4QH1A

The glic pentameric ligand-gated ion channel (wild-type) in complex with bromoacetate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
molecule tags Membrane protein, transport protein
source organism Gloeobacter violaceus pcc 7421
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh1A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh1A01
5KE4A 5KZUA 3UQ7A 2BYNA 2M6IA 2VL0A 4UY2A 2BG9A 2XQ3A 3EAMA 4XHEA 1OEDB 4ZZBA 2YOEA 2XQ6A 4QH4A 5SYOA 4UXUA 3RI5A 4LMJA 2Y57A 2BJ0A 4TWFA 3WTJA 3TLWA 4NPPA 4HFDA 5HEOA 5HEUA 3RQWA 3UU4A 4ZR6A 4LMKA 4QH5A 2BYPA 2UZ6A 2XYSA 2BG9E 3JAEA 4IREA 4TWDA 4F8HA 3EI0A 2XQ9A 4PIRA 4HFIA 5L4EA 3SH1A 3RIAA 3ZDGA 5J5HA 3SQ6A 2XYTA 4BFQA 3IGQA 4XK9A 4B5DA 4IL9A 4NZBA 3WTOA 5HEHA 3TLUA 4EZ1A 2LKHA 2WNJA 4DBMA 5AFHA 3C84A 3U8KA 3JADA 4Z90A 3WTNA 3RHWA 5HCMA 5LG3A 3PEOA 5J5FA 2X00D 1OEDE 3WTHA 3T4MA 2XQ7A 4A98A 5HEJA 5AFMB 2XQAA 5L47A 3U8JA 3ZKRA 3UQ4A 5FJVA 4ZJSA 3C79A 2W8GA 3LSVA 4FRRA 2YMEA 2XQ4A 2LLYA 2BR7A 4HQPA 3U8NA 2BYQA 3TLVA 4AFHA 5J0ZA 3UU6A 4TNVA 4Z91A 2WNLA 2BG9B 1I9BA 2ZJVA 2YMDA 3PMZA 3P4WA 4UM3S 5BP0A 4TNWA 4HFCA 2LM2A 3GUAA 2YN6A 4UM1A 4ILBA 4QH1A 4X5TA 2XZ5A 4WV9A 2MAWA 2X00A 3WTLA 5AFMA 4ZRUA 4HFBA 4LMLA 2XZ6A 3JAFA 5J5GA 5HCJA 2WZYA 2XNTA 3SIOA 2BYRA 2XNVA 4BQTA 3P50A 2Y58A 2BG9C 4TWHA 2ZJUA 2XNUA 4D01A 1UX2A 5TVCA 5IUXA 5CO5A 4HFHA 4ZK1A 4AFGA 4HFEA 1UV6A 2WN9A 3RQUA 4A97A 2PH9A 3WTKA 4UM3P 3RIFA 2Y54A 5LXBA 4ILAA 5CFBA 5BW2A 4ZJTA 2YKSA 2WNCA 5L4HA 1UW6A 2PGZA 5JMEA 4UM3A 2XQ5A 3WIPA 3WTIA 4ZZCA 5HEGA 4ALXA 2XQ8A 2LKGA 3UU3A 1OEDC 4ZK4A 5AINA 3EHZA 4AFTA 3UUBA 1OEDA 2W8FA 2Y56A 2KSRA 4IL4A 3U8LA 2BR8A 3WTMA 2M6BA 3U8MA 5AFLA 3TLTA 4QACA 3ZDHA 4QABA 3UU5A 4ILCA 5BRXA 2Y7YA 2BYSA 3UU8A 3SQ9A 5AFKA 5AFJA 2QC1B 4COFA 2C9TA 5AFNA 5J5IA 3TLSA 4QAAA
chains in the Genus database with same CATH superfamily
2XQ3A 4H9SE 2PBIA 1T72A 1OEDB 1IAPA 3LBXB 5KDMC 4H63H 4UXNB 4UV9B 2UU9T 2JIWA 4QH5A 3UULA 3UT5E 5L3BB 2BBHA 2JQKA 3SQ6A 2XAJB 3HKBE 4EEBA 5HEHA 1WLXA 3Q5WA 1KNZA 4E7ZA 1GQEA 5J5FA 3PEOA 3WAJA 4EAHA 3U8JA 2IMLA 2IC9A 2VB6A 3NRXA 4GKJT 1D1BA 4JEHB 4TNWA 3FZLB 4MBQA 2XZ5A 4X5TA 3WTLA 2ODVA 3OBVE 2L3LA 3CK6A 1WFDA 5L2LA 5AQHB 1M7KA 5FY7A 3UUMA 4JI8T 3BQIA 3CIRA 4WNKA 4ILAA 2KZ7B 2CCQA 1UW6A 1N36T 2BKOA 5HEGA 4ANJA 1UURA 3RIUA 4ZK4A 1YW0A 5AFLA 2UXNB 4O4IE 3K3QC 3K3OA 4ILCA 2BYSA 2CE7A 4JI2T 2R6GF 4YTMA 5AQKB 4P0BA 5GONE 3D0TA 5JDHA 5KZUA 2YINA 1UK5A 2WBLA 3CKDA 1SA0E 4TV9E 3GA8A 2BJ0A 4AXPA 4OFZA 2W0GA 3P4RA 3FZKB 2Q9QB 1WRDA 2BYPA 4QXHB 2VQET 2XQ9A 1SE7A 2IIUA 2V6YA 5ABGA 4WBNE 1HNXT 1HTJF 1XWMA 3A5XA 2J62A 1OEDE 4YSYA 2XQYA 4PJLA 2XQAA 4G2AA 2HN2A 5FJVA 2DWKA 2BBJA 2DHRA 2MOZA 5HWYA 1HG5A 2X0LB 4MALA 3JCFA 4ILBA 4PW8A 5IHYA 2BYRA 5DQVA 4LF4T 1ZKEA 3P4SA 2JQQA 1MNDA 2I59A 3PE0A 2CA5A 4DR6T 3PUXF 4DIDB 4U7IA 2WQYA 4JI3T 5JRCA 2VKDA 1Y01A 2MPKA 3VKHA 1KF6A 2CM0A 4NIQA 5AINA 1UUSA 2KWIB 3P4QA 4PK4A 2CXLA 2IUBA 4EYUA 4KHPT 3ZCIA 1FMVA 4K0UA 3RYFE 5BR8T 5AFJA 4COFA 2ZM6T 3ZN1B 4LF6T 5JVDE 2XAGB 3KINB 4YLHA 2WMOA 2BS3A 3AXJA 1HNWT 3WTJA 1CHUA 3C79A 3JAEA 4EYYR 1T8BA 3RIAA 1T7SA 3K8PC 2NTXA 1YD8G 3OVUA 4JYAT 1I94T 3AEEA 4DR2T 2BS4A 3LFMA 3V5UA 5FMNA 2V7IA 5C3JA 2H89A 4KX6A 5HXCA 1J5ET 3RH3A 2YMEA 3U8NA 2XJ7A 5J0ZA 2VK9A 4O4LE 3F31A 3UFEA 3S4UA 1MMAA 1NENA 4YHJA 4HFBA 3RF1A 2QRXA 4JI7T 3HKCE 4BJNA 4PJNA 4AFGA 2DWGA 1BR1A 1UV6A 2YEVC 1WCRA 3Q5XA 4CXXA 2Q9QA 5FVLA 5IYZE 1ZP0A 4UEMA 1MNEA 2I6HA 2NP9A 2OA5A 1KNRA 5LJMA 2LM9A 3QB5K 5JQGE 5C2TA 4K0KT 3RRCA 1XMQT 1OEDA 4JBWF 1OWAA 2VKOA 3KV9A 2CXDA 2Y7YA 4TX5A 5AFKA 4I55E 1MMDA 5EK3A 3VR8A 4AIUA 3L39A 1R8IA 4QHOA 4F6RC 1BR4A 2EHOD 2LRKA 4X66T 3PDYA 3PURA 2CWYA 4HFIA 4PIRA 2Q9QD 1G8XA 2K9AA 5L3DB 3C51A 3JADA 4WZXA 1E7PA 3B57A 5ADXL 3ZMUB 5KXJA 5L47A 4JEUB 3RC8A 3KV6A 5LBQB 3GMIA 1W9RA 3PUYF 4HKAA 4HFCA 3LBXA 2X66A 4UELA 3ANWA 3RC3A 2W63A 2CEAA 4KMCA 3IHRA 2Y8DA 2LJLA 2XNUA 1WR6A 3P8CD 2YDQA 5CA0E 3JC6C 2PH9A 2I0MA 3A7MA 2W2UA 1OXZA 2UXXB 3ZSTA 2C5KT 4GKKT 1HCIA 4B6XA 4ILUA 3C4XA 1YXRA 4CI1B 1X9BA 4YHHT 3ZPOA 5J2UE 3T1HT 4YSZA 3UU5A 4ISSA 4DUYT 4YT0A 1D0XA 4OX9T 2KNDA 2VQFT 4HWCA 5LMUT 1D1AA 4AKRB 2ES0A 5JDGA 5E0OA 4DV6T 4DBQA 4ZR6A 2ZM2A 4B3ST 3Q9DA 4C91A 1CUNA 1J1JA 3DTOA 5AQRB 1BR0A 2V6XA 3Q2MA 2D0UA 2X00D 4G63A 3AEGA 3LSVA 4IDQA 4TN7B 4TNVA 4YY3T 3KV4A 3P4WA 4ZXLA 3VHLA 3OJAA 3ZN0B 3GUAA 4O8SA 2MAWA 3RYCE 4DV3T 4UR9A 3NVOA 3CQGB 3ZMTB 4BQTA 2XUEA 2UXDT 5CGMA 3M65A 4DO0A 3GN5B 2MTQA 4BJMA 2E5LT 5IUXA 1HFAA 4HFHA 4CZZB 4A97A 4JLEA 1UGOA 4ZJTA 3W15B 2PGZA 3ZEFB 4UM3A 3AAEB 1Z8UA 4ADZA 1E1HB 3UUBA 3FHNA 2YDSA 4ZHQE 4PAGA 3OYZA 2RA1A 4AKHA 4GK5E 3AE2A 4MLKA 4O4HE 2PJQA 4CQIA 5AQGB 5LXTE 3CX6B 3N9QA 4HFVA 2A3DA 4IIJE 2ODUA 2PFVA 2ZM8A 4DMWA 4LFBT 4H9PC 3ONLC 4IL9A 4NZBA 3MXZA 5LMNT 2WMNA 5HXSA 2VURA 1YKHB 4QWNB 3LDQB 2CWOA 2W8GA 5FKYA 3ETUA 1IJ6A 1XDOA 4PJMA 2XAFB 1KEYA 4WV9A 3RYIE 2JQHA 3T1YT 5AQVB 3WAKA 2WDRA 2XNVA 3NKZA 2H7OA 2W00A 1HR0T 2Y58A 3ZJ1A 3AEBA 4PK6A 3AVRA 4U3CA 4LF8T 2X67A 5JR9B 3HI2A 4HWDA 2LKGA 1XMOT 4CI3B 2V26A 1XZYA 4P09A 4IE0A 5J1GA 4LF5T 2XZEA 2WAUA 1KFYA 2E5VA 4UF0B 1XDPA 2ACZA 2IC6A 4DR5T 2LT3A 3SRZA 2BG9E 2CBJA 4AQFC 5AQNB 2H3RA 2HN1A 2C5IT 3ZMZB 4XK9A 3E0ZA 3MACA 3B5MA 2WNJA 3LJCA 1U5PA 2WS3A 4IE5A 4TZ4C 2Y6XA 1VRBA 2XQ7A 5HEJA 4EV6A 3PUQA 2XQ4A 3CQCB 4EOZB 2BYQA 2V5DA 3L3PA 3AEFA 1W0AA 2IDOB 1HS7A 2YN6A 3I1AA 5AFMA 1J5WA 2WB5A 2XZ6A 3JAFA 3L8RA 3ONXA 2X0YA 4IGUA 3HKEE 2W61A 5AQPB 3N9PA 5TVCA 4IE7A 2HHHT 1US7B 3NWIA 3JC6D 1V9DA 3H3AA 2WWVA 2CPTA 3FBZA 1WYBA 2ZLYA 4O2AE 2Y56A 2BR8A 3WTMA 3N9LA 4L5GA 5LG4A 2CLYB 3ZDHA 3ZC0A 3UUXB 3J7Yq 5IWAT 4KHZF 4OYKA 3TLSA 2BKPA 3N2KE 2AE9A 5KMGP 3ZT6A 1MIWA 3EAMA 5L3GB 1D0YA 5ETWA 4QH4A 1DU2A 4LMJA 5LB7B 4CN1A 2LHNA 4EZ4A 4ZI3D 3CMLA 3EI0A 3G06A 5HXRA 3ZMSB 5FXWA 3QC9A 4EIWA 3RKOA 2JQ9A 1MIVA 3AECA 2WZHA 3KBTA 2XM2A 3PV0F 3WTNA 3FZHB 4IDNA 1HX8A 2MYSA 3IA3A 3ZLIA 2LLYA 2E9XB 1IJ5A 4UVAB 3EDUA 2W4XA 5DJQC 4CI2B 4QH1A 3I9WA 1WYCA 3C98B 5HCJA 2VVSA 3SOLA 3UUNA 4GYRA 4HEAA 4UM3P 2AXDS 3AEDA 1YQ3A 2LSJA 5JMEA 3NRYA 2P9BA 1MMNA 2NWBA 5FY0A 5JREA 4B3MT 2KSRA 4X64T 2NTYA 5F3JA 1M62A 4U72A 1KK7A 5JTGA 4X65T 4HE8A 3VRBA 2V7KA 3KDSE 4A56A 4DV2T 4HN9A 4ZZBA 2EHOA 2NW8A 2YOEA 2CXFA 3EABA 3RI5A 1QSDA 2EHOB 5HEUA 3UU4A 4AQYT 1JNZA 1VCSA 4FJOA 1YQ4A 3O9XA 3P7IA 4KBMB 4LMKA 4IREA 4NUUA 2UZ6A 2BZBA 5CJ5A 3ZDGA 5J5HA 1L0VA 5H6RB 4BFQA 4B5DA 3TLUA 1JNRA 1IBMT 1WR0A 2C5JA 4TUYE 5LP6E 5FY1A 5AFMB 2XAQB 3PTRB 3AA1B 4ZJSA 1W09A 2HPJA 4FRRA 4ZOLE 4AFHA 2E2AA 2BVLA 4O2BE 1I9BA 3PMZA 2UXBT 4U74A 2V7MA 4ZI2C 1T98A 3A8YC 2D2SA 2XY8B 4IHJE 4YTPA 4NXMT 5EZYE 3VKGA 2UUAT 2FJBA 5HXEA 2H88A 3P50A 2BG9C 4DV0T 2LSYA 1UX2A 2V7LA 3N9NA 3I0QA 3VU7H 4U33A 1N33T 2WP9A 4IDZA 3KVAA 2LE8A 5JDNA 2KLQA 3RPUA 3EHZA 2UXCT 2M6BA 2A9UA 3QOFA 3RGLA 4BA9A 4MHCA 2VKHA 5FL0A 4ZS2A 2C0SA 1D1CA 5FP3A 2V1DB 4JI6T 3LK2B 4OYJA 3ZYLA 5DABA 1U4QA 2FUPA 2NOXA 4WYVA 2KT9A 2XTLA 2CMRA 5HWXA 3SH1A 5JDMA 4DR1T 3PUAA 5HYAA 3M3ZB 3PJAA 3IGQA 2X68A 4U2YA 4EZ1A 4N78D 4IDPA 1S35A 1MIYA 5HCMA 3EVYA 3WTHA 2CHOA 5JR9C 2LSKA 4JI0T 1NEKA 5F5WA 2A72A 3R84B 4AKIA 5JDFA 3TLVA 3IBPA 2CHNA 3BQLA 5TAOA 4LMLA 2WU2A 4BAYB 5AFUL 4DV5T 4HWIB 2LSIA 4PJJA 4DR7T 4GK0E 2QYWA 3AVSA 3AE6A 5CFBA 2IHR1 4M1PA 4QXCB 3PUSA 4MFRA 3O1JA 4P1NA 4ZZCA 5LGTB 2XQ8A 4HGAA 3UU3A 2V8SV 2YU2A 3UTKA 4YSXA 2A2FX 1IBKT 2D0TA 3TKLB 4U2ZA 2JMKA 1I6ZA 4J2CA 2XPKA 1B7TA 2LOSA 5FXVA 2WDQA 2VVNA 1EZ3A 1LVKA 4H9RC 2B76A 2IAKA 3E08A 5AQIB 3B13A 4HWFA 3KVBA 4UXUA 2G0UA 3RQWA 1XNQT 2XYSA 4F8HA 3OPCA 2OLTA 4EXTA 3V5SA 4UV8B 2XYTA 5LOVE 3N5LA 4YFSA 5LA6E 4UVCB 4OK0A 5AQMB 5AFHA 3U8KA 4Z90A 3ZJ2A 5LGNB 2N1GA 3ZT5A 4DV4T 4H9OC 3O1IA 4Z8XA 3UQ4A 1SHZC 4AKLA 5AQUB 2DCFA 2E9XD 1Z0PA 3AA6B 3FXEB 4X1KE 4Z91A 2VL8A 2VASA 2K5BB 4ISTA 4AISA 4HWHA 4X1YE 2NW9A 3AE4A 3OYXA 3HKDE 4X1IE 3SIOA 4UVBB 3ONJA 3ZMVB 4GYSA 4EEDA 5LJNA 4ZK1A 3N2OA 5AQLB 3SWHA 2HH7A 3UFGA 5BW2A 1LKXA 3ZT7A 5L4HA 4JI1T 1G73A 3QK6A 1UX4A 4CXWA 4AQGA 1HNZT 3K1SA 3DJBA 2H7VC 2W67A 1FMWA 4I0UA 3QNUA 3ZC1A 2QC1B 3MK7C 3EDVA 3PU8A 2YU1A 2DL1A 3UQ7A 3FZFB 4UY2A 2W66A 4P0AA 4XHEA 3ZCJA 2X51A 2Y57A 5ABHA 2ZMAA 2UUBT 4DVDA 4I43B 4U7YA 4FI5A 2J4GA 5M4YA 3MA9A 5EK4A 3GWHA 3N2GE 2J1DG 3I9YA 3O1HA 4PFOA 4DBMA 4ZEYA 3C84A 1HX1B 5LG3A 2V7JA 4ZS3A 2CLYC 2X9WA 3T4MA 3ZKRA 1MMGA 5JDLA 1N32T 1UCUA 4EB6E 5CA1E 2X0HA 3VRAA 4HQPA 5EK2A 5HXHA 5FNVE 3AE9A 2PTFA 2WZIA 2WNLA 4UM3S 5BP0A 3ANWB 3AAIA 2CBIA 4YJ3E 2LM2A 3RX6A 2M67A 3AB3B 2Y48B 3PUGA 5AQQB 2FBWA 2SPCA 3QUJA 4ASKA 4KI0F 2JMHA 4YXDA 5CO5A 3HA4A 2E9XC 3H37A 5JR9A 3O4XE 3U78A 5AQTB 3MZKB 5LCYA 5JH7E 3ZYKA 2IW5B 3WTIA 3F57A 3KFWX 3LG7A 2L9QA 5ABEA 3AE1A 1O3XA 3CPZA 5LGUB 5BRXA 5FXZA 2L8KA 5BMVE 3VR9A 5J5IA 1ZEEA 4A5XA 5KE4A 2M6IA 3R6NA 2VL0A 5AQFB 2NR4A 5SYOA 3LK3B 4IDOA 4TWFA 2W62A 4NPPA 4HFDA 3TLWA 2UUCT 2ZM0A 4TWDA 2XASB 2X9YA 2YK0A 2E8IA 2K48A 2D5UA 3PUVF 2DI4A 3AE3A 2LHRA 3SFDA 4DR4T 4X20E 4DR3T 5LBMA 1AJ3A 4EZHA 1QLBA 1BR2A 3FXDB 2E9XA 2JJ9A 3ESLA 4H63V 4ERRA 4E7SA 3UU6A 4AQFA 2V5CA 4O4JE 2N2NA 4QXBB 3P4PA 1LVFA 2N9DA 5HAXA 3BQKA 3LK42 3MJXA 4IE6A 1HF8A 4ZRUA 3WI3A 4I4TE 4NXNT 2WZYA 5LYJE 3NBXX 3RYHE 4DV1T 2F4VT 4KUMB 3NZQA 2X9HA 1HG2A 4EGWA 4YTNA 4WBOA 4XBFB 4XZCA 2WY2A 3N9OA 4CN4A 3AE7A 4HTEA 3ABVA 5LNKA 2W8FA 3C4WA 4TV8E 3AE5A 3U8MA 3PU3A 4B3RT 4QACA 3NZPA 3SQ9A 5AFNA 2K3WA 3SS1A 4YJ2E 4CN6A 2LSGA 4V1Av 1ZHCA 4ZI7E 1QUUA 4LFAT 5ABFA 4PNIA 2KMFA 2ACXA 3PUWF 2DNXA 4QX7B 2J47A 5A1LA 5FYMA 1VCTA 2XAHB 4CXYA 3H3MA 3WTOA 4KP3C 5J2TE 2X9XA 2YDRA 5CB4E 3SFEA 3RHWA 2LRLA 3U3IA 4I50E 1NAFA 2RPAA 3DP7A 3Q5EA 1FJGT 4IT4A 2ZJVA 4ZI2D 4DNDA 4Q25A 5FL1A 2FJAA 2X00A 2KXPB 1VOMA 5JRCB 1SUMB 5KX5E 3ETVA 5C8YE 3RQUA 3QB5A 4DMVA 3PUZF 3RIFA 5LXBA 2WNCA 5L3EB 5AQOB 2WM9A 2V6YB 3AEAA 3RLFF 5L3CB 1OEDC 2BDEA 1FEWA 3FBLA 4AFTA 4WW0A 1D0ZA 4LFCT 4QABA 2JPFA 4UIGA 1X79A 2HPLA 2Q9QC 5JDQA 2WSSV 3ZYMA 4QX8B 2BYNA 2XM1A 2RP4A 2BG9A 3HR0A 4X62T 2XQ6A 1UX5A 3FB2A 4LF7T 3OKQA 1YKEB 5L4EA 3C64A 4NUVA 3RIUC 5LHIB 3N9MA 1KNPA 4DV7T 3AXJB 4JUYA 4PFPA 2BVMA 4A98A 3FZMB 1ZV4X 4PK5A 4AI6A 1Y64B 1FIOA 2BR7A 2K24A 2BS2A 3C4ZA 2BG9B 5L3FB 1ZOYA 2YMDA 4L0RA 3E22E 3ZSSA 2XHEB 2CRBA 2JRKA 2KWHA 5LHHB 4QKNA 4C90A 2XSBA 3HL6A 4AKGA 5J5GA 3L09A 2QVAA 4DUZT 2ZJUA 2WN9A 4GOUA 2Y54A 3I0OA 3IEEA 5AQJB 5FXXA 2KINB 2WDVA 4XAXB 2XQ5A 2FJEA 1W0BA 2QA7A 2VWAA 5AQSB 1H7CA 3CQXC 3TLTA 2XSAA 3KV5A 3UU8A 3AA7B 3F2EA 3CVRA 2PG8A 3MKDA 3AE8A 4IE4A 3T8OA 2LEHA 3CX7B 1N34T 3AAAB 2MBGA 2VKJA 5HEOA 3PJAJ 3RRWA 3BK9A 3GN5A 3IF8B 4JI4T 4OHFA 2WCAA 5LHGB 1IZNB 2FJDA 4UF0A 4H9NC 2LKHA 2B1EA 2Z6EA 2DLRA 2WU5A 2EHOC 4U31A 3AA0B 1E2AA 3CX8B 2GK9A 2WWUA 4H9QC 3J9X1 2LOPA 4L9IA 5DQWA 4UM1A 2OV9A 4LF9T 2XNTA 4JV5T 2BKNA 4ZI3C 4TWHA 2D9DA 4B3TT 1S94A 4D01A 1XNRT 3K3NA 3X1DA 4HFEA 3WTKA 3CWZB 5ABFB 4GIWA 2YKSA 5FVKA 3RKGA 2NW7A 3WIPA 3KBUA 4ALXA 2QGSA 4IL4A 3U8LA 4JI5T 3C50A 1NWMX 3Q5DA 5F8PA 3OTOT 1IBLT 3EUHA 2C9TA 1LRZA 4QAAA 5H6QB 4DBRA
chains in the Genus database with same CATH topology
5KE4A 5KZUA 3UQ7A 2BYNA 2M6IA 2VL0A 4UY2A 2BG9A 2XQ3A 3EAMA 4XHEA 1OEDB 4ZZBA 2YOEA 2XQ6A 4QH4A 5SYOA 4UXUA 3RI5A 4LMJA 2Y57A 2BJ0A 4TWFA 3WTJA 3TLWA 4NPPA 4HFDA 5HEOA 5HEUA 3RQWA 3UU4A 4ZR6A 4LMKA 4QH5A 2BYPA 2UZ6A 2XYSA 2BG9E 3JAEA 4IREA 4TWDA 4F8HA 3EI0A 2XQ9A 4PIRA 4HFIA 5L4EA 3SH1A 3RIAA 3ZDGA 5J5HA 3SQ6A 2XYTA 4BFQA 3IGQA 4XK9A 4B5DA 4IL9A 4NZBA 3WTOA 5HEHA 3TLUA 4EZ1A 2LKHA 2WNJA 4DBMA 5AFHA 3C84A 3U8KA 3JADA 4Z90A 3WTNA 3RHWA 5HCMA 5LG3A 3PEOA 5J5FA 2X00D 1OEDE 3WTHA 3T4MA 2XQ7A 4A98A 5HEJA 5AFMB 2XQAA 5L47A 3U8JA 3ZKRA 3UQ4A 5FJVA 4ZJSA 3C79A 2W8GA 3LSVA 4FRRA 2YMEA 2XQ4A 2LLYA 2BR7A 4HQPA 3U8NA 2BYQA 3TLVA 4AFHA 5J0ZA 3UU6A 4TNVA 4Z91A 2WNLA 2BG9B 1I9BA 2ZJVA 2YMDA 3PMZA 3P4WA 4UM3S 5BP0A 4TNWA 4HFCA 2LM2A 3GUAA 2YN6A 4UM1A 4ILBA 4QH1A 4X5TA 2XZ5A 4WV9A 2MAWA 2X00A 3WTLA 5AFMA 4ZRUA 4HFBA 4LMLA 2XZ6A 3JAFA 5J5GA 5HCJA 2WZYA 2XNTA 3SIOA 2BYRA 2XNVA 4BQTA 3P50A 2Y58A 2BG9C 4TWHA 2ZJUA 2XNUA 4D01A 1UX2A 5TVCA 5IUXA 5CO5A 4HFHA 4ZK1A 4AFGA 4HFEA 1UV6A 2WN9A 3RQUA 4A97A 2PH9A 3WTKA 4UM3P 3RIFA 2Y54A 5LXBA 4ILAA 5CFBA 5BW2A 4ZJTA 2YKSA 2WNCA 5L4HA 1UW6A 2PGZA 5JMEA 4UM3A 2XQ5A 3WIPA 3WTIA 4ZZCA 5HEGA 4ALXA 2XQ8A 2LKGA 3UU3A 1OEDC 4ZK4A 5AINA 3EHZA 4AFTA 3UUBA 1OEDA 2W8FA 2Y56A 2KSRA 4IL4A 3U8LA 2BR8A 3WTMA 2M6BA 3U8MA 5AFLA 3TLTA 4QACA 3ZDHA 4QABA 3UU5A 4ILCA 5BRXA 2Y7YA 2BYSA 3UU8A 3SQ9A 5AFKA 5AFJA 2QC1B 4COFA 2C9TA 5AFNA 5J5IA 3TLSA 4QAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KE4 A;  5KZU A;  3UQ7 A;  2BYN A;  2M6I A;  2VL0 A;  4UY2 A;  2BG9 A;  2XQ3 A;  3EAM A;  4XHE A;  1OED B;  4ZZB A;  2YOE A;  2XQ6 A;  4QH4 A;  5SYO A;  4UXU A;  3RI5 A;  4LMJ A;  2Y57 A;  2BJ0 A;  4TWF A;  3WTJ A;  3TLW A;  4NPP A;  4HFD A;  5HEO A;  5HEU A;  3RQW A;  3UU4 A;  4ZR6 A;  4LMK A;  4QH5 A;  2BYP A;  2UZ6 A;  2XYS A;  2BG9 E;  3JAE A;  4IRE A;  4TWD A;  4F8H A;  3EI0 A;  2XQ9 A;  4PIR A;  4HFI A;  5L4E A;  3SH1 A;  3RIA A;  3ZDG A;  5J5H A;  3SQ6 A;  2XYT A;  4BFQ A;  3IGQ A;  4XK9 A;  4B5D A;  4IL9 A;  4NZB A;  3WTO A;  5HEH A;  3TLU A;  4EZ1 A;  2LKH A;  2WNJ A;  4DBM A;  5AFH A;  3C84 A;  3U8K A;  3JAD A;  4Z90 A;  3WTN A;  3RHW A;  5HCM A;  5LG3 A;  3PEO A;  5J5F A;  2X00 D;  1OED E;  3WTH A;  3T4M A;  2XQ7 A;  4A98 A;  5HEJ A;  5AFM B;  2XQA A;  5L47 A;  3U8J A;  3ZKR A;  3UQ4 A;  5FJV A;  4ZJS A;  3C79 A;  2W8G A;  3LSV A;  4FRR A;  2YME A;  2XQ4 A;  2LLY A;  2BR7 A;  4HQP A;  3U8N A;  2BYQ A;  3TLV A;  4AFH A;  5J0Z A;  3UU6 A;  4TNV A;  4Z91 A;  2WNL A;  2BG9 B;  1I9B A;  2ZJV A;  2YMD A;  3PMZ A;  3P4W A;  4UM3 S;  5BP0 A;  4TNW A;  4HFC A;  2LM2 A;  3GUA A;  2YN6 A;  4UM1 A;  4ILB A;  4QH1 A;  4X5T A;  2XZ5 A;  4WV9 A;  2MAW A;  2X00 A;  3WTL A;  5AFM A;  4ZRU A;  4HFB A;  4LML A;  2XZ6 A;  3JAF A;  5J5G A;  5HCJ A;  2WZY A;  2XNT A;  3SIO A;  2BYR A;  2XNV A;  4BQT A;  3P50 A;  2Y58 A;  2BG9 C;  4TWH A;  2ZJU A;  2XNU A;  4D01 A;  1UX2 A;  5TVC A;  5IUX A;  5CO5 A;  4HFH A;  4ZK1 A;  4AFG A;  4HFE A;  1UV6 A;  2WN9 A;  3RQU A;  4A97 A;  2PH9 A;  3WTK A;  4UM3 P;  3RIF A;  2Y54 A;  5LXB A;  4ILA A;  5CFB A;  5BW2 A;  4ZJT A;  2YKS A;  2WNC A;  5L4H A;  1UW6 A;  2PGZ A;  5JME A;  4UM3 A;  2XQ5 A;  3WIP A;  3WTI A;  4ZZC A;  5HEG A;  4ALX A;  2XQ8 A;  2LKG A;  3UU3 A;  1OED C;  4ZK4 A;  5AIN A;  3EHZ A;  4AFT A;  3UUB A;  1OED A;  2W8F A;  2Y56 A;  2KSR A;  4IL4 A;  3U8L A;  2BR8 A;  3WTM A;  2M6B A;  3U8M A;  5AFL A;  3TLT A;  4QAC A;  3ZDH A;  4QAB A;  3UU5 A;  4ILC A;  5BRX A;  2Y7Y A;  2BYS A;  3UU8 A;  3SQ9 A;  5AFK A;  5AFJ A;  2QC1 B;  4COF A;  2C9T A;  5AFN A;  5J5I A;  3TLS A;  4QAA A; 
#chains in the Genus database with same CATH topology
 2XQ3 A;  4H9S E;  2PBI A;  1T72 A;  1OED B;  1IAP A;  3LBX B;  5KDM C;  4H63 H;  4UXN B;  4UV9 B;  2UU9 T;  2JIW A;  4QH5 A;  3UUL A;  3UT5 E;  5L3B B;  2BBH A;  2JQK A;  3SQ6 A;  2XAJ B;  3HKB E;  4EEB A;  5HEH A;  1WLX A;  3Q5W A;  1KNZ A;  4E7Z A;  1GQE A;  5J5F A;  3PEO A;  3WAJ A;  4EAH A;  3U8J A;  2IML A;  2IC9 A;  2VB6 A;  3NRX A;  4GKJ T;  1D1B A;  4JEH B;  4TNW A;  3FZL B;  4MBQ A;  2XZ5 A;  4X5T A;  3WTL A;  2ODV A;  3OBV E;  2L3L A;  3CK6 A;  1WFD A;  5L2L A;  5AQH B;  1M7K A;  5FY7 A;  3UUM A;  4JI8 T;  3BQI A;  3CIR A;  4WNK A;  4ILA A;  2KZ7 B;  2CCQ A;  1UW6 A;  1N36 T;  2BKO A;  5HEG A;  4ANJ A;  1UUR A;  3RIU A;  4ZK4 A;  1YW0 A;  5AFL A;  2UXN B;  4O4I E;  3K3Q C;  3K3O A;  4ILC A;  2BYS A;  2CE7 A;  4JI2 T;  2R6G F;  4YTM A;  5AQK B;  4P0B A;  5GON E;  3D0T A;  5JDH A;  5KZU A;  2YIN A;  1UK5 A;  2WBL A;  3CKD A;  1SA0 E;  4TV9 E;  3GA8 A;  2BJ0 A;  4AXP A;  4OFZ A;  2W0G A;  3P4R A;  3FZK B;  2Q9Q B;  1WRD A;  2BYP A;  4QXH B;  2VQE T;  2XQ9 A;  1SE7 A;  2IIU A;  2V6Y A;  5ABG A;  4WBN E;  1HNX T;  1HTJ F;  1XWM A;  3A5X A;  2J62 A;  1OED E;  4YSY A;  2XQY A;  4PJL A;  2XQA A;  4G2A A;  2HN2 A;  5FJV A;  2DWK A;  2BBJ A;  2DHR A;  2MOZ A;  5HWY A;  1HG5 A;  2X0L B;  4MAL A;  3JCF A;  4ILB A;  4PW8 A;  5IHY A;  2BYR A;  5DQV A;  4LF4 T;  1ZKE A;  3P4S A;  2JQQ A;  1MND A;  2I59 A;  3PE0 A;  2CA5 A;  4DR6 T;  3PUX F;  4DID B;  4U7I A;  2WQY A;  4JI3 T;  5JRC A;  2VKD A;  1Y01 A;  2MPK A;  3VKH A;  1KF6 A;  2CM0 A;  4NIQ A;  5AIN A;  1UUS A;  2KWI B;  3P4Q A;  4PK4 A;  2CXL A;  2IUB A;  4EYU A;  4KHP T;  3ZCI A;  1FMV A;  4K0U A;  3RYF E;  5BR8 T;  5AFJ A;  4COF A;  2ZM6 T;  3ZN1 B;  4LF6 T;  5JVD E;  2XAG B;  3KIN B;  4YLH A;  2WMO A;  2BS3 A;  3AXJ A;  1HNW T;  3WTJ A;  1CHU A;  3C79 A;  3JAE A;  4EYY R;  1T8B A;  3RIA A;  1T7S A;  3K8P C;  2NTX A;  1YD8 G;  3OVU A;  4JYA T;  1I94 T;  3AEE A;  4DR2 T;  2BS4 A;  3LFM A;  3V5U A;  5FMN A;  2V7I A;  5C3J A;  2H89 A;  4KX6 A;  5HXC A;  1J5E T;  3RH3 A;  2YME A;  3U8N A;  2XJ7 A;  5J0Z A;  2VK9 A;  4O4L E;  3F31 A;  3UFE A;  3S4U A;  1MMA A;  1NEN A;  4YHJ A;  4HFB A;  3RF1 A;  2QRX A;  4JI7 T;  3HKC E;  4BJN A;  4PJN A;  4AFG A;  2DWG A;  1BR1 A;  1UV6 A;  2YEV C;  1WCR A;  3Q5X A;  4CXX A;  2Q9Q A;  5FVL A;  5IYZ E;  1ZP0 A;  4UEM A;  1MNE A;  2I6H A;  2NP9 A;  2OA5 A;  1KNR A;  5LJM A;  2LM9 A;  3QB5 K;  5JQG E;  5C2T A;  4K0K T;  3RRC A;  1XMQ T;  1OED A;  4JBW F;  1OWA A;  2VKO A;  3KV9 A;  2CXD A;  2Y7Y A;  4TX5 A;  5AFK A;  4I55 E;  1MMD A;  5EK3 A;  3VR8 A;  4AIU A;  3L39 A;  1R8I A;  4QHO A;  4F6R C;  1BR4 A;  2EHO D;  2LRK A;  4X66 T;  3PDY A;  3PUR A;  2CWY A;  4HFI A;  4PIR A;  2Q9Q D;  1G8X A;  2K9A A;  5L3D B;  3C51 A;  3JAD A;  4WZX A;  1E7P A;  3B57 A;  5ADX L;  3ZMU B;  5KXJ A;  5L47 A;  4JEU B;  3RC8 A;  3KV6 A;  5LBQ B;  3GMI A;  1W9R A;  3PUY F;  4HKA A;  4HFC A;  3LBX A;  2X66 A;  4UEL A;  3ANW A;  3RC3 A;  2W63 A;  2CEA A;  4KMC A;  3IHR A;  2Y8D A;  2LJL A;  2XNU A;  1WR6 A;  3P8C D;  2YDQ A;  5CA0 E;  3JC6 C;  2PH9 A;  2I0M A;  3A7M A;  2W2U A;  1OXZ A;  2UXX B;  3ZST A;  2C5K T;  4GKK T;  1HCI A;  4B6X A;  4ILU A;  3C4X A;  1YXR A;  4CI1 B;  1X9B A;  4YHH T;  3ZPO A;  5J2U E;  3T1H T;  4YSZ A;  3UU5 A;  4ISS A;  4DUY T;  4YT0 A;  1D0X A;  4OX9 T;  2KND A;  2VQF T;  4HWC A;  5LMU T;  1D1A A;  4AKR B;  2ES0 A;  5JDG A;  5E0O A;  4DV6 T;  4DBQ A;  4ZR6 A;  2ZM2 A;  4B3S T;  3Q9D A;  4C91 A;  1CUN A;  1J1J A;  3DTO A;  5AQR B;  1BR0 A;  2V6X A;  3Q2M A;  2D0U A;  2X00 D;  4G63 A;  3AEG A;  3LSV A;  4IDQ A;  4TN7 B;  4TNV A;  4YY3 T;  3KV4 A;  3P4W A;  4ZXL A;  3VHL A;  3OJA A;  3ZN0 B;  3GUA A;  4O8S A;  2MAW A;  3RYC E;  4DV3 T;  4UR9 A;  3NVO A;  3CQG B;  3ZMT B;  4BQT A;  2XUE A;  2UXD T;  5CGM A;  3M65 A;  4DO0 A;  3GN5 B;  2MTQ A;  4BJM A;  2E5L T;  5IUX A;  1HFA A;  4HFH A;  4CZZ B;  4A97 A;  4JLE A;  1UGO A;  4ZJT A;  3W15 B;  2PGZ A;  3ZEF B;  4UM3 A;  3AAE B;  1Z8U A;  4ADZ A;  1E1H B;  3UUB A;  3FHN A;  2YDS A;  4ZHQ E;  4PAG A;  3OYZ A;  2RA1 A;  4AKH A;  4GK5 E;  3AE2 A;  4MLK A;  4O4H E;  2PJQ A;  4CQI A;  5AQG B;  5LXT E;  3CX6 B;  3N9Q A;  4HFV A;  2A3D A;  4IIJ E;  2ODU A;  2PFV A;  2ZM8 A;  4DMW A;  4LFB T;  4H9P C;  3ONL C;  4IL9 A;  4NZB A;  3MXZ A;  5LMN T;  2WMN A;  5HXS A;  2VUR A;  1YKH B;  4QWN B;  3LDQ B;  2CWO A;  2W8G A;  5FKY A;  3ETU A;  1IJ6 A;  1XDO A;  4PJM A;  2XAF B;  1KEY A;  4WV9 A;  3RYI E;  2JQH A;  3T1Y T;  5AQV B;  3WAK A;  2WDR A;  2XNV A;  3NKZ A;  2H7O A;  2W00 A;  1HR0 T;  2Y58 A;  3ZJ1 A;  3AEB A;  4PK6 A;  3AVR A;  4U3C A;  4LF8 T;  2X67 A;  5JR9 B;  3HI2 A;  4HWD A;  2LKG A;  1XMO T;  4CI3 B;  2V26 A;  1XZY A;  4P09 A;  4IE0 A;  5J1G A;  4LF5 T;  2XZE A;  2WAU A;  1KFY A;  2E5V A;  4UF0 B;  1XDP A;  2ACZ A;  2IC6 A;  4DR5 T;  2LT3 A;  3SRZ A;  2BG9 E;  2CBJ A;  4AQF C;  5AQN B;  2H3R A;  2HN1 A;  2C5I T;  3ZMZ B;  4XK9 A;  3E0Z A;  3MAC A;  3B5M A;  2WNJ A;  3LJC A;  1U5P A;  2WS3 A;  4IE5 A;  4TZ4 C;  2Y6X A;  1VRB A;  2XQ7 A;  5HEJ A;  4EV6 A;  3PUQ A;  2XQ4 A;  3CQC B;  4EOZ B;  2BYQ A;  2V5D A;  3L3P A;  3AEF A;  1W0A A;  2IDO B;  1HS7 A;  2YN6 A;  3I1A A;  5AFM A;  1J5W A;  2WB5 A;  2XZ6 A;  3JAF A;  3L8R A;  3ONX A;  2X0Y A;  4IGU A;  3HKE E;  2W61 A;  5AQP B;  3N9P A;  5TVC A;  4IE7 A;  2HHH T;  1US7 B;  3NWI A;  3JC6 D;  1V9D A;  3H3A A;  2WWV A;  2CPT A;  3FBZ A;  1WYB A;  2ZLY A;  4O2A E;  2Y56 A;  2BR8 A;  3WTM A;  3N9L A;  4L5G A;  5LG4 A;  2CLY B;  3ZDH A;  3ZC0 A;  3UUX B;  3J7Y q;  5IWA T;  4KHZ F;  4OYK A;  3TLS A;  2BKP A;  3N2K E;  2AE9 A;  5KMG P;  3ZT6 A;  1MIW A;  3EAM A;  5L3G B;  1D0Y A;  5ETW A;  4QH4 A;  1DU2 A;  4LMJ A;  5LB7 B;  4CN1 A;  2LHN A;  4EZ4 A;  4ZI3 D;  3CML A;  3EI0 A;  3G06 A;  5HXR A;  3ZMS B;  5FXW A;  3QC9 A;  4EIW A;  3RKO A;  2JQ9 A;  1MIV A;  3AEC A;  2WZH A;  3KBT A;  2XM2 A;  3PV0 F;  3WTN A;  3FZH B;  4IDN A;  1HX8 A;  2MYS A;  3IA3 A;  3ZLI A;  2LLY A;  2E9X B;  1IJ5 A;  4UVA B;  3EDU A;  2W4X A;  5DJQ C;  4CI2 B;  4QH1 A;  3I9W A;  1WYC A;  3C98 B;  5HCJ A;  2VVS A;  3SOL A;  3UUN A;  4GYR A;  4HEA A;  4UM3 P;  2AXD S;  3AED A;  1YQ3 A;  2LSJ A;  5JME A;  3NRY A;  2P9B A;  1MMN A;  2NWB A;  5FY0 A;  5JRE A;  4B3M T;  2KSR A;  4X64 T;  2NTY A;  5F3J A;  1M62 A;  4U72 A;  1KK7 A;  5JTG A;  4X65 T;  4HE8 A;  3VRB A;  2V7K A;  3KDS E;  4A56 A;  4DV2 T;  4HN9 A;  4ZZB A;  2EHO A;  2NW8 A;  2YOE A;  2CXF A;  3EAB A;  3RI5 A;  1QSD A;  2EHO B;  5HEU A;  3UU4 A;  4AQY T;  1JNZ A;  1VCS A;  4FJO A;  1YQ4 A;  3O9X A;  3P7I A;  4KBM B;  4LMK A;  4IRE A;  4NUU A;  2UZ6 A;  2BZB A;  5CJ5 A;  3ZDG A;  5J5H A;  1L0V A;  5H6R B;  4BFQ A;  4B5D A;  3TLU A;  1JNR A;  1IBM T;  1WR0 A;  2C5J A;  4TUY E;  5LP6 E;  5FY1 A;  5AFM B;  2XAQ B;  3PTR B;  3AA1 B;  4ZJS A;  1W09 A;  2HPJ A;  4FRR A;  4ZOL E;  4AFH A;  2E2A A;  2BVL A;  4O2B E;  1I9B A;  3PMZ A;  2UXB T;  4U74 A;  2V7M A;  4ZI2 C;  1T98 A;  3A8Y C;  2D2S A;  2XY8 B;  4IHJ E;  4YTP A;  4NXM T;  5EZY E;  3VKG A;  2UUA T;  2FJB A;  5HXE A;  2H88 A;  3P50 A;  2BG9 C;  4DV0 T;  2LSY A;  1UX2 A;  2V7L A;  3N9N A;  3I0Q A;  3VU7 H;  4U33 A;  1N33 T;  2WP9 A;  4IDZ A;  3KVA A;  2LE8 A;  5JDN A;  2KLQ A;  3RPU A;  3EHZ A;  2UXC T;  2M6B A;  2A9U A;  3QOF A;  3RGL A;  4BA9 A;  4MHC A;  2VKH A;  5FL0 A;  4ZS2 A;  2C0S A;  1D1C A;  5FP3 A;  2V1D B;  4JI6 T;  3LK2 B;  4OYJ A;  3ZYL A;  5DAB A;  1U4Q A;  2FUP A;  2NOX A;  4WYV A;  2KT9 A;  2XTL A;  2CMR A;  5HWX A;  3SH1 A;  5JDM A;  4DR1 T;  3PUA A;  5HYA A;  3M3Z B;  3PJA A;  3IGQ A;  2X68 A;  4U2Y A;  4EZ1 A;  4N78 D;  4IDP A;  1S35 A;  1MIY A;  5HCM A;  3EVY A;  3WTH A;  2CHO A;  5JR9 C;  2LSK A;  4JI0 T;  1NEK A;  5F5W A;  2A72 A;  3R84 B;  4AKI A;  5JDF A;  3TLV A;  3IBP A;  2CHN A;  3BQL A;  5TAO A;  4LML A;  2WU2 A;  4BAY B;  5AFU L;  4DV5 T;  4HWI B;  2LSI A;  4PJJ A;  4DR7 T;  4GK0 E;  2QYW A;  3AVS A;  3AE6 A;  5CFB A;  2IHR 1;  4M1P A;  4QXC B;  3PUS A;  4MFR A;  3O1J A;  4P1N A;  4ZZC A;  5LGT B;  2XQ8 A;  4HGA A;  3UU3 A;  2V8S V;  2YU2 A;  3UTK A;  4YSX A;  2A2F X;  1IBK T;  2D0T A;  3TKL B;  4U2Z A;  2JMK A;  1I6Z A;  4J2C A;  2XPK A;  1B7T A;  2LOS A;  5FXV A;  2WDQ A;  2VVN A;  1EZ3 A;  1LVK A;  4H9R C;  2B76 A;  2IAK A;  3E08 A;  5AQI B;  3B13 A;  4HWF A;  3KVB A;  4UXU A;  2G0U A;  3RQW A;  1XNQ T;  2XYS A;  4F8H A;  3OPC A;  2OLT A;  4EXT A;  3V5S A;  4UV8 B;  2XYT A;  5LOV E;  3N5L A;  4YFS A;  5LA6 E;  4UVC B;  4OK0 A;  5AQM B;  5AFH A;  3U8K A;  4Z90 A;  3ZJ2 A;  5LGN B;  2N1G A;  3ZT5 A;  4DV4 T;  4H9O C;  3O1I A;  4Z8X A;  3UQ4 A;  1SHZ C;  4AKL A;  5AQU B;  2DCF A;  2E9X D;  1Z0P A;  3AA6 B;  3FXE B;  4X1K E;  4Z91 A;  2VL8 A;  2VAS A;  2K5B B;  4IST A;  4AIS A;  4HWH A;  4X1Y E;  2NW9 A;  3AE4 A;  3OYX A;  3HKD E;  4X1I E;  3SIO A;  4UVB B;  3ONJ A;  3ZMV B;  4GYS A;  4EED A;  5LJN A;  4ZK1 A;  3N2O A;  5AQL B;  3SWH A;  2HH7 A;  3UFG A;  5BW2 A;  1LKX A;  3ZT7 A;  5L4H A;  4JI1 T;  1G73 A;  3QK6 A;  1UX4 A;  4CXW A;  4AQG A;  1HNZ T;  3K1S A;  3DJB A;  2H7V C;  2W67 A;  1FMW A;  4I0U A;  3QNU A;  3ZC1 A;  2QC1 B;  3MK7 C;  3EDV A;  3PU8 A;  2YU1 A;  2DL1 A;  3UQ7 A;  3FZF B;  4UY2 A;  2W66 A;  4P0A A;  4XHE A;  3ZCJ A;  2X51 A;  2Y57 A;  5ABH A;  2ZMA A;  2UUB T;  4DVD A;  4I43 B;  4U7Y A;  4FI5 A;  2J4G A;  5M4Y A;  3MA9 A;  5EK4 A;  3GWH A;  3N2G E;  2J1D G;  3I9Y A;  3O1H A;  4PFO A;  4DBM A;  4ZEY A;  3C84 A;  1HX1 B;  5LG3 A;  2V7J A;  4ZS3 A;  2CLY C;  2X9W A;  3T4M A;  3ZKR A;  1MMG A;  5JDL A;  1N32 T;  1UCU A;  4EB6 E;  5CA1 E;  2X0H A;  3VRA A;  4HQP A;  5EK2 A;  5HXH A;  5FNV E;  3AE9 A;  2PTF A;  2WZI A;  2WNL A;  4UM3 S;  5BP0 A;  3ANW B;  3AAI A;  2CBI A;  4YJ3 E;  2LM2 A;  3RX6 A;  2M67 A;  3AB3 B;  2Y48 B;  3PUG A;  5AQQ B;  2FBW A;  2SPC A;  3QUJ A;  4ASK A;  4KI0 F;  2JMH A;  4YXD A;  5CO5 A;  3HA4 A;  2E9X C;  3H37 A;  5JR9 A;  3O4X E;  3U78 A;  5AQT B;  3MZK B;  5LCY A;  5JH7 E;  3ZYK A;  2IW5 B;  3WTI A;  3F57 A;  3KFW X;  3LG7 A;  2L9Q A;  5ABE A;  3AE1 A;  1O3X A;  3CPZ A;  5LGU B;  5BRX A;  5FXZ A;  2L8K A;  5BMV E;  3VR9 A;  5J5I A;  1ZEE A;  4A5X A;  5KE4 A;  2M6I A;  3R6N A;  2VL0 A;  5AQF B;  2NR4 A;  5SYO A;  3LK3 B;  4IDO A;  4TWF A;  2W62 A;  4NPP A;  4HFD A;  3TLW A;  2UUC T;  2ZM0 A;  4TWD A;  2XAS B;  2X9Y A;  2YK0 A;  2E8I A;  2K48 A;  2D5U A;  3PUV F;  2DI4 A;  3AE3 A;  2LHR A;  3SFD A;  4DR4 T;  4X20 E;  4DR3 T;  5LBM A;  1AJ3 A;  4EZH A;  1QLB A;  1BR2 A;  3FXD B;  2E9X A;  2JJ9 A;  3ESL A;  4H63 V;  4ERR A;  4E7S A;  3UU6 A;  4AQF A;  2V5C A;  4O4J E;  2N2N A;  4QXB B;  3P4P A;  1LVF A;  2N9D A;  5HAX A;  3BQK A;  3LK4 2;  3MJX A;  4IE6 A;  1HF8 A;  4ZRU A;  3WI3 A;  4I4T E;  4NXN T;  2WZY A;  5LYJ E;  3NBX X;  3RYH E;  4DV1 T;  2F4V T;  4KUM B;  3NZQ A;  2X9H A;  1HG2 A;  4EGW A;  4YTN A;  4WBO A;  4XBF B;  4XZC A;  2WY2 A;  3N9O A;  4CN4 A;  3AE7 A;  4HTE A;  3ABV A;  5LNK A;  2W8F A;  3C4W A;  4TV8 E;  3AE5 A;  3U8M A;  3PU3 A;  4B3R T;  4QAC A;  3NZP A;  3SQ9 A;  5AFN A;  2K3W A;  3SS1 A;  4YJ2 E;  4CN6 A;  2LSG A;  4V1A v;  1ZHC A;  4ZI7 E;  1QUU A;  4LFA T;  5ABF A;  4PNI A;  2KMF A;  2ACX A;  3PUW F;  2DNX A;  4QX7 B;  2J47 A;  5A1L A;  5FYM A;  1VCT A;  2XAH B;  4CXY A;  3H3M A;  3WTO A;  4KP3 C;  5J2T E;  2X9X A;  2YDR A;  5CB4 E;  3SFE A;  3RHW A;  2LRL A;  3U3I A;  4I50 E;  1NAF A;  2RPA A;  3DP7 A;  3Q5E A;  1FJG T;  4IT4 A;  2ZJV A;  4ZI2 D;  4DND A;  4Q25 A;  5FL1 A;  2FJA A;  2X00 A;  2KXP B;  1VOM A;  5JRC B;  1SUM B;  5KX5 E;  3ETV A;  5C8Y E;  3RQU A;  3QB5 A;  4DMV A;  3PUZ F;  3RIF A;  5LXB A;  2WNC A;  5L3E B;  5AQO B;  2WM9 A;  2V6Y B;  3AEA A;  3RLF F;  5L3C B;  1OED C;  2BDE A;  1FEW A;  3FBL A;  4AFT A;  4WW0 A;  1D0Z A;  4LFC T;  4QAB A;  2JPF A;  4UIG A;  1X79 A;  2HPL A;  2Q9Q C;  5JDQ A;  2WSS V;  3ZYM A;  4QX8 B;  2BYN A;  2XM1 A;  2RP4 A;  2BG9 A;  3HR0 A;  4X62 T;  2XQ6 A;  1UX5 A;  3FB2 A;  4LF7 T;  3OKQ A;  1YKE B;  5L4E A;  3C64 A;  4NUV A;  3RIU C;  5LHI B;  3N9M A;  1KNP A;  4DV7 T;  3AXJ B;  4JUY A;  4PFP A;  2BVM A;  4A98 A;  3FZM B;  1ZV4 X;  4PK5 A;  4AI6 A;  1Y64 B;  1FIO A;  2BR7 A;  2K24 A;  2BS2 A;  3C4Z A;  2BG9 B;  5L3F B;  1ZOY A;  2YMD A;  4L0R A;  3E22 E;  3ZSS A;  2XHE B;  2CRB A;  2JRK A;  2KWH A;  5LHH B;  4QKN A;  4C90 A;  2XSB A;  3HL6 A;  4AKG A;  5J5G A;  3L09 A;  2QVA A;  4DUZ T;  2ZJU A;  2WN9 A;  4GOU A;  2Y54 A;  3I0O A;  3IEE A;  5AQJ B;  5FXX A;  2KIN B;  2WDV A;  4XAX B;  2XQ5 A;  2FJE A;  1W0B A;  2QA7 A;  2VWA A;  5AQS B;  1H7C A;  3CQX C;  3TLT A;  2XSA A;  3KV5 A;  3UU8 A;  3AA7 B;  3F2E A;  3CVR A;  2PG8 A;  3MKD A;  3AE8 A;  4IE4 A;  3T8O A;  2LEH A;  3CX7 B;  1N34 T;  3AAA B;  2MBG A;  2VKJ A;  5HEO A;  3PJA J;  3RRW A;  3BK9 A;  3GN5 A;  3IF8 B;  4JI4 T;  4OHF A;  2WCA A;  5LHG B;  1IZN B;  2FJD A;  4UF0 A;  4H9N C;  2LKH A;  2B1E A;  2Z6E A;  2DLR A;  2WU5 A;  2EHO C;  4U31 A;  3AA0 B;  1E2A A;  3CX8 B;  2GK9 A;  2WWU A;  4H9Q C;  3J9X 1;  2LOP A;  4L9I A;  5DQW A;  4UM1 A;  2OV9 A;  4LF9 T;  2XNT A;  4JV5 T;  2BKN A;  4ZI3 C;  4TWH A;  2D9D A;  4B3T T;  1S94 A;  4D01 A;  1XNR T;  3K3N A;  3X1D A;  4HFE A;  3WTK A;  3CWZ B;  5ABF B;  4GIW A;  2YKS A;  5FVK A;  3RKG A;  2NW7 A;  3WIP A;  3KBU A;  4ALX A;  2QGS A;  4IL4 A;  3U8L A;  4JI5 T;  3C50 A;  1NWM X;  3Q5D A;  5F8P A;  3OTO T;  1IBL T;  3EUH A;  2C9T A;  1LRZ A;  4QAA A;  5H6Q B;  4DBR A; 
#chains in the Genus database with same CATH homology
 5KE4 A;  5KZU A;  3UQ7 A;  2BYN A;  2M6I A;  2VL0 A;  4UY2 A;  2BG9 A;  2XQ3 A;  3EAM A;  4XHE A;  1OED B;  4ZZB A;  2YOE A;  2XQ6 A;  4QH4 A;  5SYO A;  4UXU A;  3RI5 A;  4LMJ A;  2Y57 A;  2BJ0 A;  4TWF A;  3WTJ A;  3TLW A;  4NPP A;  4HFD A;  5HEO A;  5HEU A;  3RQW A;  3UU4 A;  4ZR6 A;  4LMK A;  4QH5 A;  2BYP A;  2UZ6 A;  2XYS A;  2BG9 E;  3JAE A;  4IRE A;  4TWD A;  4F8H A;  3EI0 A;  2XQ9 A;  4PIR A;  4HFI A;  5L4E A;  3SH1 A;  3RIA A;  3ZDG A;  5J5H A;  3SQ6 A;  2XYT A;  4BFQ A;  3IGQ A;  4XK9 A;  4B5D A;  4IL9 A;  4NZB A;  3WTO A;  5HEH A;  3TLU A;  4EZ1 A;  2LKH A;  2WNJ A;  4DBM A;  5AFH A;  3C84 A;  3U8K A;  3JAD A;  4Z90 A;  3WTN A;  3RHW A;  5HCM A;  5LG3 A;  3PEO A;  5J5F A;  2X00 D;  1OED E;  3WTH A;  3T4M A;  2XQ7 A;  4A98 A;  5HEJ A;  5AFM B;  2XQA A;  5L47 A;  3U8J A;  3ZKR A;  3UQ4 A;  5FJV A;  4ZJS A;  3C79 A;  2W8G A;  3LSV A;  4FRR A;  2YME A;  2XQ4 A;  2LLY A;  2BR7 A;  4HQP A;  3U8N A;  2BYQ A;  3TLV A;  4AFH A;  5J0Z A;  3UU6 A;  4TNV A;  4Z91 A;  2WNL A;  2BG9 B;  1I9B A;  2ZJV A;  2YMD A;  3PMZ A;  3P4W A;  4UM3 S;  5BP0 A;  4TNW A;  4HFC A;  2LM2 A;  3GUA A;  2YN6 A;  4UM1 A;  4ILB A;  4QH1 A;  4X5T A;  2XZ5 A;  4WV9 A;  2MAW A;  2X00 A;  3WTL A;  5AFM A;  4ZRU A;  4HFB A;  4LML A;  2XZ6 A;  3JAF A;  5J5G A;  5HCJ A;  2WZY A;  2XNT A;  3SIO A;  2BYR A;  2XNV A;  4BQT A;  3P50 A;  2Y58 A;  2BG9 C;  4TWH A;  2ZJU A;  2XNU A;  4D01 A;  1UX2 A;  5TVC A;  5IUX A;  5CO5 A;  4HFH A;  4ZK1 A;  4AFG A;  4HFE A;  1UV6 A;  2WN9 A;  3RQU A;  4A97 A;  2PH9 A;  3WTK A;  4UM3 P;  3RIF A;  2Y54 A;  5LXB A;  4ILA A;  5CFB A;  5BW2 A;  4ZJT A;  2YKS A;  2WNC A;  5L4H A;  1UW6 A;  2PGZ A;  5JME A;  4UM3 A;  2XQ5 A;  3WIP A;  3WTI A;  4ZZC A;  5HEG A;  4ALX A;  2XQ8 A;  2LKG A;  3UU3 A;  1OED C;  4ZK4 A;  5AIN A;  3EHZ A;  4AFT A;  3UUB A;  1OED A;  2W8F A;  2Y56 A;  2KSR A;  4IL4 A;  3U8L A;  2BR8 A;  3WTM A;  2M6B A;  3U8M A;  5AFL A;  3TLT A;  4QAC A;  3ZDH A;  4QAB A;  3UU5 A;  4ILC A;  5BRX A;  2Y7Y A;  2BYS A;  3UU8 A;  3SQ9 A;  5AFK A;  5AFJ A;  2QC1 B;  4COF A;  2C9T A;  5AFN A;  5J5I A;  3TLS A;  4QAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...