;  2XNT A;  2WNC A;  4UM3 P;  2KSR A;  4IRE A;  3ZKR A;  5AFM A;  2XYS A;  2Y58 A;  4ZJT A;  3T4M A;  3RIA A;  2BYN A;  4PIR A;  5BRX A;  2PGZ A;  3IGQ A;  3ZDH A;  2BYR A;  2C9T A;  4ALX A;  4B5D A;  5L4H A;  4X5T A;  2XYT A;  2ZJV A;  2Y7Y A;  3WTM A;  4DBM A;  4ILA A;  5AFK A;  2YOE A;  4A97 A;  5BW2 A;  5SYO A;  2BJ0 A;  5HEJ A;  5AFN A;  4F8H A;  5HEU A;  3WTK A;  2M6B A;  3C79 A;  3TLT A;  3RQW A;  5HEH A;  4HFB A;  5BP0 A;  4UM1 A;  2BR8 A;  4NZB A;  2XQ9 A;  4LML A;  2LKG A;  2QC1 B;  1I9B A;  4QAB A;  3UU3 A;  4HQP A;  4AFH A;  2YKS A;  2XQ5 A;  4HFE A;  5AIN A;  1UX2 A;  2XQ6 A;  4IL9 A;  5J5I A;  3UUB A;  5HCJ A;  2VL0 A;  3RHW A;  4UM3 A;  5J0Z A;  3UU8 A;  3SH1 A;  4ZK4 A;  2W8G A;  3RI5 A;  1UV6 A;  2PH9 A;  4EZ1 A;  1OED E;  2BG9 E;  2XQ3 A;  2WNJ A;  3UQ4 A;  3TLS A;  3EI0 A;  3JAF A;  5CFB A;  3EHZ A;  2XNU A;  3WTL A;  5HEO A;  2BYQ A;  4ZK1 A;  4TNW A;  5HEG A;  1OED A;  2YN6 A;  5LG3 A;  5CO5 A;  4QAA A;  5HCM A;  4IL4 A;  4Z90 A;  3C84 A;  3WTN A;  4ZZB A;  3U8N A;  4HFC A;  3WTO A;  5AFL A;  4ZJS A;  3SQ6 A;  4FRR A;  4WV9 A;  4LMK A;  4LMJ A;  2LM2 A;  2XQA A;  5J5H A;  3ZDG A;  4D01 A;  4QH5 A;  1OED B;  2Y56 A;  2XQ7 A;  4HFI A;  4UY2 A;  4BQT A;  4COF A;  2XQ4 A;  4QAC A;  4UM3 S;  2BYP A;  3U8L A;  3JAD A;  3WTH A;  3UU5 A;  2LLY A;  2BYS A;  4AFT A;  4XHE A;  5IUX A;  4QH1 A;  4TNV A;  1UW6 A;  5FJV A;  5J5G A;  3U8J A;  3PMZ A;  2W8F A;  2LKH A;  4XK9 A;  2YMD A;  4TWH A;  3PEO A;  4UXU A;  3WTJ A;  2XNV A;  3SQ9 A;  3U8K A;  4HFD A;  4TWD A;  4ILB A;  3LSV A;  5KZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...