4QH1A

The glic pentameric ligand-gated ion channel (wild-type) in complex with bromoacetate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh1A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh1A01
2Y57A 3ZKRA 4QH5A 5HEOA 4QH4A 2MAWA 3PMZA 2BR7A 3UQ4A 2XQ3A 3TLWA 2XZ6A 5BW2A 4BQTA 5HEUA 2M6IA 4QAAA 4A97A 4IREA 2WNJA 5HEGA 5AINA 4ILBA 3JADA 4LMKA 4IL9A 4UM1A 5L47A 5HCJA 4Z91A 5KZUA 2XNVA 2PH9A 2WN9A 4WV9A 3T4MA 5JMEA 2XZ5A 3EHZA 4ILAA 2BG9C 3TLUA 4ZJTA 4FRRA 4NPPA 3UQ7A 2BR8A 3WTOA 5AFKA 1OEDE 3U8JA 3WIPA 4TNVA 3WTLA 3SH1A 5HCMA 3UU4A 3C84A 4ZZCA 4TWFA 2XQ6A 3RQWA 3UU5A 4F8HA 5CFBA 5HEJA 3UU8A 2C9TA 2X00A 4D01A 5SYOA 3SQ6A 2BJ0A 2XYSA 2X00D 5FJVA 2XYTA 4HFHA 4QH1A 5J5HA 4AFTA 4A98A 4TNWA 3TLTA 3RHWA 2XNUA 3PEOA 4LMLA 5BP0A 2WNCA 3RQUA 2YN6A 2LLYA 2XQ5A 4ILCA 4XK9A 4UM3S 2YMDA 3UUBA 4ZJSA 3WTJA 3WTMA 1UW6A 4B5DA 4X5TA 4ZRUA 3UU6A 1UX2A 2WNLA 3IGQA 4QABA 2BG9B 2W8FA 5LG3A 3UU3A 4UXUA 5AFLA 5AFNA 4QACA 5J5IA 4LMJA 4ZZBA 3EAMA 1OEDB 3SIOA 5LXBA 3WTIA 3ZDGA 2LKHA 2LM2A 2BYPA 4ZK1A 3WTHA 2BG9E 1I9BA 2WZYA 4HFEA 2BG9A 2Y54A 3P50A 2YKSA 2XQAA 5AFJA 5L4HA 2ZJUA 3P4WA 4NZBA 4UM3P 2BYSA 4TWHA 3TLVA 3RIFA 4TWDA 4HFIA 2QC1B 3JAEA 4EZ1A 4DBMA 3WTNA 4COFA 2YOEA 3RIAA 2VL0A 2BYRA 4UY2A 2BYQA 4PIRA 2LKGA 4AFHA 3JAFA 2XQ4A 3GUAA 4ALXA 3TLSA 2PGZA 2XQ9A 5TVCA 5AFMB 2YMEA 3SQ9A 3U8NA 3EI0A 5HEHA 5AFHA 3WTKA 2XQ8A 1OEDA 2XQ7A 2W8GA 4AFGA 2XNTA 3U8KA 5L4EA 3RI5A 5KE4A 2ZJVA 5IUXA 4ZK4A 2UZ6A 1UV6A 4HFBA 2Y7YA 4HFDA 3ZDHA 4BFQA 5CO5A 4IL4A 5J0ZA 2Y58A 2M6BA 5J5GA 3U8LA 2KSRA 3LSVA 3U8MA 2BYNA 4XHEA 1OEDC 4Z90A 5J5FA 5BRXA 4HFCA 4HQPA 3C79A 4UM3A 4ZR6A 5AFMA 2Y56A
chains in the Genus database with same CATH superfamily
3C4ZA 1HX1B 4GYRA 2WWUA 3KV9A 3RH3A 5F8PA 4ZI3D 3DJBA 5FY1A 1HG2A 1IJ6A 4X66T 2LSYA 4EZ4A 1UK5A 5FL1A 3WIPA 5LBMA 1BR0A 3AE6A 3NBXX 3UU5A 1WR6A 2IC9A 1UCUA 4QH1A 5HXHA 1WR0A 5AQPB 2E9XB 1ZV4X 3O1JA 1UGOA 2DWKA 5ABFB 4CQIA 1D0ZA 4GK0E 2JMHA 1NENA 3ZYKA 2WAUA 2E5VA 3N9QA 2VWAA 1OXZA 4NXNT 2XUEA 4EXTA 3WTIA 2IUBA 4X20E 3RYHE 1I9BA 3JC6C 2YDSA 5LOVE 3TLVA 3ANWB 5AQHB 1XMQT 4PIRA 3M3ZB 4JYAT 4U7YA 4AFHA 2HN1A 2IAKA 5DABA 2VB6A 2WDRA 2XQ8A 2BKOA 2YINA 4MFRA 2RP4A 3RLFF 3RYCE 2WCAA 4QXCB 3ZDHA 5JVDE 1QSDA 5A1LA 5FNVE 4QXHB 4B3TT 2W66A 3ABVA 1YQ3A 2WZIA 2YDQA 2JIWA 2H7OA 2LJLA 1IBMT 3ZC1A 1XNRT 3JCFA 3KFWX 2XQ3A 4LF5T 4AQFC 4IDOA 2BBJA 3JADA 2CBJA 3F57A 5DJQC 1MMAA 4WV9A 2LHNA 5J1GA 2XZ5A 2NR4A 2V7KA 2XM2A 4TNVA 4L0RA 2XQ6A 3ZCJA 4PK5A 4GIWA 1D1BA 2G0UA 4TN7B 4AQGA 3WAJA 2KT9A 1HCIA 3AEBA 4ILCA 5LGNB 1YW0A 2JQ9A 4QABA 2XPKA 2W8FA 1JNRA 2CWOA 3ZDGA 2HHHT 4UVBB 4ZK1A 1NWMX 2BG9E 5AQGB 2XAHB 5AFJA 4U31A 5AQQB 2XHEB 3PUYF 4BJNA 3CQGB 2WQYA 4H63V 4WBNE 4E7ZA 1LVFA 4EEBA 2MOZA 2XAGB 4DV6T 3E0ZA 3ZJ2A 1GQEA 1X9BA 1M7KA 3ZMVB 2Y56A 3ZN0B 2CXFA 4YJ3E 2XM1A 4TV9E 3EUHA 5JQGE 5AQMB 3KDSE 2XSBA 5FVLA 4LF7T 1U4QA 3M65A 3KINB 1XNQT 2D5UA 4Z91A 4C90A 2WDVA 3T1HT 3NRYA 1JNZA 2WDQA 2K9AA 2A3DA 2BG9C 3MACA 3GA8A 3AE9A 4HFVA 4H9SE 5ADXL 4PJNA 4L9IA 1J5WA 4ZJSA 3WTJA 5DQVA 4JBWF 3F31A 2CM0A 3IGQA 3PV0F 5AFLA 2KWHA 4NUUA 3P4RA 2D2SA 5KXJA 4FJOA 4U72A 2WZHA 4QX8B 2YDRA 2YKSA 2WB5A 1MIWA 3P4WA 4UM3P 4ZI2C 4HFIA 2KNDA 3JC6D 2BS4A 5FXXA 1HF8A 3K1SA 1MMGA 5LMUT 1YXRA 2W61A 2EHOC 4EZHA 2VQET 2V5CA 2Y58A 1FIOA 4YSYA 4KI0F 2CMRA 4OHFA 2LSIA 2BYNA 5JH7E 5HXRA 2Z6EA 2XSAA 3H3AA 2Y57A 4QH4A 1WFDA 3UQ4A 4BA9A 4UF0A 3MKDA 4PJLA 2V1DB 4OFZA 5EZYE 3BK9A 3RKOA 3A8YC 5AQNB 1OEDE 3P4SA 2WY2A 5JREA 5HYAA 2ZM2A 1HX8A 3HA4A 5AQVB 3O4XE 4EYUA 3GN5A 2XQ5A 1ZP0A 2YMDA 5JDGA 2CWYA 3UULA 3CX8B 2XAFB 5FXWA 5HXSA 2VVNA 5LG3A 4JLEA 2DI4A 2MTQA 4JV5T 3L09A 2K5BB 3ZMZB 4LF4T 3D0TA 2Y54A 2XQAA 3UT5E 3Q5WA 4TWHA 1X79A 4HN9A 4AXPA 1HFAA 4PW8A 4PFPA 4COFA 1W0BA 2E9XC 2BYQA 3L39A 4IE7A 4H9PC 5L3GB 2M67A 5EK2A 5JDFA 1T8BA 1IAPA 1NEKA 3AECA 2KLQA 5CJ5A 2YU2A 4AI6A 2HH7A 4DMVA 2EHOD 3B13A 3O9XA 4DV0T 1WLXA 1S35A 4HQPA 4XZCA 4U3CA 2W63A 4CXXA 4DNDA 3PMZA 3AAIA 5KX5E 5HEUA 4MHCA 2VKHA 2WNJA 4LF8T 4IDZA 2JQHA 3O1HA 3IA3A 2J4GA 5ABGA 3QK6A 4JEUB 2LHRA 2XZEA 2V7IA 2BR8A 2NOXA 3SH1A 4O4IE 3EABA 3PU8A 2C9TA 4IDPA 2J47A 5FJVA 3CKDA 3NVOA 2BKPA 2UUBT 4EIWA 1XWMA 3IBPA 3I1AA 2A9UA 4TUYE 4ZRUA 3UU6A 5HXCA 2VK9A 2BZBA 2LKHA 2LSKA 4PJMA 1N32T 2LM2A 3L8RA 5AFUL 4B6XA 1HNWT 4YLHA 3AE5A 3AVSA 4U2YA 5AFHA 5GONE 4ZI3C 4CN1A 3AEEA 3U8KA 4UV8B 3RX6A 4GKKT 2WBLA 5J0ZA 1T98A 2IIUA 2JMKA 1DU2A 3U8MA 2W2UA 1UX4A 4UVCB 3HKCE 5F5WA 3IF8B 3UFEA 5C2TA 4QH5A 2BR7A 1KF6A 2LSJA 3ZYLA 3TLWA 2CBIA 2JQQA 3HL6A 2KWIB 3K3OA 3BQKA 3N9PA 5M4YA 3O1IA 3OJAA 3IHRA 5F3JA 1HG5A 4HWHA 1B7TA 3WI3A 5JDLA 4PJJA 1D1AA 5L3FB 5AQTB 3AEDA 4ZZCA 3RQWA 5CFBA 2LSGA 2ZM6T 3SQ6A 2V6XA 2XYSA 3QOFA 5AQSB 4CXWA 1MNEA 4CI3B 5BP0A 4ISTA 2WWVA 3PTRB 4UM3S 1VOMA 4ZXLA 1UX2A 4M1PA 4ANJA 3UUMA 3SS1A 1WYBA 3R6NA 3SIOA 3A5XA 4DR3T 4O2BE 4Z8XA 1I6ZA 4YHJA 4X65T 2CE7A 2CLYB 4TWDA 4DR7T 4ISSA 3FZLB 3GUAA 4U74A 3ZYMA 2XQ9A 2E8IA 3DP7A 4KP3C 2W8GA 3RYIE 2ZJVA 2Q9QC 4BFQA 2Y7YA 5CO5A 1S94A 3AEFA 4PK4A 3U78A 5LGTB 3J7Yq 4DV7T 2GK9A 5LCYA 1HNZT 4ZI7E 4O8SA 2LOPA 3PU3A 3BQIA 1KNZA 3RF1A 3LK42 3SFEA 3N9LA 5JRCB 3LJCA 2M6IA 1YKEB 4A97A 4QX7B 4PAGA 4LMKA 2NWBA 2EHOB 3H37A 4DBQA 4EGWA 2NP9A 1XZYA 5C3JA 1L0VA 3AA0B 4AQFA 5JR9B 2LM9A 4IE6A 2E5LT 4F8HA 4HEAA 4D01A 3KVBA 5LMNT 4A98A 4IGUA 2W00A 5DQWA 5LXTE 4MLKA 2LRKA 4DMWA 2C0SA 2X68A 3VHLA 4X5TA 5BR8T 2ZLYA 4CN6A 3AE8A 5CB4E 2L8KA 3ESLA 2WZYA 2XJ7A 4WNKA 4NZBA 3RIFA 1HR0T 3CK6A 3JAEA 4AKRB 3ONLC 4HWCA 2LKGA 3JAFA 5L3CB 4ALXA 1FMWA 2Y6XA 4P0BA 5LG4A 4JI4T 4JI6T 1AJ3A 2CHOA 4DV2T 4ZS3A 5JTGA 2UXDT 1E2AA 4TV8E 5LHGB 2NTXA 5C8YE 3NZPA 2XQYA 5BRXA 4TZ4C 2X51A 4IT4A 2V5DA 4HKAA 3E22E 2RA1A 3ZT7A 3UTKA 2IDOB 3AA1B 2ZM0A 4E7SA 4ZHQE 5AQKB 3CWZB 4C91A 4IL9A 4UM1A 2QGSA 2K48A 2WM9A 2L3LA 2I0MA 2JJ9A 3PUSA 1ZKEA 1D1CA 4ZJTA 1SHZC 4JI0T 4HFHA 2ACXA 3RHWA 4HE8A 4H9RC 2BVLA 3IEEA 5AFNA 2N1GA 1XDOA 1BR4A 1NAFA 2H88A 2QA7A 3VRBA 2LT3A 3ONXA 3P7IA 3ETVA 5L4HA 2ZJUA 3N5LA 4X62T 4DR4T 5KDMC 2LE8A 4DV4T 4CI1B 4IE4A 4DV5T 3EI0A 3TKLB 2X9YA 4U33A 2Q9QD 5FL0A 3C98B 4X64T 3SRZA 1J1JA 2A72A 4ZEYA 3PURA 4L5GA 2OLTA 5CA1E 2XTLA 1KEYA 4P0AA 3VRAA 3ZLIA 1W9RA 2NW7A 1R8IA 1LVKA 3SWHA 4ILUA 5LBQB 1HS7A 2AXDS 4WYVA 4YXDA 1N34T 2XNVA 4QKNA 5L3EB 3LFMA 5FYMA 3KBUA 5LNKA 2NW9A 4ILAA 2Y48B 5AQOB 3CQCB 1J5ET 3AE7A 4IIJE 3UQ7A 3ONJA 2YK0A 2L9QA 2VQFT 4DV1T 3FXDB 3CVRA 1FMVA 3ZMTB 2WNCA 4HWDA 2N2NA 4N78D 3ZN1B 4H63H 3ZT5A 2K3WA 3L3PA 3UU3A 4QACA 1KNRA 1Z8UA 2MPKA 5L2LA 3C4WA 4Q25A 2E9XA 2B1EA 3P8CD 3WTHA 3QB5A 2J62A 3Q5EA 1N33T 4V1Av 2DHRA 4YSXA 2YOEA 3RIAA 4UY2A 2XQ4A 3TLSA 5FY7A 2PGZA 5LP6E 3SQ9A 1QLBA 4DVDA 3KBTA 4AKLA 2JPFA 4JUYA 2JQKA 2W62A 4JI1T 3OVUA 4HFCA 5JR9C 3C79A 3UUXB 3ZT6A 2R6GF 3DTOA 1W0AA 3ZSSA 2A2FX 2UXBT 5AQLB 3AA7B 1ZOYA 3AB3B 5LA6E 5AINA 1OWAA 2XAJB 1I94T 2PH9A 3RPUA 5CGMA 4NPPA 1V9DA 2X66A 2X00A 2W67A 5FXVA 2XAQB 2BJ0A 4K0UA 2X00D 5J5HA 4AFTA 3KV5A 4TNWA 4UXNB 3ZMSB 4UIGA 3ZPOA 3CQXC 3N2KE 2FBWA 3LBXB 3EVYA 4OYJA 2X9XA 5EK4A 3AEAA 1MNDA 4DR5T 2JRKA 2KINB 3C51A 2UUAT 5L3DB 2NW8A 4H9NC 3WTNA 3ZC0A 5HWXA 2VL0A 4U7IA 2IMLA 3I0QA 4AISA 2YMEA 3T1YT 4EOZB 1KNPA 2XQ7A 4CXYA 4P1NA 3RI5A 4KUMB 3AA6B 4XBFB 1UV6A 4IDNA 4IL4A 4EV6A 3UFGA 5LHHB 4Z90A 1IBLT 3U3IA 2EHOA 1BR2A 1MMDA 4ZOLE 4ZS2A 3LK2B 3AE3A 2X0LB 2XZ6A 2DL1A 3FXEB 4DV3T 3SFDA 3N9NA 1Z0PA 2V7LA 4KMCA 3P4QA 2CXLA 3B5MA 1WCRA 4YTMA 2PFVA 3EDUA 3AAAB 5HCMA 3C84A 2LRLA 4TWFA 4LFBT 1FJGT 2CXDA 2UXNB 2W0GA 2PTFA 3CMLA 3T8OA 1SUMB 1MIYA 4J2CA 1VCTA 3GWHA 2ES0A 1SE7A 3RC3A 4AKHA 4UXUA 3FZFB 3N2GE 4NXMT 3N2OA 1WRDA 2V6YB 4HWFA 3RIUC 1ZEEA 3P50A 4EB6E 1KFYA 2FJDA 4EAHA 4DBMA 3RRCA 3S4UA 5AQIB 3PUWF 4UR9A 5AQUB 4UEMA 4LF9T 5AFMB 5TVCA 3QNUA 3RC8A 5LJMA 4KHZF 4JI3T 3C50A 2CPTA 1OEDA 2KMFA 3I9WA 2Q9QA 4GKJT 1LRZA 2CRBA 2ODVA 3VR8A 3B57A 4CN4A 5LHIB 4DR1T 2D0TA 3CIRA 4A5XA 4B3ST 3LSVA 2P9BA 1LKXA 4PNIA 3Q5XA 2E9XD 4YT0A 3ZKRA 3OBVE 5HEOA 2J1DG 4NIQA 2X9HA 3AXJA 4QAAA 1UUSA 5JDNA 2KXPB 2RPAA 4X1IE 5JMEA 3AXJB 3ZCIA 3V5UA 3U8JA 2WSSV 3C4XA 2V6YA 2VASA 1IJ5A 2C5KT 3PUZF 2XYTA 5E0OA 2WU2A 3VR9A 3RQUA 2LLYA 4UVAB 2OV9A 3PUVF 2E2AA 5FY0A 2IC6A 1XDPA 1E1HB 5LXBA 1OEDB 2H7VC 3RIUA 2IHR1 3FBLA 2DCFA 5L3BB 2ODUA 2BYSA 2WMOA 2X0YA 4DUYT 1ZHCA 2YEVC 3U8NA 1MIVA 2HPJA 4XAXB 5HWYA 1KK7A 2X9WA 3VKGA 2FJAA 2XNTA 4DO0A 4HFDA 5J5GA 2CA5A 5ABEA 1OEDC 4HTEA 3NRXA 4UM3A 2DWGA 4JEHB 3PJAA 4BQTA 2X0HA 3AEGA 5BMVE 3K3QC 3OPCA 3I0OA 2QVAA 3LBXA 3KV4A 4F6RC 5EK3A 5KZUA 4IE0A 2C5JA 1YD8G 2CEAA 4X1YE 3AE4A 4NUVA 5AFKA 4LFAT 2V7MA 3NKZA 4YSZA 3WTKA 1W09A 5AQRB 2FJEA 3FZKB 4KBMB 3UUNA 2AE9A 3KVAA 5LJNA 3CX7B 1QUUA 1YQ4A 2YN6A 4I0UA 3C64A 2BS2A 2C5IT 3I9YA 4OX9T 3VU7H 2BG9B 3HKDE 3ANWA 2HPLA 5J5IA 4LMJA 3HI2A 4JI8T 3J9X1 3EAMA 5ABFA 1VCSA 2XY8B 2K24A 2WP9A 2BG9A 2D9DA 5JR9A 5IYZE 1H7CA 2MBGA 3QC9A 3ZSTA 2BDEA 4DBRA 2H3RA 4DR6T 3LG7A 1IBKT 2BBHA 2IW5B 3GN5B 1M62A 2ZM8A 4CZZB 2V7JA 2W4XA 4I55E 5J2UE 5AQJB 2MYSA 4TX5A 4ZK4A 2PG8A 2BVMA 3PUXF 3PUAA 4AKGA 5H6RB 4LFCT 2N9DA 4XHEA 4WW0A 5KMGP 3NWIA 3OYZA 3LDQB 2ZMAA 4U2ZA 4KHPT 5FVKA 5J2TE 3ZJ1A 2DLRA 2X67A 4IREA 3ZMUB 4ILBA 3FB2A 2LOSA 3PE0A 1WYCA 3T4MA 4O4JE 4B3MT 4YFSA 3P4PA 3EHZA 3HKEE 5JDMA 4YY3T 2WS3A 4FRRA 3WTOA 5JRCA 3WTLA 3UU4A 4LF6T 5HEJA 4WZXA 3QUJA 5SYOA 2Y8DA 4QWNB 3RKGA 3TLTA 3PJAJ 4LMLA 3CPZA 2ACZA 4HWIB 4XK9A 4GYSA 5FXZA 3UUBA 1UW6A 4B5DA 3R84B 2Q9QB 1N36T 4JI7T 1HTJF 3MA9A 2UU9T 3ETUA 1VRBA 1D0YA 4A56A 4EEDA 2WU5A 2UUCT 3EDVA 1XMOT 4HFEA 1T7SA 3OKQA 4H9OC 2XASB 1UURA 4EZ1A 1MMNA 4YJ2E 4DR2T 3X1DA 4BJMA 4ERRA 1UX5A 1Y64B 2VL8A 3FZHB 3NZQA 3N9OA 3AE2A 5L4EA 4O4HE 3SOLA 2OA5A 4PK6A 5KE4A 1HNXT 5IUXA 4IDQA 2UZ6A 2M6BA 3U8LA 2CCQA 4ZI2D 1YKHB 2PJQA 5AFMA 2VKOA 3MJXA 3RGLA 2CLYC 4EYYR 2QYWA 1SA0E 4G63A 2F4VT 4HGAA 5HEGA 4QHOA 3AVRA 4K0KT 5L47A 1CHUA 5HCJA 4JI5T 4UELA 3OYXA 5ETWA 2WN9A 4MALA 3GMIA 5LGUB 3KV6A 4O2AE 3Q2MA 1E7PA 3PUQA 3PDYA 1FEWA 3K8PC 1EZ3A 4YTNA 2QRXA 5LYJE 3RYFE 5HAXA 4JI2T 4OK0A 4P09A 4AIUA 1T72A 2I6HA 3FHNA 1Y01A 5JDQA 2NTYA 4IHJE 2KZ7B 3ZEFB 4GOUA 2WNLA 3H3MA 1G8XA 4YHHT 2D0UA 4BAYB 4X1KE 3HKBE 3MK7C 4WBOA 5FMNA 2BYPA 2HN2A 3CX6B 3HR0A 2FUPA 2FJBA 5FP3A 1CUNA 1U5PA 2CHNA 2BYRA 3AAEB 1US7B 4I4TE 2WMNA 3W15B 3QB5K 4B3RT 4AFGA 3VKHA 3LK3B 4HFBA 3AE1A 5JDHA 2PBIA 2VKJA 4H9QC 5FKYA 2BKNA 5LB7B 2V26A 5AQFB 2MAWA 1IZNB 3MXZA 5BW2A 2DNXA 4I43B 1G73A 4PFOA 3Q9DA 5CA0E 4KX6A 3BQLA 3K3NA 3F2EA 2SPCA 4ADZA 4O4LE 3N9MA 3TLUA 4IE5A 5TAOA 3UU8A 4OYKA 2B76A 2I59A 2VKDA 2XNUA 4MBQA 2UXCT 3PEOA 3OTOT 3WTMA 4YTPA 3V5SA 2VVSA 3E08A 2V8SV 3A7MA 2H89A 4DIDB 4ZZBA 5IWAT 3FBZA 3MZKB 2QC1B 3Q5DA 4AQYT 2BS3A 4CI2B 5HXEA 4ASKA 4G2AA 5IHYA 4GK5E 5HEHA 1BR1A 2VURA 4I50E 5H6QB 2LEHA 4UF0B 4FI5A 4QXBB 1O3XA 1D0XA 3PUGA 4DUZT 2KSRA 2UXXB 4AKIA 3RRWA 5J5FA 2YU1A 3G06A 5ABHA 3WAKA 4ZR6A 3FZMB 4UV9B
chains in the Genus database with same CATH topology
2Y57A 3ZKRA 4QH5A 5HEOA 4QH4A 2MAWA 3PMZA 2BR7A 3UQ4A 2XQ3A 3TLWA 2XZ6A 5BW2A 4BQTA 5HEUA 2M6IA 4QAAA 4A97A 4IREA 2WNJA 5HEGA 5AINA 4ILBA 3JADA 4LMKA 4IL9A 4UM1A 5L47A 5HCJA 4Z91A 5KZUA 2XNVA 2PH9A 2WN9A 4WV9A 3T4MA 5JMEA 2XZ5A 3EHZA 4ILAA 2BG9C 3TLUA 4ZJTA 4FRRA 4NPPA 3UQ7A 2BR8A 3WTOA 5AFKA 1OEDE 3U8JA 3WIPA 4TNVA 3WTLA 3SH1A 5HCMA 3UU4A 3C84A 4ZZCA 4TWFA 2XQ6A 3RQWA 3UU5A 4F8HA 5CFBA 5HEJA 3UU8A 2C9TA 2X00A 4D01A 5SYOA 3SQ6A 2BJ0A 2XYSA 2X00D 5FJVA 2XYTA 4HFHA 4QH1A 5J5HA 4AFTA 4A98A 4TNWA 3TLTA 3RHWA 2XNUA 3PEOA 4LMLA 5BP0A 2WNCA 3RQUA 2YN6A 2LLYA 2XQ5A 4ILCA 4XK9A 4UM3S 2YMDA 3UUBA 4ZJSA 3WTJA 3WTMA 1UW6A 4B5DA 4X5TA 4ZRUA 3UU6A 1UX2A 2WNLA 3IGQA 4QABA 2BG9B 2W8FA 5LG3A 3UU3A 4UXUA 5AFLA 5AFNA 4QACA 5J5IA 4LMJA 4ZZBA 3EAMA 1OEDB 3SIOA 5LXBA 3WTIA 3ZDGA 2LKHA 2LM2A 2BYPA 4ZK1A 3WTHA 2BG9E 1I9BA 2WZYA 4HFEA 2BG9A 2Y54A 3P50A 2YKSA 2XQAA 5AFJA 5L4HA 2ZJUA 3P4WA 4NZBA 4UM3P 2BYSA 4TWHA 3TLVA 3RIFA 4TWDA 4HFIA 2QC1B 3JAEA 4EZ1A 4DBMA 3WTNA 4COFA 2YOEA 3RIAA 2VL0A 2BYRA 4UY2A 2BYQA 4PIRA 2LKGA 4AFHA 3JAFA 2XQ4A 3GUAA 4ALXA 3TLSA 2PGZA 2XQ9A 5TVCA 5AFMB 2YMEA 3SQ9A 3U8NA 3EI0A 5HEHA 5AFHA 3WTKA 2XQ8A 1OEDA 2XQ7A 2W8GA 4AFGA 2XNTA 3U8KA 5L4EA 3RI5A 5KE4A 2ZJVA 5IUXA 4ZK4A 2UZ6A 1UV6A 4HFBA 2Y7YA 4HFDA 3ZDHA 4BFQA 5CO5A 4IL4A 5J0ZA 2Y58A 2M6BA 5J5GA 3U8LA 2KSRA 3LSVA 3U8MA 2BYNA 4XHEA 1OEDC 4Z90A 5J5FA 5BRXA 4HFCA 4HQPA 3C79A 4UM3A 4ZR6A 5AFMA 2Y56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y57 A;  3ZKR A;  4QH5 A;  5HEO A;  4QH4 A;  2MAW A;  3PMZ A;  2BR7 A;  3UQ4 A;  2XQ3 A;  3TLW A;  2XZ6 A;  5BW2 A;  4BQT A;  5HEU A;  2M6I A;  4QAA A;  4A97 A;  4IRE A;  2WNJ A;  5HEG A;  5AIN A;  4ILB A;  3JAD A;  4LMK A;  4IL9 A;  4UM1 A;  5L47 A;  5HCJ A;  4Z91 A;  5KZU A;  2XNV A;  2PH9 A;  2WN9 A;  4WV9 A;  3T4M A;  5JME A;  2XZ5 A;  3EHZ A;  4ILA A;  2BG9 C;  3TLU A;  4ZJT A;  4FRR A;  4NPP A;  3UQ7 A;  2BR8 A;  3WTO A;  5AFK A;  1OED E;  3U8J A;  3WIP A;  4TNV A;  3WTL A;  3SH1 A;  5HCM A;  3UU4 A;  3C84 A;  4ZZC A;  4TWF A;  2XQ6 A;  3RQW A;  3UU5 A;  4F8H A;  5CFB A;  5HEJ A;  3UU8 A;  2C9T A;  2X00 A;  4D01 A;  5SYO A;  3SQ6 A;  2BJ0 A;  2XYS A;  2X00 D;  5FJV A;  2XYT A;  4HFH A;  4QH1 A;  5J5H A;  4AFT A;  4A98 A;  4TNW A;  3TLT A;  3RHW A;  2XNU A;  3PEO A;  4LML A;  5BP0 A;  2WNC A;  3RQU A;  2YN6 A;  2LLY A;  2XQ5 A;  4ILC A;  4XK9 A;  4UM3 S;  2YMD A;  3UUB A;  4ZJS A;  3WTJ A;  3WTM A;  1UW6 A;  4B5D A;  4X5T A;  4ZRU A;  3UU6 A;  1UX2 A;  2WNL A;  3IGQ A;  4QAB A;  2BG9 B;  2W8F A;  5LG3 A;  3UU3 A;  4UXU A;  5AFL A;  5AFN A;  4QAC A;  5J5I A;  4LMJ A;  4ZZB A;  3EAM A;  1OED B;  3SIO A;  5LXB A;  3WTI A;  3ZDG A;  2LKH A;  2LM2 A;  2BYP A;  4ZK1 A;  3WTH A;  2BG9 E;  1I9B A;  2WZY A;  4HFE A;  2BG9 A;  2Y54 A;  3P50 A;  2YKS A;  2XQA A;  5AFJ A;  5L4H A;  2ZJU A;  3P4W A;  4NZB A;  4UM3 P;  2BYS A;  4TWH A;  3TLV A;  3RIF A;  4TWD A;  4HFI A;  2QC1 B;  3JAE A;  4EZ1 A;  4DBM A;  3WTN A;  4COF A;  2YOE A;  3RIA A;  2VL0 A;  2BYR A;  4UY2 A;  2BYQ A;  4PIR A;  2LKG A;  4AFH A;  3JAF A;  2XQ4 A;  3GUA A;  4ALX A;  3TLS A;  2PGZ A;  2XQ9 A;  5TVC A;  5AFM B;  2YME A;  3SQ9 A;  3U8N A;  3EI0 A;  5HEH A;  5AFH A;  3WTK A;  2XQ8 A;  1OED A;  2XQ7 A;  2W8G A;  4AFG A;  2XNT A;  3U8K A;  5L4E A;  3RI5 A;  5KE4 A;  2ZJV A;  5IUX A;  4ZK4 A;  2UZ6 A;  1UV6 A;  4HFB A;  2Y7Y A;  4HFD A;  3ZDH A;  4BFQ A;  5CO5 A;  4IL4 A;  5J0Z A;  2Y58 A;  2M6B A;  5J5G A;  3U8L A;  2KSR A;  3LSV A;  3U8M A;  2BYN A;  4XHE A;  1OED C;  4Z90 A;  5J5F A;  5BRX A;  4HFC A;  4HQP A;  3C79 A;  4UM3 A;  4ZR6 A;  5AFM A;  2Y56 A; 
#chains in the Genus database with same CATH topology
 3C4Z A;  1HX1 B;  4GYR A;  2WWU A;  3KV9 A;  3RH3 A;  5F8P A;  4ZI3 D;  3DJB A;  5FY1 A;  1HG2 A;  1IJ6 A;  4X66 T;  2LSY A;  4EZ4 A;  1UK5 A;  5FL1 A;  3WIP A;  5LBM A;  1BR0 A;  3AE6 A;  3NBX X;  3UU5 A;  1WR6 A;  2IC9 A;  1UCU A;  4QH1 A;  5HXH A;  1WR0 A;  5AQP B;  2E9X B;  1ZV4 X;  3O1J A;  1UGO A;  2DWK A;  5ABF B;  4CQI A;  1D0Z A;  4GK0 E;  2JMH A;  1NEN A;  3ZYK A;  2WAU A;  2E5V A;  3N9Q A;  2VWA A;  1OXZ A;  4NXN T;  2XUE A;  4EXT A;  3WTI A;  2IUB A;  4X20 E;  3RYH E;  1I9B A;  3JC6 C;  2YDS A;  5LOV E;  3TLV A;  3ANW B;  5AQH B;  1XMQ T;  4PIR A;  3M3Z B;  4JYA T;  4U7Y A;  4AFH A;  2HN1 A;  2IAK A;  5DAB A;  2VB6 A;  2WDR A;  2XQ8 A;  2BKO A;  2YIN A;  4MFR A;  2RP4 A;  3RLF F;  3RYC E;  2WCA A;  4QXC B;  3ZDH A;  5JVD E;  1QSD A;  5A1L A;  5FNV E;  4QXH B;  4B3T T;  2W66 A;  3ABV A;  1YQ3 A;  2WZI A;  2YDQ A;  2JIW A;  2H7O A;  2LJL A;  1IBM T;  3ZC1 A;  1XNR T;  3JCF A;  3KFW X;  2XQ3 A;  4LF5 T;  4AQF C;  4IDO A;  2BBJ A;  3JAD A;  2CBJ A;  3F57 A;  5DJQ C;  1MMA A;  4WV9 A;  2LHN A;  5J1G A;  2XZ5 A;  2NR4 A;  2V7K A;  2XM2 A;  4TNV A;  4L0R A;  2XQ6 A;  3ZCJ A;  4PK5 A;  4GIW A;  1D1B A;  2G0U A;  4TN7 B;  4AQG A;  3WAJ A;  2KT9 A;  1HCI A;  3AEB A;  4ILC A;  5LGN B;  1YW0 A;  2JQ9 A;  4QAB A;  2XPK A;  2W8F A;  1JNR A;  2CWO A;  3ZDG A;  2HHH T;  4UVB B;  4ZK1 A;  1NWM X;  2BG9 E;  5AQG B;  2XAH B;  5AFJ A;  4U31 A;  5AQQ B;  2XHE B;  3PUY F;  4BJN A;  3CQG B;  2WQY A;  4H63 V;  4WBN E;  4E7Z A;  1LVF A;  4EEB A;  2MOZ A;  2XAG B;  4DV6 T;  3E0Z A;  3ZJ2 A;  1GQE A;  1X9B A;  1M7K A;  3ZMV B;  2Y56 A;  3ZN0 B;  2CXF A;  4YJ3 E;  2XM1 A;  4TV9 E;  3EUH A;  5JQG E;  5AQM B;  3KDS E;  2XSB A;  5FVL A;  4LF7 T;  1U4Q A;  3M65 A;  3KIN B;  1XNQ T;  2D5U A;  4Z91 A;  4C90 A;  2WDV A;  3T1H T;  3NRY A;  1JNZ A;  2WDQ A;  2K9A A;  2A3D A;  2BG9 C;  3MAC A;  3GA8 A;  3AE9 A;  4HFV A;  4H9S E;  5ADX L;  4PJN A;  4L9I A;  1J5W A;  4ZJS A;  3WTJ A;  5DQV A;  4JBW F;  3F31 A;  2CM0 A;  3IGQ A;  3PV0 F;  5AFL A;  2KWH A;  4NUU A;  3P4R A;  2D2S A;  5KXJ A;  4FJO A;  4U72 A;  2WZH A;  4QX8 B;  2YDR A;  2YKS A;  2WB5 A;  1MIW A;  3P4W A;  4UM3 P;  4ZI2 C;  4HFI A;  2KND A;  3JC6 D;  2BS4 A;  5FXX A;  1HF8 A;  3K1S A;  1MMG A;  5LMU T;  1YXR A;  2W61 A;  2EHO C;  4EZH A;  2VQE T;  2V5C A;  2Y58 A;  1FIO A;  4YSY A;  4KI0 F;  2CMR A;  4OHF A;  2LSI A;  2BYN A;  5JH7 E;  5HXR A;  2Z6E A;  2XSA A;  3H3A A;  2Y57 A;  4QH4 A;  1WFD A;  3UQ4 A;  4BA9 A;  4UF0 A;  3MKD A;  4PJL A;  2V1D B;  4OFZ A;  5EZY E;  3BK9 A;  3RKO A;  3A8Y C;  5AQN B;  1OED E;  3P4S A;  2WY2 A;  5JRE A;  5HYA A;  2ZM2 A;  1HX8 A;  3HA4 A;  5AQV B;  3O4X E;  4EYU A;  3GN5 A;  2XQ5 A;  1ZP0 A;  2YMD A;  5JDG A;  2CWY A;  3UUL A;  3CX8 B;  2XAF B;  5FXW A;  5HXS A;  2VVN A;  5LG3 A;  4JLE A;  2DI4 A;  2MTQ A;  4JV5 T;  3L09 A;  2K5B B;  3ZMZ B;  4LF4 T;  3D0T A;  2Y54 A;  2XQA A;  3UT5 E;  3Q5W A;  4TWH A;  1X79 A;  4HN9 A;  4AXP A;  1HFA A;  4PW8 A;  4PFP A;  4COF A;  1W0B A;  2E9X C;  2BYQ A;  3L39 A;  4IE7 A;  4H9P C;  5L3G B;  2M67 A;  5EK2 A;  5JDF A;  1T8B A;  1IAP A;  1NEK A;  3AEC A;  2KLQ A;  5CJ5 A;  2YU2 A;  4AI6 A;  2HH7 A;  4DMV A;  2EHO D;  3B13 A;  3O9X A;  4DV0 T;  1WLX A;  1S35 A;  4HQP A;  4XZC A;  4U3C A;  2W63 A;  4CXX A;  4DND A;  3PMZ A;  3AAI A;  5KX5 E;  5HEU A;  4MHC A;  2VKH A;  2WNJ A;  4LF8 T;  4IDZ A;  2JQH A;  3O1H A;  3IA3 A;  2J4G A;  5ABG A;  3QK6 A;  4JEU B;  2LHR A;  2XZE A;  2V7I A;  2BR8 A;  2NOX A;  3SH1 A;  4O4I E;  3EAB A;  3PU8 A;  2C9T A;  4IDP A;  2J47 A;  5FJV A;  3CKD A;  3NVO A;  2BKP A;  2UUB T;  4EIW A;  1XWM A;  3IBP A;  3I1A A;  2A9U A;  4TUY E;  4ZRU A;  3UU6 A;  5HXC A;  2VK9 A;  2BZB A;  2LKH A;  2LSK A;  4PJM A;  1N32 T;  2LM2 A;  3L8R A;  5AFU L;  4B6X A;  1HNW T;  4YLH A;  3AE5 A;  3AVS A;  4U2Y A;  5AFH A;  5GON E;  4ZI3 C;  4CN1 A;  3AEE A;  3U8K A;  4UV8 B;  3RX6 A;  4GKK T;  2WBL A;  5J0Z A;  1T98 A;  2IIU A;  2JMK A;  1DU2 A;  3U8M A;  2W2U A;  1UX4 A;  4UVC B;  3HKC E;  5F5W A;  3IF8 B;  3UFE A;  5C2T A;  4QH5 A;  2BR7 A;  1KF6 A;  2LSJ A;  3ZYL A;  3TLW A;  2CBI A;  2JQQ A;  3HL6 A;  2KWI B;  3K3O A;  3BQK A;  3N9P A;  5M4Y A;  3O1I A;  3OJA A;  3IHR A;  5F3J A;  1HG5 A;  4HWH A;  1B7T A;  3WI3 A;  5JDL A;  4PJJ A;  1D1A A;  5L3F B;  5AQT B;  3AED A;  4ZZC A;  3RQW A;  5CFB A;  2LSG A;  2ZM6 T;  3SQ6 A;  2V6X A;  2XYS A;  3QOF A;  5AQS B;  4CXW A;  1MNE A;  4CI3 B;  5BP0 A;  4IST A;  2WWV A;  3PTR B;  4UM3 S;  1VOM A;  4ZXL A;  1UX2 A;  4M1P A;  4ANJ A;  3UUM A;  3SS1 A;  1WYB A;  3R6N A;  3SIO A;  3A5X A;  4DR3 T;  4O2B E;  4Z8X A;  1I6Z A;  4YHJ A;  4X65 T;  2CE7 A;  2CLY B;  4TWD A;  4DR7 T;  4ISS A;  3FZL B;  3GUA A;  4U74 A;  3ZYM A;  2XQ9 A;  2E8I A;  3DP7 A;  4KP3 C;  2W8G A;  3RYI E;  2ZJV A;  2Q9Q C;  4BFQ A;  2Y7Y A;  5CO5 A;  1S94 A;  3AEF A;  4PK4 A;  3U78 A;  5LGT B;  3J7Y q;  4DV7 T;  2GK9 A;  5LCY A;  1HNZ T;  4ZI7 E;  4O8S A;  2LOP A;  3PU3 A;  3BQI A;  1KNZ A;  3RF1 A;  3LK4 2;  3SFE A;  3N9L A;  5JRC B;  3LJC A;  2M6I A;  1YKE B;  4A97 A;  4QX7 B;  4PAG A;  4LMK A;  2NWB A;  2EHO B;  3H37 A;  4DBQ A;  4EGW A;  2NP9 A;  1XZY A;  5C3J A;  1L0V A;  3AA0 B;  4AQF A;  5JR9 B;  2LM9 A;  4IE6 A;  2E5L T;  4F8H A;  4HEA A;  4D01 A;  3KVB A;  5LMN T;  4A98 A;  4IGU A;  2W00 A;  5DQW A;  5LXT E;  4MLK A;  2LRK A;  4DMW A;  2C0S A;  2X68 A;  3VHL A;  4X5T A;  5BR8 T;  2ZLY A;  4CN6 A;  3AE8 A;  5CB4 E;  2L8K A;  3ESL A;  2WZY A;  2XJ7 A;  4WNK A;  4NZB A;  3RIF A;  1HR0 T;  3CK6 A;  3JAE A;  4AKR B;  3ONL C;  4HWC A;  2LKG A;  3JAF A;  5L3C B;  4ALX A;  1FMW A;  2Y6X A;  4P0B A;  5LG4 A;  4JI4 T;  4JI6 T;  1AJ3 A;  2CHO A;  4DV2 T;  4ZS3 A;  5JTG A;  2UXD T;  1E2A A;  4TV8 E;  5LHG B;  2NTX A;  5C8Y E;  3NZP A;  2XQY A;  5BRX A;  4TZ4 C;  2X51 A;  4IT4 A;  2V5D A;  4HKA A;  3E22 E;  2RA1 A;  3ZT7 A;  3UTK A;  2IDO B;  3AA1 B;  2ZM0 A;  4E7S A;  4ZHQ E;  5AQK B;  3CWZ B;  4C91 A;  4IL9 A;  4UM1 A;  2QGS A;  2K48 A;  2WM9 A;  2L3L A;  2I0M A;  2JJ9 A;  3PUS A;  1ZKE A;  1D1C A;  4ZJT A;  1SHZ C;  4JI0 T;  4HFH A;  2ACX A;  3RHW A;  4HE8 A;  4H9R C;  2BVL A;  3IEE A;  5AFN A;  2N1G A;  1XDO A;  1BR4 A;  1NAF A;  2H88 A;  2QA7 A;  3VRB A;  2LT3 A;  3ONX A;  3P7I A;  3ETV A;  5L4H A;  2ZJU A;  3N5L A;  4X62 T;  4DR4 T;  5KDM C;  2LE8 A;  4DV4 T;  4CI1 B;  4IE4 A;  4DV5 T;  3EI0 A;  3TKL B;  2X9Y A;  4U33 A;  2Q9Q D;  5FL0 A;  3C98 B;  4X64 T;  3SRZ A;  1J1J A;  2A72 A;  4ZEY A;  3PUR A;  4L5G A;  2OLT A;  5CA1 E;  2XTL A;  1KEY A;  4P0A A;  3VRA A;  3ZLI A;  1W9R A;  2NW7 A;  1R8I A;  1LVK A;  3SWH A;  4ILU A;  5LBQ B;  1HS7 A;  2AXD S;  4WYV A;  4YXD A;  1N34 T;  2XNV A;  4QKN A;  5L3E B;  3LFM A;  5FYM A;  3KBU A;  5LNK A;  2NW9 A;  4ILA A;  2Y48 B;  5AQO B;  3CQC B;  1J5E T;  3AE7 A;  4IIJ E;  3UQ7 A;  3ONJ A;  2YK0 A;  2L9Q A;  2VQF T;  4DV1 T;  3FXD B;  3CVR A;  1FMV A;  3ZMT B;  2WNC A;  4HWD A;  2N2N A;  4N78 D;  3ZN1 B;  4H63 H;  3ZT5 A;  2K3W A;  3L3P A;  3UU3 A;  4QAC A;  1KNR A;  1Z8U A;  2MPK A;  5L2L A;  3C4W A;  4Q25 A;  2E9X A;  2B1E A;  3P8C D;  3WTH A;  3QB5 A;  2J62 A;  3Q5E A;  1N33 T;  4V1A v;  2DHR A;  4YSX A;  2YOE A;  3RIA A;  4UY2 A;  2XQ4 A;  3TLS A;  5FY7 A;  2PGZ A;  5LP6 E;  3SQ9 A;  1QLB A;  4DVD A;  3KBT A;  4AKL A;  2JPF A;  4JUY A;  2JQK A;  2W62 A;  4JI1 T;  3OVU A;  4HFC A;  5JR9 C;  3C79 A;  3UUX B;  3ZT6 A;  2R6G F;  3DTO A;  1W0A A;  3ZSS A;  2A2F X;  2UXB T;  5AQL B;  3AA7 B;  1ZOY A;  3AB3 B;  5LA6 E;  5AIN A;  1OWA A;  2XAJ B;  1I94 T;  2PH9 A;  3RPU A;  5CGM A;  4NPP A;  1V9D A;  2X66 A;  2X00 A;  2W67 A;  5FXV A;  2XAQ B;  2BJ0 A;  4K0U A;  2X00 D;  5J5H A;  4AFT A;  3KV5 A;  4TNW A;  4UXN B;  3ZMS B;  4UIG A;  3ZPO A;  3CQX C;  3N2K E;  2FBW A;  3LBX B;  3EVY A;  4OYJ A;  2X9X A;  5EK4 A;  3AEA A;  1MND A;  4DR5 T;  2JRK A;  2KIN B;  3C51 A;  2UUA T;  5L3D B;  2NW8 A;  4H9N C;  3WTN A;  3ZC0 A;  5HWX A;  2VL0 A;  4U7I A;  2IML A;  3I0Q A;  4AIS A;  2YME A;  3T1Y T;  4EOZ B;  1KNP A;  2XQ7 A;  4CXY A;  4P1N A;  3RI5 A;  4KUM B;  3AA6 B;  4XBF B;  1UV6 A;  4IDN A;  4IL4 A;  4EV6 A;  3UFG A;  5LHH B;  4Z90 A;  1IBL T;  3U3I A;  2EHO A;  1BR2 A;  1MMD A;  4ZOL E;  4ZS2 A;  3LK2 B;  3AE3 A;  2X0L B;  2XZ6 A;  2DL1 A;  3FXE B;  4DV3 T;  3SFD A;  3N9N A;  1Z0P A;  2V7L A;  4KMC A;  3P4Q A;  2CXL A;  3B5M A;  1WCR A;  4YTM A;  2PFV A;  3EDU A;  3AAA B;  5HCM A;  3C84 A;  2LRL A;  4TWF A;  4LFB T;  1FJG T;  2CXD A;  2UXN B;  2W0G A;  2PTF A;  3CML A;  3T8O A;  1SUM B;  1MIY A;  4J2C A;  1VCT A;  3GWH A;  2ES0 A;  1SE7 A;  3RC3 A;  4AKH A;  4UXU A;  3FZF B;  3N2G E;  4NXM T;  3N2O A;  1WRD A;  2V6Y B;  4HWF A;  3RIU C;  1ZEE A;  3P50 A;  4EB6 E;  1KFY A;  2FJD A;  4EAH A;  4DBM A;  3RRC A;  3S4U A;  5AQI B;  3PUW F;  4UR9 A;  5AQU B;  4UEM A;  4LF9 T;  5AFM B;  5TVC A;  3QNU A;  3RC8 A;  5LJM A;  4KHZ F;  4JI3 T;  3C50 A;  2CPT A;  1OED A;  2KMF A;  3I9W A;  2Q9Q A;  4GKJ T;  1LRZ A;  2CRB A;  2ODV A;  3VR8 A;  3B57 A;  4CN4 A;  5LHI B;  4DR1 T;  2D0T A;  3CIR A;  4A5X A;  4B3S T;  3LSV A;  2P9B A;  1LKX A;  4PNI A;  3Q5X A;  2E9X D;  4YT0 A;  3ZKR A;  3OBV E;  5HEO A;  2J1D G;  4NIQ A;  2X9H A;  3AXJ A;  4QAA A;  1UUS A;  5JDN A;  2KXP B;  2RPA A;  4X1I E;  5JME A;  3AXJ B;  3ZCI A;  3V5U A;  3U8J A;  2WSS V;  3C4X A;  2V6Y A;  2VAS A;  1IJ5 A;  2C5K T;  3PUZ F;  2XYT A;  5E0O A;  2WU2 A;  3VR9 A;  3RQU A;  2LLY A;  4UVA B;  2OV9 A;  3PUV F;  2E2A A;  5FY0 A;  2IC6 A;  1XDP A;  1E1H B;  5LXB A;  1OED B;  2H7V C;  3RIU A;  2IHR 1;  3FBL A;  2DCF A;  5L3B B;  2ODU A;  2BYS A;  2WMO A;  2X0Y A;  4DUY T;  1ZHC A;  2YEV C;  3U8N A;  1MIV A;  2HPJ A;  4XAX B;  5HWY A;  1KK7 A;  2X9W A;  3VKG A;  2FJA A;  2XNT A;  4DO0 A;  4HFD A;  5J5G A;  2CA5 A;  5ABE A;  1OED C;  4HTE A;  3NRX A;  4UM3 A;  2DWG A;  4JEH B;  3PJA A;  4BQT A;  2X0H A;  3AEG A;  5BMV E;  3K3Q C;  3OPC A;  3I0O A;  2QVA A;  3LBX A;  3KV4 A;  4F6R C;  5EK3 A;  5KZU A;  4IE0 A;  2C5J A;  1YD8 G;  2CEA A;  4X1Y E;  3AE4 A;  4NUV A;  5AFK A;  4LFA T;  2V7M A;  3NKZ A;  4YSZ A;  3WTK A;  1W09 A;  5AQR B;  2FJE A;  3FZK B;  4KBM B;  3UUN A;  2AE9 A;  3KVA A;  5LJN A;  3CX7 B;  1QUU A;  1YQ4 A;  2YN6 A;  4I0U A;  3C64 A;  2BS2 A;  2C5I T;  3I9Y A;  4OX9 T;  3VU7 H;  2BG9 B;  3HKD E;  3ANW A;  2HPL A;  5J5I A;  4LMJ A;  3HI2 A;  4JI8 T;  3J9X 1;  3EAM A;  5ABF A;  1VCS A;  2XY8 B;  2K24 A;  2WP9 A;  2BG9 A;  2D9D A;  5JR9 A;  5IYZ E;  1H7C A;  2MBG A;  3QC9 A;  3ZST A;  2BDE A;  4DBR A;  2H3R A;  4DR6 T;  3LG7 A;  1IBK T;  2BBH A;  2IW5 B;  3GN5 B;  1M62 A;  2ZM8 A;  4CZZ B;  2V7J A;  2W4X A;  4I55 E;  5J2U E;  5AQJ B;  2MYS A;  4TX5 A;  4ZK4 A;  2PG8 A;  2BVM A;  3PUX F;  3PUA A;  4AKG A;  5H6R B;  4LFC T;  2N9D A;  4XHE A;  4WW0 A;  5KMG P;  3NWI A;  3OYZ A;  3LDQ B;  2ZMA A;  4U2Z A;  4KHP T;  5FVK A;  5J2T E;  3ZJ1 A;  2DLR A;  2X67 A;  4IRE A;  3ZMU B;  4ILB A;  3FB2 A;  2LOS A;  3PE0 A;  1WYC A;  3T4M A;  4O4J E;  4B3M T;  4YFS A;  3P4P A;  3EHZ A;  3HKE E;  5JDM A;  4YY3 T;  2WS3 A;  4FRR A;  3WTO A;  5JRC A;  3WTL A;  3UU4 A;  4LF6 T;  5HEJ A;  4WZX A;  3QUJ A;  5SYO A;  2Y8D A;  4QWN B;  3RKG A;  3TLT A;  3PJA J;  4LML A;  3CPZ A;  2ACZ A;  4HWI B;  4XK9 A;  4GYS A;  5FXZ A;  3UUB A;  1UW6 A;  4B5D A;  3R84 B;  2Q9Q B;  1N36 T;  4JI7 T;  1HTJ F;  3MA9 A;  2UU9 T;  3ETU A;  1VRB A;  1D0Y A;  4A56 A;  4EED A;  2WU5 A;  2UUC T;  3EDV A;  1XMO T;  4HFE A;  1T7S A;  3OKQ A;  4H9O C;  2XAS B;  1UUR A;  4EZ1 A;  1MMN A;  4YJ2 E;  4DR2 T;  3X1D A;  4BJM A;  4ERR A;  1UX5 A;  1Y64 B;  2VL8 A;  3FZH B;  3NZQ A;  3N9O A;  3AE2 A;  5L4E A;  4O4H E;  3SOL A;  2OA5 A;  4PK6 A;  5KE4 A;  1HNX T;  5IUX A;  4IDQ A;  2UZ6 A;  2M6B A;  3U8L A;  2CCQ A;  4ZI2 D;  1YKH B;  2PJQ A;  5AFM A;  2VKO A;  3MJX A;  3RGL A;  2CLY C;  4EYY R;  2QYW A;  1SA0 E;  4G63 A;  2F4V T;  4HGA A;  5HEG A;  4QHO A;  3AVR A;  4K0K T;  5L47 A;  1CHU A;  5HCJ A;  4JI5 T;  4UEL A;  3OYX A;  5ETW A;  2WN9 A;  4MAL A;  3GMI A;  5LGU B;  3KV6 A;  4O2A E;  3Q2M A;  1E7P A;  3PUQ A;  3PDY A;  1FEW A;  3K8P C;  1EZ3 A;  4YTN A;  2QRX A;  5LYJ E;  3RYF E;  5HAX A;  4JI2 T;  4OK0 A;  4P09 A;  4AIU A;  1T72 A;  2I6H A;  3FHN A;  1Y01 A;  5JDQ A;  2NTY A;  4IHJ E;  2KZ7 B;  3ZEF B;  4GOU A;  2WNL A;  3H3M A;  1G8X A;  4YHH T;  2D0U A;  4BAY B;  4X1K E;  3HKB E;  3MK7 C;  4WBO A;  5FMN A;  2BYP A;  2HN2 A;  3CX6 B;  3HR0 A;  2FUP A;  2FJB A;  5FP3 A;  1CUN A;  1U5P A;  2CHN A;  2BYR A;  3AAE B;  1US7 B;  4I4T E;  2WMN A;  3W15 B;  3QB5 K;  4B3R T;  4AFG A;  3VKH A;  3LK3 B;  4HFB A;  3AE1 A;  5JDH A;  2PBI A;  2VKJ A;  4H9Q C;  5FKY A;  2BKN A;  5LB7 B;  2V26 A;  5AQF B;  2MAW A;  1IZN B;  3MXZ A;  5BW2 A;  2DNX A;  4I43 B;  1G73 A;  4PFO A;  3Q9D A;  5CA0 E;  4KX6 A;  3BQL A;  3K3N A;  3F2E A;  2SPC A;  4ADZ A;  4O4L E;  3N9M A;  3TLU A;  4IE5 A;  5TAO A;  3UU8 A;  4OYK A;  2B76 A;  2I59 A;  2VKD A;  2XNU A;  4MBQ A;  2UXC T;  3PEO A;  3OTO T;  3WTM A;  4YTP A;  3V5S A;  2VVS A;  3E08 A;  2V8S V;  3A7M A;  2H89 A;  4DID B;  4ZZB A;  5IWA T;  3FBZ A;  3MZK B;  2QC1 B;  3Q5D A;  4AQY T;  2BS3 A;  4CI2 B;  5HXE A;  4ASK A;  4G2A A;  5IHY A;  4GK5 E;  5HEH A;  1BR1 A;  2VUR A;  4I50 E;  5H6Q B;  2LEH A;  4UF0 B;  4FI5 A;  4QXB B;  1O3X A;  1D0X A;  3PUG A;  4DUZ T;  2KSR A;  2UXX B;  4AKI A;  3RRW A;  5J5F A;  2YU1 A;  3G06 A;  5ABH A;  3WAK A;  4ZR6 A;  3FZM B;  4UV9 B; 
#chains in the Genus database with same CATH homology
 2Y57 A;  3ZKR A;  4QH5 A;  5HEO A;  4QH4 A;  2MAW A;  3PMZ A;  2BR7 A;  3UQ4 A;  2XQ3 A;  3TLW A;  2XZ6 A;  5BW2 A;  4BQT A;  5HEU A;  2M6I A;  4QAA A;  4A97 A;  4IRE A;  2WNJ A;  5HEG A;  5AIN A;  4ILB A;  3JAD A;  4LMK A;  4IL9 A;  4UM1 A;  5L47 A;  5HCJ A;  4Z91 A;  5KZU A;  2XNV A;  2PH9 A;  2WN9 A;  4WV9 A;  3T4M A;  5JME A;  2XZ5 A;  3EHZ A;  4ILA A;  2BG9 C;  3TLU A;  4ZJT A;  4FRR A;  4NPP A;  3UQ7 A;  2BR8 A;  3WTO A;  5AFK A;  1OED E;  3U8J A;  3WIP A;  4TNV A;  3WTL A;  3SH1 A;  5HCM A;  3UU4 A;  3C84 A;  4ZZC A;  4TWF A;  2XQ6 A;  3RQW A;  3UU5 A;  4F8H A;  5CFB A;  5HEJ A;  3UU8 A;  2C9T A;  2X00 A;  4D01 A;  5SYO A;  3SQ6 A;  2BJ0 A;  2XYS A;  2X00 D;  5FJV A;  2XYT A;  4HFH A;  4QH1 A;  5J5H A;  4AFT A;  4A98 A;  4TNW A;  3TLT A;  3RHW A;  2XNU A;  3PEO A;  4LML A;  5BP0 A;  2WNC A;  3RQU A;  2YN6 A;  2LLY A;  2XQ5 A;  4ILC A;  4XK9 A;  4UM3 S;  2YMD A;  3UUB A;  4ZJS A;  3WTJ A;  3WTM A;  1UW6 A;  4B5D A;  4X5T A;  4ZRU A;  3UU6 A;  1UX2 A;  2WNL A;  3IGQ A;  4QAB A;  2BG9 B;  2W8F A;  5LG3 A;  3UU3 A;  4UXU A;  5AFL A;  5AFN A;  4QAC A;  5J5I A;  4LMJ A;  4ZZB A;  3EAM A;  1OED B;  3SIO A;  5LXB A;  3WTI A;  3ZDG A;  2LKH A;  2LM2 A;  2BYP A;  4ZK1 A;  3WTH A;  2BG9 E;  1I9B A;  2WZY A;  4HFE A;  2BG9 A;  2Y54 A;  3P50 A;  2YKS A;  2XQA A;  5AFJ A;  5L4H A;  2ZJU A;  3P4W A;  4NZB A;  4UM3 P;  2BYS A;  4TWH A;  3TLV A;  3RIF A;  4TWD A;  4HFI A;  2QC1 B;  3JAE A;  4EZ1 A;  4DBM A;  3WTN A;  4COF A;  2YOE A;  3RIA A;  2VL0 A;  2BYR A;  4UY2 A;  2BYQ A;  4PIR A;  2LKG A;  4AFH A;  3JAF A;  2XQ4 A;  3GUA A;  4ALX A;  3TLS A;  2PGZ A;  2XQ9 A;  5TVC A;  5AFM B;  2YME A;  3SQ9 A;  3U8N A;  3EI0 A;  5HEH A;  5AFH A;  3WTK A;  2XQ8 A;  1OED A;  2XQ7 A;  2W8G A;  4AFG A;  2XNT A;  3U8K A;  5L4E A;  3RI5 A;  5KE4 A;  2ZJV A;  5IUX A;  4ZK4 A;  2UZ6 A;  1UV6 A;  4HFB A;  2Y7Y A;  4HFD A;  3ZDH A;  4BFQ A;  5CO5 A;  4IL4 A;  5J0Z A;  2Y58 A;  2M6B A;  5J5G A;  3U8L A;  2KSR A;  3LSV A;  3U8M A;  2BYN A;  4XHE A;  1OED C;  4Z90 A;  5J5F A;  5BRX A;  4HFC A;  4HQP A;  3C79 A;  4UM3 A;  4ZR6 A;  5AFM A;  2Y56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...