4QH1A

The glic pentameric ligand-gated ion channel (wild-type) in complex with bromoacetate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein, transport protein
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh1A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh1A01
3UU8A 3EI0A 4D01A 2LKGA 3U8MA 1OEDB 5HEGA 4Z91A 2Y54A 3RI5A 5HEJA 4HQPA 4ZZBA 3JAFA 5FJVA 4XHEA 4ILCA 2XQ4A 4HFEA 4HFIA 4TWHA 4QACA 4UM3P 5AFMB 3TLWA 3RIAA 3C84A 3WTKA 4QH4A 4TWDA 4ILAA 5J5GA 2UZ6A 4LMKA 4UXUA 3ZDGA 2W8FA 2YMEA 3JADA 3RQWA 5JMEA 4WV9A 2XYTA 5BW2A 3JAEA 2BG9B 1OEDE 2LM2A 5J5FA 5J0ZA 5SYOA 2BR7A 3P50A 2LLYA 2YMDA 4BQTA 5J5HA 4ZJSA 2WNLA 4HFCA 2MAWA 4QAAA 4TNWA 4F8HA 3UQ7A 2BYQA 2BYRA 2PGZA 5AFJA 2XQ9A 2ZJUA 3SQ6A 4BFQA 4LMJA 3UQ4A 3EHZA 4A97A 1UX2A 4X5TA 4ZRUA 1OEDC 2XZ6A 4QABA 4ZK1A 4TWFA 5HEUA 1UV6A 4ZK4A 4NZBA 2VL0A 3EAMA 4AFTA 4EZ1A 5J5IA 2XYSA 4UM3S 3IGQA 2BG9E 3PEOA 4UY2A 3U8JA 3U8LA 5AFHA 3U8KA 3WTLA 5LG3A 3T4MA 2BYSA 2Y7YA 2YN6A 5HEOA 3TLUA 2M6IA 5L4EA 3WTMA 4XK9A 1I9BA 2KSRA 5HCJA 4FRRA 3WIPA 2XZ5A 2BG9C 3TLSA 4UM3A 4ZR6A 4IL4A 2BR8A 3PMZA 3LSVA 2ZJVA 3UU5A 3UU3A 2XQ3A 4ILBA 3RQUA 3RHWA 4A98A 2Y56A 4HFHA 4ALXA 5AINA 4TNVA 1OEDA 2PH9A 4AFGA 2X00A 4Z90A 2XNTA 5BRXA 3ZDHA 4QH5A 2QC1B 3GUAA 4LMLA 4COFA 5KZUA 2XQ6A 3C79A 5AFLA 5LXBA 5AFMA 2WNCA 4HFDA 4B5DA 3SQ9A 3RIFA 4ZZCA 5HEHA 2XNUA 2XQAA 5CFBA 2YKSA 3UU4A 2BYNA 5TVCA 3UUBA 2LKHA 3TLTA 4PIRA 5IUXA 3SIOA 4DBMA 2XQ5A 5KE4A 3SH1A 3WTIA 2BG9A 3TLVA 2XNVA 2WN9A 4HFBA 2YOEA 5AFKA 5AFNA 2XQ8A 2W8GA 2XQ7A 5CO5A 3WTHA 5BP0A 4IREA 3UU6A 3ZKRA 2WNJA 5HCMA 5L47A 3WTJA 2M6BA 4QH1A 4ZJTA 3P4WA 2C9TA 3WTNA 3U8NA 4IL9A 2Y57A 2X00D 2WZYA 2BYPA 2Y58A 4UM1A 4AFHA 2BJ0A 1UW6A 5L4HA 3WTOA 4NPPA
chains in the Genus database with same CATH superfamily
2WQYA 5FY7A 3PU3A 3PTRB 4HFEA 3QOFA 4L9IA 4ASKA 4HWIB 4X20E 3RRCA 2N9DA 3ZCIA 5AQLB 5F3JA 5J2UE 3HI2A 1Y01A 3LBXA 3AE5A 5C2TA 2HN2A 2AE9A 3SQ6A 2ZJUA 4DR7T 2ZLYA 3RH3A 2WDRA 3IGQA 4QXCB 4UY2A 2JQ9A 3AE8A 2CHNA 1FEWA 5FVKA 3TLSA 4ZR6A 4PJJA 3CQCB 5FKYA 3RIUA 2ZM0A 4P09A 5C8YE 4QH5A 3CX7B 2QC1B 3Q5XA 3IA3A 2A9UA 3GUAA 5AFLA 5AFMA 3EDVA 5LOVE 4N78D 4PNIA 5C3JA 3E08A 4XZCA 4QXHB 4IE7A 5IUXA 2KNDA 4H9OC 1ZOYA 2UXDT 2BBJA 2DHRA 2X0LB 1UGOA 1ZP0A 5BP0A 4WNKA 3IEEA 2M67A 3FZKB 5AQNB 5FYMA 5EK2A 2H7VC 4TV9E 1W0BA 1YKEB 4IL9A 3BK9A 4AQGA 1MNEA 5E0OA 3SOLA 1VRBA 4WW0A 4X62T 5HEGA 3NVOA 4Q25A 3FZMB 3GN5A 4E7SA 4FJOA 3N9NA 4U7YA 5JRCA 3JADA 3DTOA 1D1BA 2YDRA 4I55E 3KINB 2CWOA 2LM2A 5LG4A 3PJAA 3HR0A 3C4ZA 2C5JA 3A5XA 4IE4A 4YHJA 4HFCA 2MAWA 1KF6A 2VL8A 3FXEB 1HNWT 4GKJT 2YU1A 3CIRA 3PUGA 3K3QC 1JNZA 3PEOA 1VOMA 3RLFF 5J1GA 4H9NC 2FBWA 3ANWB 2M6IA 2A72A 1HF8A 5HCJA 2D9DA 5CA0E 2BG9C 5J2TE 4NUUA 2VVNA 4AKLA 3RQUA 3RHWA 4IDPA 1OEDA 4I50E 4LMLA 2XQ6A 5LJNA 2E9XD 5DQVA 4ANJA 1BR1A 3ZN1B 4BA9A 3AAEB 3F31A 3L8RA 2VKJA 1YXRA 2Y8DA 3UUNA 2MOZA 4KX6A 3KV9A 2WNJA 3ZMUB 3OYZA 2YINA 4QX7B 2K9AA 1US7B 4U3CA 3HL6A 5KDMC 2V8SV 5L4HA 3AE2A 2BKOA 2VKHA 1OWAA 2OLTA 4ZS2A 3Q5DA 4H9QC 4TWHA 4TWDA 1S94A 3RYIE 4HFVA 3I9YA 5LB7B 4DV7T 2BKNA 2ACZA 4UVBB 1IJ6A 2D2SA 4F8HA 2XQ9A 4LMJA 3ZLIA 1E1HB 3UUXB 1IBKT 4JI7T 5HEUA 5AQFB 3ZEFB 4TV8E 4CXYA 4PW8A 2WS3A 4U74A 3WTMA 4ZS3A 4X66T 4UM3A 4DV5T 1ZKEA 2P9BA 4IDZA 2WCAA 1KNPA 4H9SE 3C79A 2W2UA 4EAHA 3RIFA 4ZZCA 4DUZT 3ETUA 2CWYA 2YKSA 5JDLA 5L2LA 2X0HA 3FZLB 1MMAA 2UXCT 2B1EA 2NOXA 4IE6A 2XQ7A 2BS4A 4HE8A 2YEVC 5L47A 2RA1A 3C51A 2Q9QC 2LOSA 4DV0T 2X00D 2Y58A 2J1DG 2XPKA 2JIWA 2PJQA 4WYVA 4DR4T 4BJMA 2XQYA 4HQPA 3AEEA 2X9XA 5FJVA 2Y6XA 3NRXA 5LBQB 5FY0A 4NXNT 2K5BB 2V6XA 2JMHA 5LYJE 4EXTA 3MZKB 5ADXL 5FVLA 2CM0A 3AA7B 4CZZB 4LF5T 5JMEA 1T8BA 4AKGA 3ZPOA 3MJXA 2BG9B 2VVSA 5SYOA 2BS3A 3RF1A 3UQ7A 1YD8G 1YQ4A 5LGTB 2FJAA 5LA6E 3D0TA 2IC6A 1N36T 3PUSA 1S35A 2UUAT 1UURA 4XBFB 5FY1A 2YK0A 3H3AA 3L09A 5L3GB 4G63A 4EEBA 4KP3C 3AAAB 3FHNA 3R6NA 2RPAA 2XQ3A 3KBTA 4ALXA 2NW8A 2XM1A 1T98A 3AEDA 2X67A 3N9MA 1LVFA 4EOZB 3UFGA 2N1GA 2DNXA 4YSZA 1E2AA 5JDQA 4O4JE 3IF8B 4UEMA 3UUBA 3N5LA 3SH1A 4IT4A 3RKOA 2XNVA 2WN9A 3O1HA 3VKHA 4YT0A 2WDVA 4IREA 2V5CA 2QA7A 3WI3A 3I9WA 5ABHA 4O8SA 5HXEA 4P1NA 1QSDA 4TN7B 3FB2A 5ABFB 5FXVA 4M1PA 2WU2A 1UUSA 2WBLA 4MALA 3I0OA 4Z91A 3ZSTA 4NXMT 2PG8A 3GWHA 4JBWF 3I1AA 4DV2T 5LJMA 4AKIA 1D0YA 2W4XA 2H89A 1KFYA 3RX6A 1FIOA 1N34T 1OEDE 4YXDA 4AQYT 2W61A 3ZMVB 2BBHA 5LMNT 1L0VA 4IDOA 5ETWA 4ZK4A 4EZ4A 5AQVB 4MFRA 2IMLA 4AQFA 4DMWA 1NWMX 2IAKA 4A56A 3AE6A 3TLUA 3ZT5A 4WZXA 4GIWA 1FMVA 5LMUT 2BDEA 2CXLA 2XAGB 4KHZF 4ILBA 3QK6A 4TUYE 4X1KE 2Q9QB 3SFDA 5BRXA 3IBPA 5CGMA 2E8IA 5H6QB 2XZEA 3RKGA 3CX8B 4UELA 2XNUA 2BYNA 2KINB 3GA8A 4TZ4C 1NAFA 4JEHB 1M62A 4A5XA 4B3MT 4X65T 4PJLA 1LRZA 4C90A 1X9BA 4GK0E 3CKDA 3VRBA 3AEBA 4CI1B 2XAQB 4NPPA 5AQJB 3RI5A 4L0RA 2MBGA 2EHOA 4UR9A 4AXPA 3C84A 3WTKA 2LRLA 3K3OA 3VR8A 4CN4A 3FXDB 4UV9B 2KWHA 5LHHB 2YMEA 1CHUA 4WV9A 4QX8B 2IW5B 2CRBA 4BQTA 4JYAT 5LCYA 4AKHA 4E7ZA 4ZHQE 3UQ4A 3ZT6A 3RRWA 3M65A 5GONE 5LGUB 2L3LA 3WTLA 4EIWA 2HH7A 2WWUA 3A8YC 3PMZA 3LDQB 4IHJE 3AE7A 2VKDA 2LSGA 4ZI3C 5FP3A 3ZYMA 4IE0A 4COFA 1UX4A 1J5ET 3IHRA 1HFAA 5DJQC 3TLTA 1JNRA 4EGWA 1HX8A 3SS1A 2YOEA 2LOPA 5CO5A 2FUPA 5HCMA 3JC6D 3WTJA 3RGLA 3ZSSA 4NUVA 4HGAA 4ISTA 3AXJB 4PK6A 3OKQA 3UT5E 1XMQT 4UF0A 1M7KA 1XWMA 4U33A 2J47A 2WSSV 3PUVF 4QWNB 4LMKA 1YQ3A 4EYYR 4DR3T 4DVDA 2WP9A 3KDSE 4XAXB 4JI8T 5J0ZA 1WYBA 2GK9A 4JLEA 2LLYA 5ABGA 1W09A 3ZC0A 2WNLA 4O2AE 1U5PA 4DNDA 1IAPA 1OEDC 4QABA 5DABA 4O2BE 3RYCE 3NWIA 2XYSA 3QB5K 5AFHA 2QGSA 4GYSA 4JI0T 1HR0T 2IUBA 2UUCT 2XSAA 2J62A 3N2GE 3ABVA 4DUYT 3WIPA 3PU8A 4B3RT 4IL4A 3ZMSB 5HYAA 2ODUA 2LJLA 3UU3A 3HKBE 5AINA 4YSYA 3LBXB 1HNZT 3SQ9A 3UU4A 3OTOT 2WZIA 1DU2A 3U78A 5JR9C 3SRZA 5AFKA 4B3TT 1BR2A 2LHRA 2X9YA 4PK5A 3ZKRA 5AQHB 5AQSB 2YDQA 3WTNA 2JQQA 2WZHA 3KBUA 2ZMAA 4YY3T 2R6GF 3N9OA 3PUQA 1MIYA 3Q9DA 3FZHB 2E2AA 2XY8B 4HWDA 4UXNB 3Q5EA 1WR0A 4YTMA 5AFMB 2ACXA 3VU7H 2LSKA 3RYFE 2JRKA 4V1Av 2K48A 3P4QA 1T72A 4UVAB 2IDOB 4IE5A 5JH7E 5H6RB 3P50A 2YMDA 2MYSA 3DJBA 3BQKA 1HG5A 1HNXT 1WFDA 2E9XC 3B5MA 1GQEA 5J5IA 4AFTA 1MMDA 3U8JA 5IHYA 2W0GA 1IBLT 3V5SA 3GN5B 2LSYA 4ZI2C 2RP4A 5JRCB 2WB5A 2WDQA 3SWHA 5FL0A 2PH9A 2VKOA 4PJNA 2YU2A 2X9WA 1LVKA 3OBVE 4DR6T 2CE7A 2N2NA 2SPCA 2H88A 3HKCE 1VCSA 3P4WA 3FBLA 2KZ7B 5JDHA 4DR2T 3AA0B 1UW6A 4GYRA 4P0BA 1OEDB 3JAFA 4K0UA 3E0ZA 5HAXA 3KVBA 3OVUA 2BS2A 2WAUA 5AQMB 2FJDA 4WBOA 3PUWF 3C4WA 2I0MA 4H63H 2PGZA 1FJGT 3ZMZB 3EHZA 4PFOA 4A97A 4DO0A 4NIQA 5ABFA 3AE3A 3PURA 2CA5A 4AI6A 1XDOA 2XHEB 3CK6A 3VHLA 5HXSA 5JR9B 2V7IA 4F6RC 3RC3A 3VRAA 2WWVA 3K8PC 3KFWX 4MBQA 4I4TE 2CBJA 2NR4A 4CI3B 2Y56A 2VQET 1MMGA 2HPLA 3EUHA 5AQIB 1UX5A 3EABA 2I59A 2H7OA 4YJ2E 3SIOA 3ZJ1A 3WTIA 2NW7A 3KV6A 1G73A 3ONJA 4KI0F 2BVMA 4DV3T 4JEUB 2X66A 3NBXX 4QXBB 4QH1A 4ZJTA 3ZN0B 2CLYC 1HS7A 3MA9A 4GKKT 2NTYA 1T7SA 4CXXA 4YTPA 3UU8A 4O4IE 4JI5T 2LT3A 2V6YA 3U8MA 2E9XB 2AXDS 1MIVA 3U3IA 1HTJF 4ZZBA 1ZHCA 2FJEA 4ILCA 2V7JA 4QACA 4QH4A 4AQFC 4PAGA 5LP6E 1X79A 1XNQT 4DIDB 1HG2A 4HN9A 3HKDE 2OA5A 2BYRA 2BYQA 4JI6T 5JDFA 1UX2A 1I6ZA 4ZK1A 1WYCA 4EZ1A 2EHOD 3U8LA 2LM9A 3LK42 3Q5WA 5LHGB 2BYSA 2YN6A 3UTKA 4PJMA 5L3DB 2JQHA 1KK7A 4JV5T 3G06A 2C0SA 1V9DA 1N33T 5F5WA 5KXJA 3LSVA 4I43B 2DLRA 5L3FB 3CMLA 5JQGE 2W67A 4AFGA 3QUJA 2V7KA 4U72A 1SE7A 3T8OA 4KUMB 3P7IA 4DR1T 2Y48B 3J9X1 3AA1B 4GOUA 2XAHB 3QNUA 2A2FX 3NZPA 2LKHA 2VB6A 1FMWA 3UFEA 3O9XA 3TLVA 4HFBA 1BR4A 3QB5A 2XQ8A 4CQIA 3F57A 1UCUA 2M6BA 3AB3B 3EDUA 4UV8B 2IIUA 3AEFA 5FXXA 4MHCA 3V5UA 5AQUB 4DBRA 3O1JA 3FZFB 5A1LA 3VKGA 4HFIA 1MMNA 4UM3P 4ILAA 5AQQB 4UXUA 4LFBT 1B7TA 3ZMTB 3A7MA 2DI4A 3FBZA 4H9RC 4IGUA 2KMFA 3N9PA 5CJ5A 2F4VT 4BAYB 3P4SA 1I94T 2X0YA 3LFMA 5BR8T 5M4YA 1XDPA 4OYJA 1VCTA 4YLHA 3AEGA 3K3NA 4FRRA 2KLQA 2JPFA 2UXNB 4DMVA 4YSXA 5AQOB 3RIUC 2D0TA 2CLYB 5KX5E 2V1DB 2CHOA 3OJAA 4YTNA 4B5DA 2WY2A 3ONLC 2QRXA 2XUEA 4LF8T 3MK7C 2W8GA 4U2ZA 5HXCA 1D0ZA 2CXFA 2HPJA 2E5LT 4DV1T 3N9QA 2C9TA 4B6XA 2NWBA 3LG7A 5CB4E 2Y57A 5F8PA 2MPKA 4AFHA 4UM1A 2JMKA 5AQGB 2BJ0A 3R84B 3ANWA 3PUZF 3UUMA 2OV9A 5LBMA 2D5UA 1D1AA 3RIAA 4ISSA 3ONXA 1O3XA 3LJCA 2KT9A 5J5FA 4WBNE 2UXBT 4O4LE 3M3ZB 1UK5A 4TWFA 2VL0A 4Z8XA 2V26A 5EK4A 5LG3A 2XJ7A 2H3RA 2Y7YA 5LXTE 4UIGA 2EHOB 3J7Yq 3JC6C 2ZJVA 2ZM8A 2I6HA 2WM9A 3RPUA 1IZNB 2WU5A 4K0KT 3ZT7A 3T1HT 2VURA 3AE4A 5LGNB 2LHNA 4HFDA 4KHPT 5HEHA 2DWGA 5CFBA 4OYKA 2JQKA 5L3BB 1HX1B 2ZM6T 1D1CA 2XTLA 4ADZA 2LRKA 4ZI7E 2PBIA 4IIJE 2E5VA 5CA1E 1KNRA 1E7PA 2X51A 2W66A 4IDQA 1OXZA 2QVAA 3P4PA 3AVSA 3C98B 4BJNA 1J1JA 4C91A 4EV6A 5IYZE 3PDYA 3LK2B 5HEJA 4AKRB 1LKXA 3OYXA 2LE8A 5J5GA 2UZ6A 3PJAJ 3AE9A 3MACA 3RQWA 4YJ3E 2VQFT 2VK9A 5LHIB 3LK3B 4HKAA 5L3CB 4TNWA 3ZJ2A 3BQLA 5IWAT 4X5TA 4IDNA 4P0AA 1IJ5A 1YKHB 3EAMA 4LF7T 3PV0F 1SUMB 4UF0B 3AEAA 5L4EA 2BZBA 2CEAA 2BR8A 5HWYA 1QLBA 4A98A 2KXPB 2BKPA 4ZI2D 1R8IA 2B76A 4X64T 4ZXLA 2WNCA 4ILUA 1SA0E 1NEKA 3AAIA 4LFAT 1N32T 3CX6B 2VWAA 4PIRA 4X1IE 1U4QA 4G2AA 2BG9A 5JR9A 3CQXC 2DCFA 4PFPA 2LEHA 2CBIA 1WRDA 5AFUL 2HHHT 4JI3T 4KBMB 2WZYA 2BYPA 4EYUA 4CXWA 2X9HA 2XAJB 3EI0A 4D01A 2LKGA 2HN1A 1KNZA 1EZ3A 3MKDA 2Y54A 4HWCA 2XQ4A 4HWHA 2J4GA 3TLWA 3KVAA 5JREA 3PUXF 4JI2T 3K1SA 5KMGP 2XAFB 5BW2A 3ZYLA 1WLXA 3ZCJA 2BR7A 1NENA 2PFVA 4OFZA 2Q9QD 3AA6B 4QAAA 4AISA 3CPZA 3N9LA 3TKLB 4TX5A 4EB6E 2E9XA 2V7LA 4NZBA 2K24A 5JVDE 4B3ST 5HWXA 2UXXB 2NTXA 3C64A 4X1YE 3CVRA 5HXRA 5FXWA 2V5DA 3JCFA 1I9BA 4HEAA 2KSRA 3B13A 3BQIA 1KEYA 2XZ5A 1IBMT 3O4XE 2W00A 1MIWA 4DV6T 4HFHA 4TNVA 5L3EB 4H9PC 4EEDA 5LXBA 5KZUA 1Y64B 2G0UA 3PUAA 3SFEA 3T1YT 3P8CD 3H3MA 1W9RA 3ETVA 3E22E 3CWZB 2FJBA 2YDSA 5JDMA 2QYWA 2CPTA 3WTHA 3UU6A 2BVLA 4U7IA 1W0AA 2W62A 4OX9T 4HTEA 1ZV4X 4ZEYA 4U2YA 3N2OA 5AQTB 3U8NA 3O1IA 3F2EA 3WTOA 4YFSA 5FNVE 5BMVE 2DWKA 3W15B 2KWIB 4OK0A 2ZM2A 2UU9T 4DBQA 3RYHE 2W8FA 2Z6EA 1BR0A 2Q9QA 3JAEA 4QHOA 5HXHA 2UUBT 2CXDA 4CN1A 3QC9A 4CI2B 5J5HA 5AFJA 3WAKA 2MTQA 3KV4A 4BFQA 2XASB 3AVRA 2K3WA 5FXZA 3X1DA 4OHFA 5LNKA 4HWFA 4CN6A 4UM3S 5ABEA 1G8XA 3U8KA 2WMOA 2DL1A 5HEOA 1Z8UA 1CUNA 2C5KT 4LFCT 2XSBA 2NP9A 3P4RA 1XNRT 1QUUA 3ESLA 4DV4T 5JDGA 4DR5T 2X00A 5FL1A 2CCQA 4I0UA 2A3DA 1HCIA 2XQAA 4YHHT 3C50A 5EZYE 5JTGA 2ODVA 4AIUA 5KE4A 1ZEEA 1SHZC 3DP7A 2VASA 4L5GA 3NKZA 3L39A 4EZHA 4LF6T 2V7MA 4H63V 3N2KE 4LF4T 1H7CA 3MXZA 4KMCA 5AQKB 3ZYKA 3S4UA 2XM2A 1YW0A 3GMIA 1WR6A 4FI5A 5FMNA 3OPCA 4XHEA 2EHOC 5JDNA 4JUYA 3H37A 3KV5A 3ZDGA 3ZC1A 3B57A 2XYTA 4U31A 4ZJSA 2CMRA 5AQPB 4PK4A 4UVCB 2LSJA 4ZRUA 4MLKA 2L8KA 2XZ6A 2JJ9A 3NZQA 1D0XA 1UV6A 1Z0PA 1XZYA 4GK5E 2BG9E 3AECA 3EVYA 2V6YB 2L9QA 3T4MA 4ZOLE 2ES0A 3PE0A 2X68A 4XK9A 2PTFA 4QKNA 3CQGB 1XMOT 3WAJA 3L3PA 3AXJA 5DQWA 1MNDA 3UU5A 4ERRA 2C5IT 2D0UA 3C4XA 3Q2MA 2IC9A 4Z90A 2XNTA 3ZDHA 3VR9A 3HA4A 2W63A 5EK3A 4J2CA 2LSIA 3PUYF 5TVCA 4DBMA 2XQ5A 3HKEE 3AE1A 5AFNA 4JI4T 4LF9T 1WCRA 2NW9A 3I0QA 2IHR1 3RC8A 1J5WA 1AJ3A 5AQRB 3NRYA 2WMNA 4ZI3D 4O4HE 3UULA 5TAOA 4JI1T
chains in the Genus database with same CATH topology
3UU8A 3EI0A 4D01A 2LKGA 3U8MA 1OEDB 5HEGA 4Z91A 2Y54A 3RI5A 5HEJA 4HQPA 4ZZBA 3JAFA 5FJVA 4XHEA 4ILCA 2XQ4A 4HFEA 4HFIA 4TWHA 4QACA 4UM3P 5AFMB 3TLWA 3RIAA 3C84A 3WTKA 4QH4A 4TWDA 4ILAA 5J5GA 2UZ6A 4LMKA 4UXUA 3ZDGA 2W8FA 2YMEA 3JADA 3RQWA 5JMEA 4WV9A 2XYTA 5BW2A 3JAEA 2BG9B 1OEDE 2LM2A 5J5FA 5J0ZA 5SYOA 2BR7A 3P50A 2LLYA 2YMDA 4BQTA 5J5HA 4ZJSA 2WNLA 4HFCA 2MAWA 4QAAA 4TNWA 4F8HA 3UQ7A 2BYQA 2BYRA 2PGZA 5AFJA 2XQ9A 2ZJUA 3SQ6A 4BFQA 4LMJA 3UQ4A 3EHZA 4A97A 1UX2A 4X5TA 4ZRUA 1OEDC 2XZ6A 4QABA 4ZK1A 4TWFA 5HEUA 1UV6A 4ZK4A 4NZBA 2VL0A 3EAMA 4AFTA 4EZ1A 5J5IA 2XYSA 4UM3S 3IGQA 2BG9E 3PEOA 4UY2A 3U8JA 3U8LA 5AFHA 3U8KA 3WTLA 5LG3A 3T4MA 2BYSA 2Y7YA 2YN6A 5HEOA 3TLUA 2M6IA 5L4EA 3WTMA 4XK9A 1I9BA 2KSRA 5HCJA 4FRRA 3WIPA 2XZ5A 2BG9C 3TLSA 4UM3A 4ZR6A 4IL4A 2BR8A 3PMZA 3LSVA 2ZJVA 3UU5A 3UU3A 2XQ3A 4ILBA 3RQUA 3RHWA 4A98A 2Y56A 4HFHA 4ALXA 5AINA 4TNVA 1OEDA 2PH9A 4AFGA 2X00A 4Z90A 2XNTA 5BRXA 3ZDHA 4QH5A 2QC1B 3GUAA 4LMLA 4COFA 5KZUA 2XQ6A 3C79A 5AFLA 5LXBA 5AFMA 2WNCA 4HFDA 4B5DA 3SQ9A 3RIFA 4ZZCA 5HEHA 2XNUA 2XQAA 5CFBA 2YKSA 3UU4A 2BYNA 5TVCA 3UUBA 2LKHA 3TLTA 4PIRA 5IUXA 3SIOA 4DBMA 2XQ5A 5KE4A 3SH1A 3WTIA 2BG9A 3TLVA 2XNVA 2WN9A 4HFBA 2YOEA 5AFKA 5AFNA 2XQ8A 2W8GA 2XQ7A 5CO5A 3WTHA 5BP0A 4IREA 3UU6A 3ZKRA 2WNJA 5HCMA 5L47A 3WTJA 2M6BA 4QH1A 4ZJTA 3P4WA 2C9TA 3WTNA 3U8NA 4IL9A 2Y57A 2X00D 2WZYA 2BYPA 2Y58A 4UM1A 4AFHA 2BJ0A 1UW6A 5L4HA 3WTOA 4NPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU8 A;  3EI0 A;  4D01 A;  2LKG A;  3U8M A;  1OED B;  5HEG A;  4Z91 A;  2Y54 A;  3RI5 A;  5HEJ A;  4HQP A;  4ZZB A;  3JAF A;  5FJV A;  4XHE A;  4ILC A;  2XQ4 A;  4HFE A;  4HFI A;  4TWH A;  4QAC A;  4UM3 P;  5AFM B;  3TLW A;  3RIA A;  3C84 A;  3WTK A;  4QH4 A;  4TWD A;  4ILA A;  5J5G A;  2UZ6 A;  4LMK A;  4UXU A;  3ZDG A;  2W8F A;  2YME A;  3JAD A;  3RQW A;  5JME A;  4WV9 A;  2XYT A;  5BW2 A;  3JAE A;  2BG9 B;  1OED E;  2LM2 A;  5J5F A;  5J0Z A;  5SYO A;  2BR7 A;  3P50 A;  2LLY A;  2YMD A;  4BQT A;  5J5H A;  4ZJS A;  2WNL A;  4HFC A;  2MAW A;  4QAA A;  4TNW A;  4F8H A;  3UQ7 A;  2BYQ A;  2BYR A;  2PGZ A;  5AFJ A;  2XQ9 A;  2ZJU A;  3SQ6 A;  4BFQ A;  4LMJ A;  3UQ4 A;  3EHZ A;  4A97 A;  1UX2 A;  4X5T A;  4ZRU A;  1OED C;  2XZ6 A;  4QAB A;  4ZK1 A;  4TWF A;  5HEU A;  1UV6 A;  4ZK4 A;  4NZB A;  2VL0 A;  3EAM A;  4AFT A;  4EZ1 A;  5J5I A;  2XYS A;  4UM3 S;  3IGQ A;  2BG9 E;  3PEO A;  4UY2 A;  3U8J A;  3U8L A;  5AFH A;  3U8K A;  3WTL A;  5LG3 A;  3T4M A;  2BYS A;  2Y7Y A;  2YN6 A;  5HEO A;  3TLU A;  2M6I A;  5L4E A;  3WTM A;  4XK9 A;  1I9B A;  2KSR A;  5HCJ A;  4FRR A;  3WIP A;  2XZ5 A;  2BG9 C;  3TLS A;  4UM3 A;  4ZR6 A;  4IL4 A;  2BR8 A;  3PMZ A;  3LSV A;  2ZJV A;  3UU5 A;  3UU3 A;  2XQ3 A;  4ILB A;  3RQU A;  3RHW A;  4A98 A;  2Y56 A;  4HFH A;  4ALX A;  5AIN A;  4TNV A;  1OED A;  2PH9 A;  4AFG A;  2X00 A;  4Z90 A;  2XNT A;  5BRX A;  3ZDH A;  4QH5 A;  2QC1 B;  3GUA A;  4LML A;  4COF A;  5KZU A;  2XQ6 A;  3C79 A;  5AFL A;  5LXB A;  5AFM A;  2WNC A;  4HFD A;  4B5D A;  3SQ9 A;  3RIF A;  4ZZC A;  5HEH A;  2XNU A;  2XQA A;  5CFB A;  2YKS A;  3UU4 A;  2BYN A;  5TVC A;  3UUB A;  2LKH A;  3TLT A;  4PIR A;  5IUX A;  3SIO A;  4DBM A;  2XQ5 A;  5KE4 A;  3SH1 A;  3WTI A;  2BG9 A;  3TLV A;  2XNV A;  2WN9 A;  4HFB A;  2YOE A;  5AFK A;  5AFN A;  2XQ8 A;  2W8G A;  2XQ7 A;  5CO5 A;  3WTH A;  5BP0 A;  4IRE A;  3UU6 A;  3ZKR A;  2WNJ A;  5HCM A;  5L47 A;  3WTJ A;  2M6B A;  4QH1 A;  4ZJT A;  3P4W A;  2C9T A;  3WTN A;  3U8N A;  4IL9 A;  2Y57 A;  2X00 D;  2WZY A;  2BYP A;  2Y58 A;  4UM1 A;  4AFH A;  2BJ0 A;  1UW6 A;  5L4H A;  3WTO A;  4NPP A; 
#chains in the Genus database with same CATH topology
 2WQY A;  5FY7 A;  3PU3 A;  3PTR B;  4HFE A;  3QOF A;  4L9I A;  4ASK A;  4HWI B;  4X20 E;  3RRC A;  2N9D A;  3ZCI A;  5AQL B;  5F3J A;  5J2U E;  3HI2 A;  1Y01 A;  3LBX A;  3AE5 A;  5C2T A;  2HN2 A;  2AE9 A;  3SQ6 A;  2ZJU A;  4DR7 T;  2ZLY A;  3RH3 A;  2WDR A;  3IGQ A;  4QXC B;  4UY2 A;  2JQ9 A;  3AE8 A;  2CHN A;  1FEW A;  5FVK A;  3TLS A;  4ZR6 A;  4PJJ A;  3CQC B;  5FKY A;  3RIU A;  2ZM0 A;  4P09 A;  5C8Y E;  4QH5 A;  3CX7 B;  2QC1 B;  3Q5X A;  3IA3 A;  2A9U A;  3GUA A;  5AFL A;  5AFM A;  3EDV A;  5LOV E;  4N78 D;  4PNI A;  5C3J A;  3E08 A;  4XZC A;  4QXH B;  4IE7 A;  5IUX A;  2KND A;  4H9O C;  1ZOY A;  2UXD T;  2BBJ A;  2DHR A;  2X0L B;  1UGO A;  1ZP0 A;  5BP0 A;  4WNK A;  3IEE A;  2M67 A;  3FZK B;  5AQN B;  5FYM A;  5EK2 A;  2H7V C;  4TV9 E;  1W0B A;  1YKE B;  4IL9 A;  3BK9 A;  4AQG A;  1MNE A;  5E0O A;  3SOL A;  1VRB A;  4WW0 A;  4X62 T;  5HEG A;  3NVO A;  4Q25 A;  3FZM B;  3GN5 A;  4E7S A;  4FJO A;  3N9N A;  4U7Y A;  5JRC A;  3JAD A;  3DTO A;  1D1B A;  2YDR A;  4I55 E;  3KIN B;  2CWO A;  2LM2 A;  5LG4 A;  3PJA A;  3HR0 A;  3C4Z A;  2C5J A;  3A5X A;  4IE4 A;  4YHJ A;  4HFC A;  2MAW A;  1KF6 A;  2VL8 A;  3FXE B;  1HNW T;  4GKJ T;  2YU1 A;  3CIR A;  3PUG A;  3K3Q C;  1JNZ A;  3PEO A;  1VOM A;  3RLF F;  5J1G A;  4H9N C;  2FBW A;  3ANW B;  2M6I A;  2A72 A;  1HF8 A;  5HCJ A;  2D9D A;  5CA0 E;  2BG9 C;  5J2T E;  4NUU A;  2VVN A;  4AKL A;  3RQU A;  3RHW A;  4IDP A;  1OED A;  4I50 E;  4LML A;  2XQ6 A;  5LJN A;  2E9X D;  5DQV A;  4ANJ A;  1BR1 A;  3ZN1 B;  4BA9 A;  3AAE B;  3F31 A;  3L8R A;  2VKJ A;  1YXR A;  2Y8D A;  3UUN A;  2MOZ A;  4KX6 A;  3KV9 A;  2WNJ A;  3ZMU B;  3OYZ A;  2YIN A;  4QX7 B;  2K9A A;  1US7 B;  4U3C A;  3HL6 A;  5KDM C;  2V8S V;  5L4H A;  3AE2 A;  2BKO A;  2VKH A;  1OWA A;  2OLT A;  4ZS2 A;  3Q5D A;  4H9Q C;  4TWH A;  4TWD A;  1S94 A;  3RYI E;  4HFV A;  3I9Y A;  5LB7 B;  4DV7 T;  2BKN A;  2ACZ A;  4UVB B;  1IJ6 A;  2D2S A;  4F8H A;  2XQ9 A;  4LMJ A;  3ZLI A;  1E1H B;  3UUX B;  1IBK T;  4JI7 T;  5HEU A;  5AQF B;  3ZEF B;  4TV8 E;  4CXY A;  4PW8 A;  2WS3 A;  4U74 A;  3WTM A;  4ZS3 A;  4X66 T;  4UM3 A;  4DV5 T;  1ZKE A;  2P9B A;  4IDZ A;  2WCA A;  1KNP A;  4H9S E;  3C79 A;  2W2U A;  4EAH A;  3RIF A;  4ZZC A;  4DUZ T;  3ETU A;  2CWY A;  2YKS A;  5JDL A;  5L2L A;  2X0H A;  3FZL B;  1MMA A;  2UXC T;  2B1E A;  2NOX A;  4IE6 A;  2XQ7 A;  2BS4 A;  4HE8 A;  2YEV C;  5L47 A;  2RA1 A;  3C51 A;  2Q9Q C;  2LOS A;  4DV0 T;  2X00 D;  2Y58 A;  2J1D G;  2XPK A;  2JIW A;  2PJQ A;  4WYV A;  4DR4 T;  4BJM A;  2XQY A;  4HQP A;  3AEE A;  2X9X A;  5FJV A;  2Y6X A;  3NRX A;  5LBQ B;  5FY0 A;  4NXN T;  2K5B B;  2V6X A;  2JMH A;  5LYJ E;  4EXT A;  3MZK B;  5ADX L;  5FVL A;  2CM0 A;  3AA7 B;  4CZZ B;  4LF5 T;  5JME A;  1T8B A;  4AKG A;  3ZPO A;  3MJX A;  2BG9 B;  2VVS A;  5SYO A;  2BS3 A;  3RF1 A;  3UQ7 A;  1YD8 G;  1YQ4 A;  5LGT B;  2FJA A;  5LA6 E;  3D0T A;  2IC6 A;  1N36 T;  3PUS A;  1S35 A;  2UUA T;  1UUR A;  4XBF B;  5FY1 A;  2YK0 A;  3H3A A;  3L09 A;  5L3G B;  4G63 A;  4EEB A;  4KP3 C;  3AAA B;  3FHN A;  3R6N A;  2RPA A;  2XQ3 A;  3KBT A;  4ALX A;  2NW8 A;  2XM1 A;  1T98 A;  3AED A;  2X67 A;  3N9M A;  1LVF A;  4EOZ B;  3UFG A;  2N1G A;  2DNX A;  4YSZ A;  1E2A A;  5JDQ A;  4O4J E;  3IF8 B;  4UEM A;  3UUB A;  3N5L A;  3SH1 A;  4IT4 A;  3RKO A;  2XNV A;  2WN9 A;  3O1H A;  3VKH A;  4YT0 A;  2WDV A;  4IRE A;  2V5C A;  2QA7 A;  3WI3 A;  3I9W A;  5ABH A;  4O8S A;  5HXE A;  4P1N A;  1QSD A;  4TN7 B;  3FB2 A;  5ABF B;  5FXV A;  4M1P A;  2WU2 A;  1UUS A;  2WBL A;  4MAL A;  3I0O A;  4Z91 A;  3ZST A;  4NXM T;  2PG8 A;  3GWH A;  4JBW F;  3I1A A;  4DV2 T;  5LJM A;  4AKI A;  1D0Y A;  2W4X A;  2H89 A;  1KFY A;  3RX6 A;  1FIO A;  1N34 T;  1OED E;  4YXD A;  4AQY T;  2W61 A;  3ZMV B;  2BBH A;  5LMN T;  1L0V A;  4IDO A;  5ETW A;  4ZK4 A;  4EZ4 A;  5AQV B;  4MFR A;  2IML A;  4AQF A;  4DMW A;  1NWM X;  2IAK A;  4A56 A;  3AE6 A;  3TLU A;  3ZT5 A;  4WZX A;  4GIW A;  1FMV A;  5LMU T;  2BDE A;  2CXL A;  2XAG B;  4KHZ F;  4ILB A;  3QK6 A;  4TUY E;  4X1K E;  2Q9Q B;  3SFD A;  5BRX A;  3IBP A;  5CGM A;  2E8I A;  5H6Q B;  2XZE A;  3RKG A;  3CX8 B;  4UEL A;  2XNU A;  2BYN A;  2KIN B;  3GA8 A;  4TZ4 C;  1NAF A;  4JEH B;  1M62 A;  4A5X A;  4B3M T;  4X65 T;  4PJL A;  1LRZ A;  4C90 A;  1X9B A;  4GK0 E;  3CKD A;  3VRB A;  3AEB A;  4CI1 B;  2XAQ B;  4NPP A;  5AQJ B;  3RI5 A;  4L0R A;  2MBG A;  2EHO A;  4UR9 A;  4AXP A;  3C84 A;  3WTK A;  2LRL A;  3K3O A;  3VR8 A;  4CN4 A;  3FXD B;  4UV9 B;  2KWH A;  5LHH B;  2YME A;  1CHU A;  4WV9 A;  4QX8 B;  2IW5 B;  2CRB A;  4BQT A;  4JYA T;  5LCY A;  4AKH A;  4E7Z A;  4ZHQ E;  3UQ4 A;  3ZT6 A;  3RRW A;  3M65 A;  5GON E;  5LGU B;  2L3L A;  3WTL A;  4EIW A;  2HH7 A;  2WWU A;  3A8Y C;  3PMZ A;  3LDQ B;  4IHJ E;  3AE7 A;  2VKD A;  2LSG A;  4ZI3 C;  5FP3 A;  3ZYM A;  4IE0 A;  4COF A;  1UX4 A;  1J5E T;  3IHR A;  1HFA A;  5DJQ C;  3TLT A;  1JNR A;  4EGW A;  1HX8 A;  3SS1 A;  2YOE A;  2LOP A;  5CO5 A;  2FUP A;  5HCM A;  3JC6 D;  3WTJ A;  3RGL A;  3ZSS A;  4NUV A;  4HGA A;  4IST A;  3AXJ B;  4PK6 A;  3OKQ A;  3UT5 E;  1XMQ T;  4UF0 A;  1M7K A;  1XWM A;  4U33 A;  2J47 A;  2WSS V;  3PUV F;  4QWN B;  4LMK A;  1YQ3 A;  4EYY R;  4DR3 T;  4DVD A;  2WP9 A;  3KDS E;  4XAX B;  4JI8 T;  5J0Z A;  1WYB A;  2GK9 A;  4JLE A;  2LLY A;  5ABG A;  1W09 A;  3ZC0 A;  2WNL A;  4O2A E;  1U5P A;  4DND A;  1IAP A;  1OED C;  4QAB A;  5DAB A;  4O2B E;  3RYC E;  3NWI A;  2XYS A;  3QB5 K;  5AFH A;  2QGS A;  4GYS A;  4JI0 T;  1HR0 T;  2IUB A;  2UUC T;  2XSA A;  2J62 A;  3N2G E;  3ABV A;  4DUY T;  3WIP A;  3PU8 A;  4B3R T;  4IL4 A;  3ZMS B;  5HYA A;  2ODU A;  2LJL A;  3UU3 A;  3HKB E;  5AIN A;  4YSY A;  3LBX B;  1HNZ T;  3SQ9 A;  3UU4 A;  3OTO T;  2WZI A;  1DU2 A;  3U78 A;  5JR9 C;  3SRZ A;  5AFK A;  4B3T T;  1BR2 A;  2LHR A;  2X9Y A;  4PK5 A;  3ZKR A;  5AQH B;  5AQS B;  2YDQ A;  3WTN A;  2JQQ A;  2WZH A;  3KBU A;  2ZMA A;  4YY3 T;  2R6G F;  3N9O A;  3PUQ A;  1MIY A;  3Q9D A;  3FZH B;  2E2A A;  2XY8 B;  4HWD A;  4UXN B;  3Q5E A;  1WR0 A;  4YTM A;  5AFM B;  2ACX A;  3VU7 H;  2LSK A;  3RYF E;  2JRK A;  4V1A v;  2K48 A;  3P4Q A;  1T72 A;  4UVA B;  2IDO B;  4IE5 A;  5JH7 E;  5H6R B;  3P50 A;  2YMD A;  2MYS A;  3DJB A;  3BQK A;  1HG5 A;  1HNX T;  1WFD A;  2E9X C;  3B5M A;  1GQE A;  5J5I A;  4AFT A;  1MMD A;  3U8J A;  5IHY A;  2W0G A;  1IBL T;  3V5S A;  3GN5 B;  2LSY A;  4ZI2 C;  2RP4 A;  5JRC B;  2WB5 A;  2WDQ A;  3SWH A;  5FL0 A;  2PH9 A;  2VKO A;  4PJN A;  2YU2 A;  2X9W A;  1LVK A;  3OBV E;  4DR6 T;  2CE7 A;  2N2N A;  2SPC A;  2H88 A;  3HKC E;  1VCS A;  3P4W A;  3FBL A;  2KZ7 B;  5JDH A;  4DR2 T;  3AA0 B;  1UW6 A;  4GYR A;  4P0B A;  1OED B;  3JAF A;  4K0U A;  3E0Z A;  5HAX A;  3KVB A;  3OVU A;  2BS2 A;  2WAU A;  5AQM B;  2FJD A;  4WBO A;  3PUW F;  3C4W A;  2I0M A;  4H63 H;  2PGZ A;  1FJG T;  3ZMZ B;  3EHZ A;  4PFO A;  4A97 A;  4DO0 A;  4NIQ A;  5ABF A;  3AE3 A;  3PUR A;  2CA5 A;  4AI6 A;  1XDO A;  2XHE B;  3CK6 A;  3VHL A;  5HXS A;  5JR9 B;  2V7I A;  4F6R C;  3RC3 A;  3VRA A;  2WWV A;  3K8P C;  3KFW X;  4MBQ A;  4I4T E;  2CBJ A;  2NR4 A;  4CI3 B;  2Y56 A;  2VQE T;  1MMG A;  2HPL A;  3EUH A;  5AQI B;  1UX5 A;  3EAB A;  2I59 A;  2H7O A;  4YJ2 E;  3SIO A;  3ZJ1 A;  3WTI A;  2NW7 A;  3KV6 A;  1G73 A;  3ONJ A;  4KI0 F;  2BVM A;  4DV3 T;  4JEU B;  2X66 A;  3NBX X;  4QXB B;  4QH1 A;  4ZJT A;  3ZN0 B;  2CLY C;  1HS7 A;  3MA9 A;  4GKK T;  2NTY A;  1T7S A;  4CXX A;  4YTP A;  3UU8 A;  4O4I E;  4JI5 T;  2LT3 A;  2V6Y A;  3U8M A;  2E9X B;  2AXD S;  1MIV A;  3U3I A;  1HTJ F;  4ZZB A;  1ZHC A;  2FJE A;  4ILC A;  2V7J A;  4QAC A;  4QH4 A;  4AQF C;  4PAG A;  5LP6 E;  1X79 A;  1XNQ T;  4DID B;  1HG2 A;  4HN9 A;  3HKD E;  2OA5 A;  2BYR A;  2BYQ A;  4JI6 T;  5JDF A;  1UX2 A;  1I6Z A;  4ZK1 A;  1WYC A;  4EZ1 A;  2EHO D;  3U8L A;  2LM9 A;  3LK4 2;  3Q5W A;  5LHG B;  2BYS A;  2YN6 A;  3UTK A;  4PJM A;  5L3D B;  2JQH A;  1KK7 A;  4JV5 T;  3G06 A;  2C0S A;  1V9D A;  1N33 T;  5F5W A;  5KXJ A;  3LSV A;  4I43 B;  2DLR A;  5L3F B;  3CML A;  5JQG E;  2W67 A;  4AFG A;  3QUJ A;  2V7K A;  4U72 A;  1SE7 A;  3T8O A;  4KUM B;  3P7I A;  4DR1 T;  2Y48 B;  3J9X 1;  3AA1 B;  4GOU A;  2XAH B;  3QNU A;  2A2F X;  3NZP A;  2LKH A;  2VB6 A;  1FMW A;  3UFE A;  3O9X A;  3TLV A;  4HFB A;  1BR4 A;  3QB5 A;  2XQ8 A;  4CQI A;  3F57 A;  1UCU A;  2M6B A;  3AB3 B;  3EDU A;  4UV8 B;  2IIU A;  3AEF A;  5FXX A;  4MHC A;  3V5U A;  5AQU B;  4DBR A;  3O1J A;  3FZF B;  5A1L A;  3VKG A;  4HFI A;  1MMN A;  4UM3 P;  4ILA A;  5AQQ B;  4UXU A;  4LFB T;  1B7T A;  3ZMT B;  3A7M A;  2DI4 A;  3FBZ A;  4H9R C;  4IGU A;  2KMF A;  3N9P A;  5CJ5 A;  2F4V T;  4BAY B;  3P4S A;  1I94 T;  2X0Y A;  3LFM A;  5BR8 T;  5M4Y A;  1XDP A;  4OYJ A;  1VCT A;  4YLH A;  3AEG A;  3K3N A;  4FRR A;  2KLQ A;  2JPF A;  2UXN B;  4DMV A;  4YSX A;  5AQO B;  3RIU C;  2D0T A;  2CLY B;  5KX5 E;  2V1D B;  2CHO A;  3OJA A;  4YTN A;  4B5D A;  2WY2 A;  3ONL C;  2QRX A;  2XUE A;  4LF8 T;  3MK7 C;  2W8G A;  4U2Z A;  5HXC A;  1D0Z A;  2CXF A;  2HPJ A;  2E5L T;  4DV1 T;  3N9Q A;  2C9T A;  4B6X A;  2NWB A;  3LG7 A;  5CB4 E;  2Y57 A;  5F8P A;  2MPK A;  4AFH A;  4UM1 A;  2JMK A;  5AQG B;  2BJ0 A;  3R84 B;  3ANW A;  3PUZ F;  3UUM A;  2OV9 A;  5LBM A;  2D5U A;  1D1A A;  3RIA A;  4ISS A;  3ONX A;  1O3X A;  3LJC A;  2KT9 A;  5J5F A;  4WBN E;  2UXB T;  4O4L E;  3M3Z B;  1UK5 A;  4TWF A;  2VL0 A;  4Z8X A;  2V26 A;  5EK4 A;  5LG3 A;  2XJ7 A;  2H3R A;  2Y7Y A;  5LXT E;  4UIG A;  2EHO B;  3J7Y q;  3JC6 C;  2ZJV A;  2ZM8 A;  2I6H A;  2WM9 A;  3RPU A;  1IZN B;  2WU5 A;  4K0K T;  3ZT7 A;  3T1H T;  2VUR A;  3AE4 A;  5LGN B;  2LHN A;  4HFD A;  4KHP T;  5HEH A;  2DWG A;  5CFB A;  4OYK A;  2JQK A;  5L3B B;  1HX1 B;  2ZM6 T;  1D1C A;  2XTL A;  4ADZ A;  2LRK A;  4ZI7 E;  2PBI A;  4IIJ E;  2E5V A;  5CA1 E;  1KNR A;  1E7P A;  2X51 A;  2W66 A;  4IDQ A;  1OXZ A;  2QVA A;  3P4P A;  3AVS A;  3C98 B;  4BJN A;  1J1J A;  4C91 A;  4EV6 A;  5IYZ E;  3PDY A;  3LK2 B;  5HEJ A;  4AKR B;  1LKX A;  3OYX A;  2LE8 A;  5J5G A;  2UZ6 A;  3PJA J;  3AE9 A;  3MAC A;  3RQW A;  4YJ3 E;  2VQF T;  2VK9 A;  5LHI B;  3LK3 B;  4HKA A;  5L3C B;  4TNW A;  3ZJ2 A;  3BQL A;  5IWA T;  4X5T A;  4IDN A;  4P0A A;  1IJ5 A;  1YKH B;  3EAM A;  4LF7 T;  3PV0 F;  1SUM B;  4UF0 B;  3AEA A;  5L4E A;  2BZB A;  2CEA A;  2BR8 A;  5HWY A;  1QLB A;  4A98 A;  2KXP B;  2BKP A;  4ZI2 D;  1R8I A;  2B76 A;  4X64 T;  4ZXL A;  2WNC A;  4ILU A;  1SA0 E;  1NEK A;  3AAI A;  4LFA T;  1N32 T;  3CX6 B;  2VWA A;  4PIR A;  4X1I E;  1U4Q A;  4G2A A;  2BG9 A;  5JR9 A;  3CQX C;  2DCF A;  4PFP A;  2LEH A;  2CBI A;  1WRD A;  5AFU L;  2HHH T;  4JI3 T;  4KBM B;  2WZY A;  2BYP A;  4EYU A;  4CXW A;  2X9H A;  2XAJ B;  3EI0 A;  4D01 A;  2LKG A;  2HN1 A;  1KNZ A;  1EZ3 A;  3MKD A;  2Y54 A;  4HWC A;  2XQ4 A;  4HWH A;  2J4G A;  3TLW A;  3KVA A;  5JRE A;  3PUX F;  4JI2 T;  3K1S A;  5KMG P;  2XAF B;  5BW2 A;  3ZYL A;  1WLX A;  3ZCJ A;  2BR7 A;  1NEN A;  2PFV A;  4OFZ A;  2Q9Q D;  3AA6 B;  4QAA A;  4AIS A;  3CPZ A;  3N9L A;  3TKL B;  4TX5 A;  4EB6 E;  2E9X A;  2V7L A;  4NZB A;  2K24 A;  5JVD E;  4B3S T;  5HWX A;  2UXX B;  2NTX A;  3C64 A;  4X1Y E;  3CVR A;  5HXR A;  5FXW A;  2V5D A;  3JCF A;  1I9B A;  4HEA A;  2KSR A;  3B13 A;  3BQI A;  1KEY A;  2XZ5 A;  1IBM T;  3O4X E;  2W00 A;  1MIW A;  4DV6 T;  4HFH A;  4TNV A;  5L3E B;  4H9P C;  4EED A;  5LXB A;  5KZU A;  1Y64 B;  2G0U A;  3PUA A;  3SFE A;  3T1Y T;  3P8C D;  3H3M A;  1W9R A;  3ETV A;  3E22 E;  3CWZ B;  2FJB A;  2YDS A;  5JDM A;  2QYW A;  2CPT A;  3WTH A;  3UU6 A;  2BVL A;  4U7I A;  1W0A A;  2W62 A;  4OX9 T;  4HTE A;  1ZV4 X;  4ZEY A;  4U2Y A;  3N2O A;  5AQT B;  3U8N A;  3O1I A;  3F2E A;  3WTO A;  4YFS A;  5FNV E;  5BMV E;  2DWK A;  3W15 B;  2KWI B;  4OK0 A;  2ZM2 A;  2UU9 T;  4DBQ A;  3RYH E;  2W8F A;  2Z6E A;  1BR0 A;  2Q9Q A;  3JAE A;  4QHO A;  5HXH A;  2UUB T;  2CXD A;  4CN1 A;  3QC9 A;  4CI2 B;  5J5H A;  5AFJ A;  3WAK A;  2MTQ A;  3KV4 A;  4BFQ A;  2XAS B;  3AVR A;  2K3W A;  5FXZ A;  3X1D A;  4OHF A;  5LNK A;  4HWF A;  4CN6 A;  4UM3 S;  5ABE A;  1G8X A;  3U8K A;  2WMO A;  2DL1 A;  5HEO A;  1Z8U A;  1CUN A;  2C5K T;  4LFC T;  2XSB A;  2NP9 A;  3P4R A;  1XNR T;  1QUU A;  3ESL A;  4DV4 T;  5JDG A;  4DR5 T;  2X00 A;  5FL1 A;  2CCQ A;  4I0U A;  2A3D A;  1HCI A;  2XQA A;  4YHH T;  3C50 A;  5EZY E;  5JTG A;  2ODV A;  4AIU A;  5KE4 A;  1ZEE A;  1SHZ C;  3DP7 A;  2VAS A;  4L5G A;  3NKZ A;  3L39 A;  4EZH A;  4LF6 T;  2V7M A;  4H63 V;  3N2K E;  4LF4 T;  1H7C A;  3MXZ A;  4KMC A;  5AQK B;  3ZYK A;  3S4U A;  2XM2 A;  1YW0 A;  3GMI A;  1WR6 A;  4FI5 A;  5FMN A;  3OPC A;  4XHE A;  2EHO C;  5JDN A;  4JUY A;  3H37 A;  3KV5 A;  3ZDG A;  3ZC1 A;  3B57 A;  2XYT A;  4U31 A;  4ZJS A;  2CMR A;  5AQP B;  4PK4 A;  4UVC B;  2LSJ A;  4ZRU A;  4MLK A;  2L8K A;  2XZ6 A;  2JJ9 A;  3NZQ A;  1D0X A;  1UV6 A;  1Z0P A;  1XZY A;  4GK5 E;  2BG9 E;  3AEC A;  3EVY A;  2V6Y B;  2L9Q A;  3T4M A;  4ZOL E;  2ES0 A;  3PE0 A;  2X68 A;  4XK9 A;  2PTF A;  4QKN A;  3CQG B;  1XMO T;  3WAJ A;  3L3P A;  3AXJ A;  5DQW A;  1MND A;  3UU5 A;  4ERR A;  2C5I T;  2D0U A;  3C4X A;  3Q2M A;  2IC9 A;  4Z90 A;  2XNT A;  3ZDH A;  3VR9 A;  3HA4 A;  2W63 A;  5EK3 A;  4J2C A;  2LSI A;  3PUY F;  5TVC A;  4DBM A;  2XQ5 A;  3HKE E;  3AE1 A;  5AFN A;  4JI4 T;  4LF9 T;  1WCR A;  2NW9 A;  3I0Q A;  2IHR 1;  3RC8 A;  1J5W A;  1AJ3 A;  5AQR B;  3NRY A;  2WMN A;  4ZI3 D;  4O4H E;  3UUL A;  5TAO A;  4JI1 T; 
#chains in the Genus database with same CATH homology
 3UU8 A;  3EI0 A;  4D01 A;  2LKG A;  3U8M A;  1OED B;  5HEG A;  4Z91 A;  2Y54 A;  3RI5 A;  5HEJ A;  4HQP A;  4ZZB A;  3JAF A;  5FJV A;  4XHE A;  4ILC A;  2XQ4 A;  4HFE A;  4HFI A;  4TWH A;  4QAC A;  4UM3 P;  5AFM B;  3TLW A;  3RIA A;  3C84 A;  3WTK A;  4QH4 A;  4TWD A;  4ILA A;  5J5G A;  2UZ6 A;  4LMK A;  4UXU A;  3ZDG A;  2W8F A;  2YME A;  3JAD A;  3RQW A;  5JME A;  4WV9 A;  2XYT A;  5BW2 A;  3JAE A;  2BG9 B;  1OED E;  2LM2 A;  5J5F A;  5J0Z A;  5SYO A;  2BR7 A;  3P50 A;  2LLY A;  2YMD A;  4BQT A;  5J5H A;  4ZJS A;  2WNL A;  4HFC A;  2MAW A;  4QAA A;  4TNW A;  4F8H A;  3UQ7 A;  2BYQ A;  2BYR A;  2PGZ A;  5AFJ A;  2XQ9 A;  2ZJU A;  3SQ6 A;  4BFQ A;  4LMJ A;  3UQ4 A;  3EHZ A;  4A97 A;  1UX2 A;  4X5T A;  4ZRU A;  1OED C;  2XZ6 A;  4QAB A;  4ZK1 A;  4TWF A;  5HEU A;  1UV6 A;  4ZK4 A;  4NZB A;  2VL0 A;  3EAM A;  4AFT A;  4EZ1 A;  5J5I A;  2XYS A;  4UM3 S;  3IGQ A;  2BG9 E;  3PEO A;  4UY2 A;  3U8J A;  3U8L A;  5AFH A;  3U8K A;  3WTL A;  5LG3 A;  3T4M A;  2BYS A;  2Y7Y A;  2YN6 A;  5HEO A;  3TLU A;  2M6I A;  5L4E A;  3WTM A;  4XK9 A;  1I9B A;  2KSR A;  5HCJ A;  4FRR A;  3WIP A;  2XZ5 A;  2BG9 C;  3TLS A;  4UM3 A;  4ZR6 A;  4IL4 A;  2BR8 A;  3PMZ A;  3LSV A;  2ZJV A;  3UU5 A;  3UU3 A;  2XQ3 A;  4ILB A;  3RQU A;  3RHW A;  4A98 A;  2Y56 A;  4HFH A;  4ALX A;  5AIN A;  4TNV A;  1OED A;  2PH9 A;  4AFG A;  2X00 A;  4Z90 A;  2XNT A;  5BRX A;  3ZDH A;  4QH5 A;  2QC1 B;  3GUA A;  4LML A;  4COF A;  5KZU A;  2XQ6 A;  3C79 A;  5AFL A;  5LXB A;  5AFM A;  2WNC A;  4HFD A;  4B5D A;  3SQ9 A;  3RIF A;  4ZZC A;  5HEH A;  2XNU A;  2XQA A;  5CFB A;  2YKS A;  3UU4 A;  2BYN A;  5TVC A;  3UUB A;  2LKH A;  3TLT A;  4PIR A;  5IUX A;  3SIO A;  4DBM A;  2XQ5 A;  5KE4 A;  3SH1 A;  3WTI A;  2BG9 A;  3TLV A;  2XNV A;  2WN9 A;  4HFB A;  2YOE A;  5AFK A;  5AFN A;  2XQ8 A;  2W8G A;  2XQ7 A;  5CO5 A;  3WTH A;  5BP0 A;  4IRE A;  3UU6 A;  3ZKR A;  2WNJ A;  5HCM A;  5L47 A;  3WTJ A;  2M6B A;  4QH1 A;  4ZJT A;  3P4W A;  2C9T A;  3WTN A;  3U8N A;  4IL9 A;  2Y57 A;  2X00 D;  2WZY A;  2BYP A;  2Y58 A;  4UM1 A;  4AFH A;  2BJ0 A;  1UW6 A;  5L4H A;  3WTO A;  4NPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...