4QH1A

The glic pentameric ligand-gated ion channel (wild-type) in complex with bromoacetate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus pcc 7421
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh1A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh1A01
2YKSA 2PGZA 4WV9A 4XK9A 4ZJSA 3T4MA 3WTJA 2X00A 2Y57A 4HFCA 4UM3S 4UM1A 4TWDA 3UU5A 1OEDB 3WTIA 2KSRA 5JMEA 2XZ5A 3JAEA 3RIAA 4UM3P 2XQ4A 3GUAA 1OEDE 2MAWA 2XYSA 5L4HA 3EAMA 4ZZBA 2BR7A 2WNJA 4QACA 3TLWA 5BW2A 3WTOA 3SQ6A 2XQ9A 4TNVA 3EHZA 3U8NA 2Y54A 1I9BA 4QH1A 4AFHA 5AFMA 3WTKA 4HQPA 5KE4A 2LM2A 3EI0A 4AFTA 1OEDC 5J5GA 2YMEA 5IUXA 3RIFA 4QAAA 4HFEA 5HEHA 3U8LA 4ILAA 2QC1B 5AFJA 3RHWA 3SH1A 4F8HA 2WNLA 3P4WA 4A97A 5L47A 5LXBA 3P50A 5HEOA 3ZKRA 5J0ZA 2UZ6A 2XYTA 5CO5A 4QABA 3UUBA 2BR8A 2BYNA 4DBMA 2BYRA 3U8JA 4HFHA 4UY2A 5AFMB 3WTHA 3IGQA 2BJ0A 4NPPA 4AFGA 3JADA 4UM3A 4BQTA 3UU8A 4COFA 4X5TA 3UU4A 2BG9E 2YN6A 2WNCA 4B5DA 4EZ1A 5SYOA 5L4EA 5FJVA 3TLVA 2W8FA 5HCMA 2C9TA 4TWFA 2BG9A 2XNUA 3TLTA 3ZDGA 4Z90A 2XQ6A 3JAFA 2BYPA 2VL0A 4IREA 4LMKA 4IL9A 5HEGA 5HEUA 3WTMA 5BRXA 3PEOA 2XQ5A 2PH9A 4HFIA 4ILCA 5LG3A 2X00D 2M6BA 2XNTA 3WIPA 2XQ7A 2LLYA 4QH5A 3TLSA 4LMJA 3UU3A 2Y58A 3UU6A 2YOEA 2BG9B 3RQWA 3LSVA 4ZRUA 4PIRA 3SQ9A 2XNVA 5BP0A 1UW6A 3SIOA 2BYSA 3TLUA 5TVCA 5AFLA 5AFKA 5HCJA 5J5FA 4HFBA 4ZK4A 4LMLA 2XQ3A 5AFHA 2YMDA 2Y56A 3PMZA 2BG9C 2W8GA 3RI5A 4IL4A 1UV6A 3C79A 3WTNA 5CFBA 4XHEA 4ZJTA 2XQAA 3C84A 4NZBA 3U8MA 4ALXA 2LKHA 3U8KA 3UQ4A 3UQ7A 3RQUA 4ZR6A 2Y7YA 5KZUA 2WZYA 5AFNA 2BYQA 4QH4A 1OEDA 2WN9A 2M6IA 5HEJA 2ZJVA 4ZK1A 5J5HA 4UXUA 5AINA 4Z91A 4D01A 4ILBA 4ZZCA 1UX2A 2LKGA 4FRRA 4BFQA 2XZ6A 5J5IA 3ZDHA 4TNWA 2XQ8A 4HFDA 3WTLA 4A98A 2ZJUA 4TWHA
chains in the Genus database with same CATH superfamily
2DHRA 3GA8A 3RX6A 3CX6B 1KEYA 4DR4T 2N9DA 3JAEA 1ZKEA 2XZEA 3P4PA 4H63H 1BR1A 4EEBA 2XAGB 3HI2A 4IE5A 2YEVC 3U3IA 3ZC1A 3KFWX 4A56A 5LXBA 3P50A 5F3JA 2QGSA 5CO5A 2EHOC 4P1NA 3PUQA 3U8JA 4JI4T 3NVOA 2BJ0A 1XMQT 4AQFC 4U31A 3OTOT 3PJAJ 5JVDE 4ISSA 3N9QA 4CN6A 4Z90A 4X66T 1US7B 3JAFA 4B3MT 1BR2A 1SA0E 1ZOYA 4HFIA 2B1EA 2IHR1 5ABHA 2YDRA 2I59A 1QSDA 3ZYMA 4OFZA 3PUVF 5AFLA 3I9WA 2X0LB 2Y8DA 1BR0A 4ZK4A 1WLXA 2OV9A 3FZLB 2V7JA 1UV6A 5DQVA 3ZSTA 1YD8G 3FXDB 5AFUL 3V5SA 2ZLYA 4IDZA 3IBPA 4ILBA 2XPKA 3NRYA 3A7MA 3W15B 2PJQA 4YTMA 3E08A 2HPLA 5L3EB 2NTXA 5GONE 4WBNE 3KINB 3GMIA 3RIUA 4AQYT 5FYMA 2XQ4A 5FKYA 2WNJA 5L3FB 4JEHB 4U72A 4EOZB 4YSZA 3AA1B 2BKNA 4HE8A 1L0VA 3NZQA 5LJMA 3RKOA 3B13A 3P4WA 4E7SA 2IC6A 4IE0A 4C90A 3P8CD 3QUJA 2WM9A 2FJDA 2BYRA 1YQ3A 1Y64B 2ES0A 4A5XA 3IF8B 2XNUA 1IBMT 4QHOA 5LGUB 4ZI2D 2CA5A 3AE3A 2XJ7A 5BRXA 2UXDT 3PEOA 2IDOB 4JI1T 3B5MA 2XQ7A 3AEDA 2Y58A 3RQWA 3K3NA 3PV0F 2VVNA 4DIDB 1G73A 4NXMT 2OA5A 5LYJE 4YSYA 2E9XA 2D5UA 2SPCA 2A2FX 2WZYA 4LFBT 4X64T 1OEDA 5H6RB 2WN9A 5HEJA 3T1YT 1Z0PA 3AEFA 2K24A 4YT0A 3B57A 1N34T 4CXXA 3ONXA 2V7IA 4UIGA 4CQIA 3ZMVB 3C98B 4CI3B 1ZHCA 4IT4A 4DV0T 1UCUA 4MLKA 4ASKA 2YMEA 4I0UA 3LJCA 3PU3A 5CJ5A 4P0AA 2BR8A 2IAKA 5FP3A 4EIWA 5BR8T 4NPPA 4EYYR 2XHEB 5LCYA 4M1PA 4DUZT 2WAUA 4O8SA 4DMWA 3RYCE 2W8FA 2C9TA 2BG9A 2XQYA 4I43B 5HWXA 2X9XA 2CHOA 5M4YA 4O2AE 5HXRA 1E2AA 4IE4A 4DV4T 2XNTA 3UUNA 4CXYA 3UU6A 1HFAA 3LSVA 2XAFB 4B6XA 2NP9A 3EVYA 5ADXL 5HXHA 2VK9A 3ZC0A 2BYSA 1WR6A 2WDRA 4HKAA 5AFKA 5AQMB 4JEUB 3OBVE 5FMNA 1UGOA 2KXPB 3EABA 2MYSA 3ANWB 4V1Av 2N2NA 4NZBA 2BKOA 1D0XA 3UQ7A 5JRCA 2ODUA 4HWHA 2WQYA 2BKPA 2BZBA 1NENA 2XQ8A 3PURA 3T4MA 2X9HA 5LBQB 4GKKT 4PFOA 4HFVA 5E0OA 5L4HA 2WMNA 3AEEA 1QUUA 4GK5E 4TN7B 4HTEA 3ZMTB 4UVBB 4MHCA 5IUXA 3U8LA 4ILAA 3G06A 1O3XA 5L47A 5FXZA 2ACXA 3MXZA 3GN5B 5DJQC 1W09A 3CQGB 3BQIA 2V6YA 3UU8A 2BG9E 3HKEE 3KDSE 2A3DA 5FY0A 4PJMA 3PUAA 1D0ZA 2PH9A 4ILCA 4PFPA 3TLSA 4ISTA 4DR5T 2H7OA 2K48A 3N9OA 2W4XA 3IEEA 4UV9B 4X1YE 1UX5A 2I6HA 4WYVA 3ZSSA 2CXLA 3Q9DA 4B3TT 2BBHA 2P9BA 1S35A 3ZJ2A 5L3DB 1HS7A 2YU2A 3O4XE 3AE5A 3NRXA 2E5VA 5JDFA 1ZEEA 5EK2A 4PK4A 5AFNA 1FJGT 4DR1T 1HNWT 4JI6T 2W00A 2WWUA 2LKGA 5J2TE 4U2ZA 5FVLA 4XK9A 4HFCA 5JR9A 5AQJB 2HPJA 3ZYKA 2VASA 2WMOA 3RRWA 2BDEA 2JQ9A 3U8NA 4XBFB 3ZMZB 1GQEA 2LEHA 2XAHB 2LHNA 3Q5WA 2Q9QA 3RIFA 3QC9A 1MMDA 3C4ZA 2H89A 4U3CA 3SH1A 2RPAA 2IMLA 1MIWA 5C2TA 4QABA 3HKCE 1KFYA 5AFMB 3N9LA 2UXXB 4UV8B 2E8IA 2X66A 4TX5A 3AAAB 3J9X1 1J5WA 5A1LA 2JRKA 4TWFA 1NEKA 5LGTB 4DR3T 3WTMA 3BQKA 2WDQA 5AQGB 3Q5EA 2X00D 3FBLA 1N33T 2LSIA 2NW9A 2KMFA 2V7LA 2YINA 3AE8A 3K1SA 3LK2B 1S94A 3ZEFB 3BK9A 3N2KE 2Z6EA 1VCTA 2V8SV 1M7KA 4C91A 4QH4A 2L8KA 2X0HA 2E9XC 4ERRA 4D01A 3VR8A 3SOLA 4A98A 2XASB 4WV9A 4YHJA 4BAYB 2YDSA 1JNZA 4YHHT 3MJXA 1KNRA 5HXCA 2BR7A 3EAMA 3AE9A 4QX7B 3SQ6A 4O2BE 1XZYA 3WAJA 2Y54A 3AXJB 1I9BA 3WTKA 4GYRA 3JC6C 1WYCA 2VKDA 5AFJA 4OYJA 3RHWA 2QVAA 3O9XA 3AAIA 5IHYA 3U78A 2BYNA 2BS3A 3IHRA 1SUMB 4ZHQE 3JC6D 1Y01A 4WBOA 5LGNB 2ZM2A 2PG8A 3RPUA 2BS2A 4KI0F 3CMLA 1HF8A 4DV3T 5LG3A 2M6BA 4JBWF 4JYAT 4QKNA 5FNVE 2YDQA 4ZRUA 3PUWF 2XNVA 5BP0A 3UT5E 3TLUA 1FEWA 3MZKB 1VOMA 2VKHA 4NUUA 4ZI3C 5AFHA 3AE1A 1W0BA 2EHOD 4IL4A 4KUMB 5AQKB 3C79A 3SRZA 2HN1A 2UXBT 2PFVA 4LFAT 4H9NC 2XQAA 3R84B 4L5GA 2NR4A 5JDQA 2Y7YA 2CM0A 4UXUA 2YU1A 4FI5A 4ZZCA 3Q5DA 4EYUA 2UUCT 4ZI3D 5LB7B 1YKEB 4H63V 5JH7E 2WCAA 1XDOA 3UTKA 2ZMAA 2KSRA 4IIJE 4ILUA 5FL0A 4HWFA 4YJ3E 2J1DG 5L3BB 4AFHA 2LM2A 3EI0A 5FVKA 3RLFF 5FL1A 4UF0A 4UR9A 4DVDA 2KLQA 1UUSA 4AKLA 2ACZA 3O1JA 4LF9T 3C64A 4OYKA 3ZT6A 2LRLA 5EZYE 1Z8UA 2EHOB 3ABVA 3SWHA 3N9NA 5H6QB 4PW8A 2RA1A 2X68A 4AKRB 5LHIB 4IL9A 3FHNA 4OX9T 5KDMC 3SFDA 2IW5B 2XSBA 3CVRA 3EDUA 1B7TA 1KNPA 3FXEB 1AJ3A 3L39A 1I94T 4JI8T 1HX8A 2W61A 4KP3C 2XSAA 4DNDA 4NXNT 5BMVE 4HEAA 3PMZA 4IDOA 5JDGA 2PBIA 4XHEA 3VHLA 4ZJTA 2ZM6T 3KV4A 3AEAA 4JUYA 5FXWA 2HH7A 4N78D 4OHFA 4AISA 1HR0T 5AQQB 5HAXA 3E0ZA 3PDYA 1LVKA 3AAEB 4ZXLA 4UVCB 2UXCT 4B3RT 3ZYLA 4UM1A 1IZNB 3KV5A 4IDPA 2XZ5A 2KINB 3AA7B 5JDLA 4Z8XA 3DJBA 5L3GB 3X1DA 3A8YC 3VKHA 1MNEA 2I0MA 5KE4A 3Q5XA 4QAAA 3AE2A 1E1HB 5HXSA 3NZPA 2UUAT 3T8OA 4X62T 1OXZA 3MK7C 2DWKA 1IAPA 1HG5A 5DABA 3D0TA 5LP6E 4AFGA 3JADA 2YN6A 4JI5T 5SYOA 3QK6A 4UXNB 3SFEA 1T8BA 2V5CA 4LMKA 3ZT5A 4X1IE 3H3MA 1CHUA 4YFSA 2OLTA 4LMJA 3UU3A 1MIYA 1N36T 3ETUA 1N32T 2C5JA 5ABFB 3OKQA 2W2UA 2UUBT 5J5FA 4PAGA 2VURA 2NOXA 1KF6A 4LF6T 2MPKA 3WTNA 3MKDA 4KMCA 4P09A 4AKGA 5L2LA 4BJNA 3FZFB 4H9QC 2L3LA 3P4RA 4HWIB 4Z91A 4DR7T 4FRRA 5ABEA 2H88A 2LSKA 2VQET 1XWMA 4AQGA 4JI0T 3PUYF 3ONLC 2PGZA 3Q2MA 4IGUA 4ZS3A 3CK6A 1FMVA 3AA6B 3RYIE 1W0AA 1OEDE 2H7VC 4QACA 2KNDA 2WSSV 3R6NA 1XMOT 2YK0A 2XQ9A 5JDHA 3H37A 4YJ2E 2LSYA 1NAFA 4HFEA 2K5BB 1D1BA 5CGMA 1YKHB 4B3ST 2AXDS 4A97A 3MA9A 5KMGP 4DV6T 3V5UA 2JQHA 2WP9A 3HKBE 1HNXT 4P0BA 1R8IA 5HXEA 2K3WA 3KVAA 2JQKA 5ETWA 2KZ7B 1ZP0A 4EGWA 4PNIA 3PJAA 2WZHA 2WU5A 5AQLB 2XM1A 4DO0A 3TKLB 5HEUA 3LK3B 4TZ4C 3I1AA 4JV5T 4DV5T 2V7KA 2BVMA 3LBXB 1MMAA 3RH3A 2LHRA 2VVSA 3GWHA 3RKGA 3LFMA 3FZKB 4ADZA 3OPCA 5AQOB 3AVSA 5C3JA 1FIOA 3QNUA 4ALXA 4PK6A 4QXBB 2NW8A 2AE9A 3ZMSB 5J5HA 1LKXA 4IE6A 4DR6T 4IDQA 5J2UE 1I6ZA 4L0RA 1EZ3A 1IJ6A 2Y57A 4U33A 4UM3P 1WYBA 2V26A 3UFEA 5KX5E 3VKGA 4H9SE 4HQPA 5JDMA 2WY2A 4AFTA 2K9AA 4X1KE 4DBRA 1J5ET 4EEDA 3AEGA 2CHNA 3N9PA 1ZV4X 4UY2A 2XM2A 2C5IT 4HWCA 5KXJA 2KT9A 2CCQA 2VKOA 3RIUC 3TLTA 2XQ6A 5LA6E 4GYSA 4EZ4A 2VL0A 2XTLA 3AEBA 4HWDA 1X9BA 3AA0B 4PJNA 1WRDA 4X65T 4ZI7E 3ANWA 2CPTA 3DTOA 4QX8B 3VU7H 4KHPT 4H9PC 3ZPOA 4HFBA 3AB3B 3CIRA 4H9OC 4U74A 2IC9A 2Y56A 4OK0A 1T98A 2Y48B 4AIUA 2JIWA 3UQ4A 3RQUA 4UELA 4HN9A 2D0UA 2DLRA 2LJLA 3O1IA 5LHHB 3UFGA 2FJAA 4K0UA 1MIVA 2MAWA 4DR2T 2X67A 4KX6A 3WTOA 2DCFA 3GN5A 4O4LE 3VRAA 1OEDC 2KWIB 2W67A 4EZHA 5LMNT 2QC1B 4CI1B 3ZKRA 3MACA 4X20E 1WFDA 2M67A 2XAJB 4DBMA 3ZCJA 2W63A 2V7MA 2LSGA 4BQTA 4COFA 2E9XD 2VL8A 4X5TA 3NBXX 4ZOLE 4B5DA 5F5WA 2PTFA 4YY3T 1UK5A 4MBQA 1UX4A 2VQFT 1X79A 3VRBA 2ZM0A 1W9RA 2LOSA 4IREA 4PJLA 3K3QC 2ZM8A 1VCSA 5AQPB 4JI2T 2E5LT 2D2SA 3SIOA 2R6GF 4DUYT 3ZCIA 3CWZB 1U4QA 4LMLA 3ZLIA 2YMDA 2V6XA 2C5KT 2BG9C 2CMRA 3UULA 2X51A 5EK4A 3O1HA 2CWYA 2VWAA 3VR9A 5LOVE 5HWYA 4BA9A 3FBZA 3I0OA 1KNZA 2H3RA 5CB4E 2FBWA 1MMGA 2V1DB 2W0GA 3WTLA 2GK9A 2LRKA 2WZIA 4ZJSA 1JNRA 2E9XB 3RC8A 4UM3S 4TWDA 3UU5A 1OEDB 4IHJE 4G63A 3EHZA 5AFMA 2LM9A 5LHGB 2JMHA 4YTPA 2WS3A 4TUYE 2NW7A 5JQGE 3E22E 2WNLA 2QRXA 5J0ZA 2UZ6A 3K8PC 3UUBA 1VRBA 3OYZA 2E2AA 4AXPA 2HHHT 4IDNA 3C50A 3TLVA 1CUNA 5L3CB 4TV9E 1SE7A 3PTRB 4YXDA 2J47A 3LK42 2JMKA 4LF5T 3QB5A 1HG2A 2BG9B 3BQLA 3ONJA 4PIRA 2MOZA 1M62A 2W62A 5AQNB 2D0TA 1BR4A 2CXFA 5TVCA 3ZJ1A 4DV1T 2LT3A 2XQ3A 2W8GA 5DQWA 1D0YA 3CQCB 1WR0A 3F57A 1D1AA 1XNRT 2LOPA 5AQTB 2ZJVA 1HTJF 2CXDA 4PJJA 4QXHB 4BFQA 3PUXF 4HFDA 5IWAT 3AXJA 4TWHA 4ZI2C 2X00A 3J7Yq 5JRCB 2BS4A 1LVFA 2XUEA 3WTIA 4H9RC 2CEAA 3P7IA 4ZZBA 5AQUB 3TLWA 1U5PA 2UU9T 3AE7A 3F31A 2CLYC 4DBQA 2X0YA 2DL1A 2A72A 1LRZA 4G2AA 2L9QA 4CZZB 5JR9C 4EXTA 2WWVA 2DI4A 3QOFA 4JLEA 2JQQA 2WNCA 4AKHA 3FZHB 4EZ1A 4HGAA 3EDVA 3PUZF 5HEGA 2V6YB 4AKIA 2Q9QC 4YSXA 5JDNA 2X9YA 2CBJA 1HX1B 4TV8E 3OJAA 2IIUA 4U7IA 4NUVA 3S4UA 2F4VT 1UW6A 3M65A 2FUPA 1G8XA 3RGLA 3ZN1B 5HCJA 2V5DA 2Q9QD 4ZS2A 4O4HE 4DV7T 2IUBA 3PU8A 3C4XA 2KWHA 3AECA 1T7SA 2JPFA 3U8MA 2LKHA 3L3PA 3U8KA 5FXXA 4ZR6A 5KZUA 2LSJA 2BYQA 3KV6A 2C0SA 3T1HT 2XZ6A 2ODVA 5JREA 1HNZT 2B76A 3CX8B 2WU2A 3PUSA 4GIWA 2J4GA 5JMEA 5AQRB 1YW0A 4YTNA 3RIAA 1OWAA 2CLYB 5FY7A 3L09A 3LDQB 3I9YA 1WCRA 2DNXA 4QH1A 2N1GA 4CXWA 3OVUA 3N2OA 4DMVA 5JR9B 5HEHA 2QYWA 2EHOA 3CQXC 4Q25A 4AQFA 5CA0E 3IGQA 5AQIB 2Q9QB 5L4EA 3ZDGA 5AQVB 3HL6A 4BJMA 1IBKT 4J2CA 2WBLA 3ETVA 4E7ZA 2XQ5A 1XNQT 3WI3A 3WIPA 4I50E 3PUGA 2WB5A 4WZXA 5LG4A 2JJ9A 2A9UA 5AQFB 4QXCB 2BVLA 3RI5A 3L8RA 5CFBA 4MFRA 3WAKA 3AE4A 3I0QA 3RYHE 2LE8A 1XDPA 3RRCA 3KBTA 4LF4T 4I4TE 4UVAB 5FXVA 3N9MA 2MTQA 2YKSA 3WTJA 2VKJA 3CPZA 4JI7T 2CBIA 4U2YA 3FB2A 3F2EA 5IYZE 5BW2A 3DP7A 4ZEYA 3FZMB 1YQ4A 3M3ZB 3CX7B 3ZT7A 4YLHA 4UEMA 1DU2A 5HEOA 3IA3A 2W66A 5ABGA 4GK0E 4IE7A 2CRBA 4K0KT 3WTHA 4CN4A 2WDVA 5EK3A 3HA4A 3RC3A 4O4JE 3H3AA 3NKZA 3ZN0B 3P4QA 3SS1A 3N5LA 4LF7T 3UUXB 2FJBA 3KBUA 5ABFA 2BYPA 4ANJA 1HCIA 3QB5K 3KVBA 5HYAA 3A5XA 4LF8T 2Y6XA 2LLYA 4QH5A 4AI6A 2X9WA 5J1GA 2YOEA 3LG7A 3NWIA 1SHZC 1MNDA 3ZMUB 2QA7A 3P4SA 5TAOA 2NTYA 4F6RC 1YXRA 5AQSB 5AQHB 3HR0A 4DV2T 4ZK1A 2VB6A 5AINA 3N2GE 2FJEA 5J5IA 3ZDHA 4TNWA 2J62A 4EB6E 4CN1A 4PK5A 1E7PA 3AE6A 3HKDE 3RF1A 5LXTE 1NWMX 3C51A 3GUAA 4XAXB 2MBGA 2XYSA 4QWNB 4CI2B 4TNVA 4JI3T 3K3OA 3OYXA 4GOUA 5J5GA 2XY8B 2DWGA 2CWOA 1H7CA 4F8HA 4KHZF 4FJOA 5LJNA 2CE7A 2HN2A 4WW0A 2XYTA 3CKDA 5F8PA 4HFHA 1T72A 3JCFA 4UM3A 1QLBA 2NWBA 3UUMA 3KV9A 4NIQA 3UU4A 4MALA 5JTGA 1MMNA 4WNKA 4UF0B 5FJVA 5HCMA 3LBXA 4U7YA 4EV6A 4LFCT 5LMUT 5CA1E 1IJ5A 1KK7A 2G0UA 5C8YE 3RYFE 1IBLT 4KBMB 3SQ9A 5LBMA 3ESLA 2XAQB 2UXNB 3AVRA 3C4WA 1UURA 1V9DA 5LNKA 3PE0A 1J1JA 2RP4A 4O4IE 4EAHA 3EUHA 2BBJA 3C84A 4I55E 4GKJT 5FY1A 2M6IA 4L9IA 2D9DA 1UX2A 4XZCA 1FMWA 2ZJUA 1D1CA
chains in the Genus database with same CATH topology
2YKSA 2PGZA 4WV9A 4XK9A 4ZJSA 3T4MA 3WTJA 2X00A 2Y57A 4HFCA 4UM3S 4UM1A 4TWDA 3UU5A 1OEDB 3WTIA 2KSRA 5JMEA 2XZ5A 3JAEA 3RIAA 4UM3P 2XQ4A 3GUAA 1OEDE 2MAWA 2XYSA 5L4HA 3EAMA 4ZZBA 2BR7A 2WNJA 4QACA 3TLWA 5BW2A 3WTOA 3SQ6A 2XQ9A 4TNVA 3EHZA 3U8NA 2Y54A 1I9BA 4QH1A 4AFHA 5AFMA 3WTKA 4HQPA 5KE4A 2LM2A 3EI0A 4AFTA 1OEDC 5J5GA 2YMEA 5IUXA 3RIFA 4QAAA 4HFEA 5HEHA 3U8LA 4ILAA 2QC1B 5AFJA 3RHWA 3SH1A 4F8HA 2WNLA 3P4WA 4A97A 5L47A 5LXBA 3P50A 5HEOA 3ZKRA 5J0ZA 2UZ6A 2XYTA 5CO5A 4QABA 3UUBA 2BR8A 2BYNA 4DBMA 2BYRA 3U8JA 4HFHA 4UY2A 5AFMB 3WTHA 3IGQA 2BJ0A 4NPPA 4AFGA 3JADA 4UM3A 4BQTA 3UU8A 4COFA 4X5TA 3UU4A 2BG9E 2YN6A 2WNCA 4B5DA 4EZ1A 5SYOA 5L4EA 5FJVA 3TLVA 2W8FA 5HCMA 2C9TA 4TWFA 2BG9A 2XNUA 3TLTA 3ZDGA 4Z90A 2XQ6A 3JAFA 2BYPA 2VL0A 4IREA 4LMKA 4IL9A 5HEGA 5HEUA 3WTMA 5BRXA 3PEOA 2XQ5A 2PH9A 4HFIA 4ILCA 5LG3A 2X00D 2M6BA 2XNTA 3WIPA 2XQ7A 2LLYA 4QH5A 3TLSA 4LMJA 3UU3A 2Y58A 3UU6A 2YOEA 2BG9B 3RQWA 3LSVA 4ZRUA 4PIRA 3SQ9A 2XNVA 5BP0A 1UW6A 3SIOA 2BYSA 3TLUA 5TVCA 5AFLA 5AFKA 5HCJA 5J5FA 4HFBA 4ZK4A 4LMLA 2XQ3A 5AFHA 2YMDA 2Y56A 3PMZA 2BG9C 2W8GA 3RI5A 4IL4A 1UV6A 3C79A 3WTNA 5CFBA 4XHEA 4ZJTA 2XQAA 3C84A 4NZBA 3U8MA 4ALXA 2LKHA 3U8KA 3UQ4A 3UQ7A 3RQUA 4ZR6A 2Y7YA 5KZUA 2WZYA 5AFNA 2BYQA 4QH4A 1OEDA 2WN9A 2M6IA 5HEJA 2ZJVA 4ZK1A 5J5HA 4UXUA 5AINA 4Z91A 4D01A 4ILBA 4ZZCA 1UX2A 2LKGA 4FRRA 4BFQA 2XZ6A 5J5IA 3ZDHA 4TNWA 2XQ8A 4HFDA 3WTLA 4A98A 2ZJUA 4TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKS A;  2PGZ A;  4WV9 A;  4XK9 A;  4ZJS A;  3T4M A;  3WTJ A;  2X00 A;  2Y57 A;  4HFC A;  4UM3 S;  4UM1 A;  4TWD A;  3UU5 A;  1OED B;  3WTI A;  2KSR A;  5JME A;  2XZ5 A;  3JAE A;  3RIA A;  4UM3 P;  2XQ4 A;  3GUA A;  1OED E;  2MAW A;  2XYS A;  5L4H A;  3EAM A;  4ZZB A;  2BR7 A;  2WNJ A;  4QAC A;  3TLW A;  5BW2 A;  3WTO A;  3SQ6 A;  2XQ9 A;  4TNV A;  3EHZ A;  3U8N A;  2Y54 A;  1I9B A;  4QH1 A;  4AFH A;  5AFM A;  3WTK A;  4HQP A;  5KE4 A;  2LM2 A;  3EI0 A;  4AFT A;  1OED C;  5J5G A;  2YME A;  5IUX A;  3RIF A;  4QAA A;  4HFE A;  5HEH A;  3U8L A;  4ILA A;  2QC1 B;  5AFJ A;  3RHW A;  3SH1 A;  4F8H A;  2WNL A;  3P4W A;  4A97 A;  5L47 A;  5LXB A;  3P50 A;  5HEO A;  3ZKR A;  5J0Z A;  2UZ6 A;  2XYT A;  5CO5 A;  4QAB A;  3UUB A;  2BR8 A;  2BYN A;  4DBM A;  2BYR A;  3U8J A;  4HFH A;  4UY2 A;  5AFM B;  3WTH A;  3IGQ A;  2BJ0 A;  4NPP A;  4AFG A;  3JAD A;  4UM3 A;  4BQT A;  3UU8 A;  4COF A;  4X5T A;  3UU4 A;  2BG9 E;  2YN6 A;  2WNC A;  4B5D A;  4EZ1 A;  5SYO A;  5L4E A;  5FJV A;  3TLV A;  2W8F A;  5HCM A;  2C9T A;  4TWF A;  2BG9 A;  2XNU A;  3TLT A;  3ZDG A;  4Z90 A;  2XQ6 A;  3JAF A;  2BYP A;  2VL0 A;  4IRE A;  4LMK A;  4IL9 A;  5HEG A;  5HEU A;  3WTM A;  5BRX A;  3PEO A;  2XQ5 A;  2PH9 A;  4HFI A;  4ILC A;  5LG3 A;  2X00 D;  2M6B A;  2XNT A;  3WIP A;  2XQ7 A;  2LLY A;  4QH5 A;  3TLS A;  4LMJ A;  3UU3 A;  2Y58 A;  3UU6 A;  2YOE A;  2BG9 B;  3RQW A;  3LSV A;  4ZRU A;  4PIR A;  3SQ9 A;  2XNV A;  5BP0 A;  1UW6 A;  3SIO A;  2BYS A;  3TLU A;  5TVC A;  5AFL A;  5AFK A;  5HCJ A;  5J5F A;  4HFB A;  4ZK4 A;  4LML A;  2XQ3 A;  5AFH A;  2YMD A;  2Y56 A;  3PMZ A;  2BG9 C;  2W8G A;  3RI5 A;  4IL4 A;  1UV6 A;  3C79 A;  3WTN A;  5CFB A;  4XHE A;  4ZJT A;  2XQA A;  3C84 A;  4NZB A;  3U8M A;  4ALX A;  2LKH A;  3U8K A;  3UQ4 A;  3UQ7 A;  3RQU A;  4ZR6 A;  2Y7Y A;  5KZU A;  2WZY A;  5AFN A;  2BYQ A;  4QH4 A;  1OED A;  2WN9 A;  2M6I A;  5HEJ A;  2ZJV A;  4ZK1 A;  5J5H A;  4UXU A;  5AIN A;  4Z91 A;  4D01 A;  4ILB A;  4ZZC A;  1UX2 A;  2LKG A;  4FRR A;  4BFQ A;  2XZ6 A;  5J5I A;  3ZDH A;  4TNW A;  2XQ8 A;  4HFD A;  3WTL A;  4A98 A;  2ZJU A;  4TWH A; 
#chains in the Genus database with same CATH topology
 2DHR A;  3GA8 A;  3RX6 A;  3CX6 B;  1KEY A;  4DR4 T;  2N9D A;  3JAE A;  1ZKE A;  2XZE A;  3P4P A;  4H63 H;  1BR1 A;  4EEB A;  2XAG B;  3HI2 A;  4IE5 A;  2YEV C;  3U3I A;  3ZC1 A;  3KFW X;  4A56 A;  5LXB A;  3P50 A;  5F3J A;  2QGS A;  5CO5 A;  2EHO C;  4P1N A;  3PUQ A;  3U8J A;  4JI4 T;  3NVO A;  2BJ0 A;  1XMQ T;  4AQF C;  4U31 A;  3OTO T;  3PJA J;  5JVD E;  4ISS A;  3N9Q A;  4CN6 A;  4Z90 A;  4X66 T;  1US7 B;  3JAF A;  4B3M T;  1BR2 A;  1SA0 E;  1ZOY A;  4HFI A;  2B1E A;  2IHR 1;  5ABH A;  2YDR A;  2I59 A;  1QSD A;  3ZYM A;  4OFZ A;  3PUV F;  5AFL A;  3I9W A;  2X0L B;  2Y8D A;  1BR0 A;  4ZK4 A;  1WLX A;  2OV9 A;  3FZL B;  2V7J A;  1UV6 A;  5DQV A;  3ZST A;  1YD8 G;  3FXD B;  5AFU L;  3V5S A;  2ZLY A;  4IDZ A;  3IBP A;  4ILB A;  2XPK A;  3NRY A;  3A7M A;  3W15 B;  2PJQ A;  4YTM A;  3E08 A;  2HPL A;  5L3E B;  2NTX A;  5GON E;  4WBN E;  3KIN B;  3GMI A;  3RIU A;  4AQY T;  5FYM A;  2XQ4 A;  5FKY A;  2WNJ A;  5L3F B;  4JEH B;  4U72 A;  4EOZ B;  4YSZ A;  3AA1 B;  2BKN A;  4HE8 A;  1L0V A;  3NZQ A;  5LJM A;  3RKO A;  3B13 A;  3P4W A;  4E7S A;  2IC6 A;  4IE0 A;  4C90 A;  3P8C D;  3QUJ A;  2WM9 A;  2FJD A;  2BYR A;  1YQ3 A;  1Y64 B;  2ES0 A;  4A5X A;  3IF8 B;  2XNU A;  1IBM T;  4QHO A;  5LGU B;  4ZI2 D;  2CA5 A;  3AE3 A;  2XJ7 A;  5BRX A;  2UXD T;  3PEO A;  2IDO B;  4JI1 T;  3B5M A;  2XQ7 A;  3AED A;  2Y58 A;  3RQW A;  3K3N A;  3PV0 F;  2VVN A;  4DID B;  1G73 A;  4NXM T;  2OA5 A;  5LYJ E;  4YSY A;  2E9X A;  2D5U A;  2SPC A;  2A2F X;  2WZY A;  4LFB T;  4X64 T;  1OED A;  5H6R B;  2WN9 A;  5HEJ A;  3T1Y T;  1Z0P A;  3AEF A;  2K24 A;  4YT0 A;  3B57 A;  1N34 T;  4CXX A;  3ONX A;  2V7I A;  4UIG A;  4CQI A;  3ZMV B;  3C98 B;  4CI3 B;  1ZHC A;  4IT4 A;  4DV0 T;  1UCU A;  4MLK A;  4ASK A;  2YME A;  4I0U A;  3LJC A;  3PU3 A;  5CJ5 A;  4P0A A;  2BR8 A;  2IAK A;  5FP3 A;  4EIW A;  5BR8 T;  4NPP A;  4EYY R;  2XHE B;  5LCY A;  4M1P A;  4DUZ T;  2WAU A;  4O8S A;  4DMW A;  3RYC E;  2W8F A;  2C9T A;  2BG9 A;  2XQY A;  4I43 B;  5HWX A;  2X9X A;  2CHO A;  5M4Y A;  4O2A E;  5HXR A;  1E2A A;  4IE4 A;  4DV4 T;  2XNT A;  3UUN A;  4CXY A;  3UU6 A;  1HFA A;  3LSV A;  2XAF B;  4B6X A;  2NP9 A;  3EVY A;  5ADX L;  5HXH A;  2VK9 A;  3ZC0 A;  2BYS A;  1WR6 A;  2WDR A;  4HKA A;  5AFK A;  5AQM B;  4JEU B;  3OBV E;  5FMN A;  1UGO A;  2KXP B;  3EAB A;  2MYS A;  3ANW B;  4V1A v;  2N2N A;  4NZB A;  2BKO A;  1D0X A;  3UQ7 A;  5JRC A;  2ODU A;  4HWH A;  2WQY A;  2BKP A;  2BZB A;  1NEN A;  2XQ8 A;  3PUR A;  3T4M A;  2X9H A;  5LBQ B;  4GKK T;  4PFO A;  4HFV A;  5E0O A;  5L4H A;  2WMN A;  3AEE A;  1QUU A;  4GK5 E;  4TN7 B;  4HTE A;  3ZMT B;  4UVB B;  4MHC A;  5IUX A;  3U8L A;  4ILA A;  3G06 A;  1O3X A;  5L47 A;  5FXZ A;  2ACX A;  3MXZ A;  3GN5 B;  5DJQ C;  1W09 A;  3CQG B;  3BQI A;  2V6Y A;  3UU8 A;  2BG9 E;  3HKE E;  3KDS E;  2A3D A;  5FY0 A;  4PJM A;  3PUA A;  1D0Z A;  2PH9 A;  4ILC A;  4PFP A;  3TLS A;  4IST A;  4DR5 T;  2H7O A;  2K48 A;  3N9O A;  2W4X A;  3IEE A;  4UV9 B;  4X1Y E;  1UX5 A;  2I6H A;  4WYV A;  3ZSS A;  2CXL A;  3Q9D A;  4B3T T;  2BBH A;  2P9B A;  1S35 A;  3ZJ2 A;  5L3D B;  1HS7 A;  2YU2 A;  3O4X E;  3AE5 A;  3NRX A;  2E5V A;  5JDF A;  1ZEE A;  5EK2 A;  4PK4 A;  5AFN A;  1FJG T;  4DR1 T;  1HNW T;  4JI6 T;  2W00 A;  2WWU A;  2LKG A;  5J2T E;  4U2Z A;  5FVL A;  4XK9 A;  4HFC A;  5JR9 A;  5AQJ B;  2HPJ A;  3ZYK A;  2VAS A;  2WMO A;  3RRW A;  2BDE A;  2JQ9 A;  3U8N A;  4XBF B;  3ZMZ B;  1GQE A;  2LEH A;  2XAH B;  2LHN A;  3Q5W A;  2Q9Q A;  3RIF A;  3QC9 A;  1MMD A;  3C4Z A;  2H89 A;  4U3C A;  3SH1 A;  2RPA A;  2IML A;  1MIW A;  5C2T A;  4QAB A;  3HKC E;  1KFY A;  5AFM B;  3N9L A;  2UXX B;  4UV8 B;  2E8I A;  2X66 A;  4TX5 A;  3AAA B;  3J9X 1;  1J5W A;  5A1L A;  2JRK A;  4TWF A;  1NEK A;  5LGT B;  4DR3 T;  3WTM A;  3BQK A;  2WDQ A;  5AQG B;  3Q5E A;  2X00 D;  3FBL A;  1N33 T;  2LSI A;  2NW9 A;  2KMF A;  2V7L A;  2YIN A;  3AE8 A;  3K1S A;  3LK2 B;  1S94 A;  3ZEF B;  3BK9 A;  3N2K E;  2Z6E A;  1VCT A;  2V8S V;  1M7K A;  4C91 A;  4QH4 A;  2L8K A;  2X0H A;  2E9X C;  4ERR A;  4D01 A;  3VR8 A;  3SOL A;  4A98 A;  2XAS B;  4WV9 A;  4YHJ A;  4BAY B;  2YDS A;  1JNZ A;  4YHH T;  3MJX A;  1KNR A;  5HXC A;  2BR7 A;  3EAM A;  3AE9 A;  4QX7 B;  3SQ6 A;  4O2B E;  1XZY A;  3WAJ A;  2Y54 A;  3AXJ B;  1I9B A;  3WTK A;  4GYR A;  3JC6 C;  1WYC A;  2VKD A;  5AFJ A;  4OYJ A;  3RHW A;  2QVA A;  3O9X A;  3AAI A;  5IHY A;  3U78 A;  2BYN A;  2BS3 A;  3IHR A;  1SUM B;  4ZHQ E;  3JC6 D;  1Y01 A;  4WBO A;  5LGN B;  2ZM2 A;  2PG8 A;  3RPU A;  2BS2 A;  4KI0 F;  3CML A;  1HF8 A;  4DV3 T;  5LG3 A;  2M6B A;  4JBW F;  4JYA T;  4QKN A;  5FNV E;  2YDQ A;  4ZRU A;  3PUW F;  2XNV A;  5BP0 A;  3UT5 E;  3TLU A;  1FEW A;  3MZK B;  1VOM A;  2VKH A;  4NUU A;  4ZI3 C;  5AFH A;  3AE1 A;  1W0B A;  2EHO D;  4IL4 A;  4KUM B;  5AQK B;  3C79 A;  3SRZ A;  2HN1 A;  2UXB T;  2PFV A;  4LFA T;  4H9N C;  2XQA A;  3R84 B;  4L5G A;  2NR4 A;  5JDQ A;  2Y7Y A;  2CM0 A;  4UXU A;  2YU1 A;  4FI5 A;  4ZZC A;  3Q5D A;  4EYU A;  2UUC T;  4ZI3 D;  5LB7 B;  1YKE B;  4H63 V;  5JH7 E;  2WCA A;  1XDO A;  3UTK A;  2ZMA A;  2KSR A;  4IIJ E;  4ILU A;  5FL0 A;  4HWF A;  4YJ3 E;  2J1D G;  5L3B B;  4AFH A;  2LM2 A;  3EI0 A;  5FVK A;  3RLF F;  5FL1 A;  4UF0 A;  4UR9 A;  4DVD A;  2KLQ A;  1UUS A;  4AKL A;  2ACZ A;  3O1J A;  4LF9 T;  3C64 A;  4OYK A;  3ZT6 A;  2LRL A;  5EZY E;  1Z8U A;  2EHO B;  3ABV A;  3SWH A;  3N9N A;  5H6Q B;  4PW8 A;  2RA1 A;  2X68 A;  4AKR B;  5LHI B;  4IL9 A;  3FHN A;  4OX9 T;  5KDM C;  3SFD A;  2IW5 B;  2XSB A;  3CVR A;  3EDU A;  1B7T A;  1KNP A;  3FXE B;  1AJ3 A;  3L39 A;  1I94 T;  4JI8 T;  1HX8 A;  2W61 A;  4KP3 C;  2XSA A;  4DND A;  4NXN T;  5BMV E;  4HEA A;  3PMZ A;  4IDO A;  5JDG A;  2PBI A;  4XHE A;  3VHL A;  4ZJT A;  2ZM6 T;  3KV4 A;  3AEA A;  4JUY A;  5FXW A;  2HH7 A;  4N78 D;  4OHF A;  4AIS A;  1HR0 T;  5AQQ B;  5HAX A;  3E0Z A;  3PDY A;  1LVK A;  3AAE B;  4ZXL A;  4UVC B;  2UXC T;  4B3R T;  3ZYL A;  4UM1 A;  1IZN B;  3KV5 A;  4IDP A;  2XZ5 A;  2KIN B;  3AA7 B;  5JDL A;  4Z8X A;  3DJB A;  5L3G B;  3X1D A;  3A8Y C;  3VKH A;  1MNE A;  2I0M A;  5KE4 A;  3Q5X A;  4QAA A;  3AE2 A;  1E1H B;  5HXS A;  3NZP A;  2UUA T;  3T8O A;  4X62 T;  1OXZ A;  3MK7 C;  2DWK A;  1IAP A;  1HG5 A;  5DAB A;  3D0T A;  5LP6 E;  4AFG A;  3JAD A;  2YN6 A;  4JI5 T;  5SYO A;  3QK6 A;  4UXN B;  3SFE A;  1T8B A;  2V5C A;  4LMK A;  3ZT5 A;  4X1I E;  3H3M A;  1CHU A;  4YFS A;  2OLT A;  4LMJ A;  3UU3 A;  1MIY A;  1N36 T;  3ETU A;  1N32 T;  2C5J A;  5ABF B;  3OKQ A;  2W2U A;  2UUB T;  5J5F A;  4PAG A;  2VUR A;  2NOX A;  1KF6 A;  4LF6 T;  2MPK A;  3WTN A;  3MKD A;  4KMC A;  4P09 A;  4AKG A;  5L2L A;  4BJN A;  3FZF B;  4H9Q C;  2L3L A;  3P4R A;  4HWI B;  4Z91 A;  4DR7 T;  4FRR A;  5ABE A;  2H88 A;  2LSK A;  2VQE T;  1XWM A;  4AQG A;  4JI0 T;  3PUY F;  3ONL C;  2PGZ A;  3Q2M A;  4IGU A;  4ZS3 A;  3CK6 A;  1FMV A;  3AA6 B;  3RYI E;  1W0A A;  1OED E;  2H7V C;  4QAC A;  2KND A;  2WSS V;  3R6N A;  1XMO T;  2YK0 A;  2XQ9 A;  5JDH A;  3H37 A;  4YJ2 E;  2LSY A;  1NAF A;  4HFE A;  2K5B B;  1D1B A;  5CGM A;  1YKH B;  4B3S T;  2AXD S;  4A97 A;  3MA9 A;  5KMG P;  4DV6 T;  3V5U A;  2JQH A;  2WP9 A;  3HKB E;  1HNX T;  4P0B A;  1R8I A;  5HXE A;  2K3W A;  3KVA A;  2JQK A;  5ETW A;  2KZ7 B;  1ZP0 A;  4EGW A;  4PNI A;  3PJA A;  2WZH A;  2WU5 A;  5AQL B;  2XM1 A;  4DO0 A;  3TKL B;  5HEU A;  3LK3 B;  4TZ4 C;  3I1A A;  4JV5 T;  4DV5 T;  2V7K A;  2BVM A;  3LBX B;  1MMA A;  3RH3 A;  2LHR A;  2VVS A;  3GWH A;  3RKG A;  3LFM A;  3FZK B;  4ADZ A;  3OPC A;  5AQO B;  3AVS A;  5C3J A;  1FIO A;  3QNU A;  4ALX A;  4PK6 A;  4QXB B;  2NW8 A;  2AE9 A;  3ZMS B;  5J5H A;  1LKX A;  4IE6 A;  4DR6 T;  4IDQ A;  5J2U E;  1I6Z A;  4L0R A;  1EZ3 A;  1IJ6 A;  2Y57 A;  4U33 A;  4UM3 P;  1WYB A;  2V26 A;  3UFE A;  5KX5 E;  3VKG A;  4H9S E;  4HQP A;  5JDM A;  2WY2 A;  4AFT A;  2K9A A;  4X1K E;  4DBR A;  1J5E T;  4EED A;  3AEG A;  2CHN A;  3N9P A;  1ZV4 X;  4UY2 A;  2XM2 A;  2C5I T;  4HWC A;  5KXJ A;  2KT9 A;  2CCQ A;  2VKO A;  3RIU C;  3TLT A;  2XQ6 A;  5LA6 E;  4GYS A;  4EZ4 A;  2VL0 A;  2XTL A;  3AEB A;  4HWD A;  1X9B A;  3AA0 B;  4PJN A;  1WRD A;  4X65 T;  4ZI7 E;  3ANW A;  2CPT A;  3DTO A;  4QX8 B;  3VU7 H;  4KHP T;  4H9P C;  3ZPO A;  4HFB A;  3AB3 B;  3CIR A;  4H9O C;  4U74 A;  2IC9 A;  2Y56 A;  4OK0 A;  1T98 A;  2Y48 B;  4AIU A;  2JIW A;  3UQ4 A;  3RQU A;  4UEL A;  4HN9 A;  2D0U A;  2DLR A;  2LJL A;  3O1I A;  5LHH B;  3UFG A;  2FJA A;  4K0U A;  1MIV A;  2MAW A;  4DR2 T;  2X67 A;  4KX6 A;  3WTO A;  2DCF A;  3GN5 A;  4O4L E;  3VRA A;  1OED C;  2KWI B;  2W67 A;  4EZH A;  5LMN T;  2QC1 B;  4CI1 B;  3ZKR A;  3MAC A;  4X20 E;  1WFD A;  2M67 A;  2XAJ B;  4DBM A;  3ZCJ A;  2W63 A;  2V7M A;  2LSG A;  4BQT A;  4COF A;  2E9X D;  2VL8 A;  4X5T A;  3NBX X;  4ZOL E;  4B5D A;  5F5W A;  2PTF A;  4YY3 T;  1UK5 A;  4MBQ A;  1UX4 A;  2VQF T;  1X79 A;  3VRB A;  2ZM0 A;  1W9R A;  2LOS A;  4IRE A;  4PJL A;  3K3Q C;  2ZM8 A;  1VCS A;  5AQP B;  4JI2 T;  2E5L T;  2D2S A;  3SIO A;  2R6G F;  4DUY T;  3ZCI A;  3CWZ B;  1U4Q A;  4LML A;  3ZLI A;  2YMD A;  2V6X A;  2C5K T;  2BG9 C;  2CMR A;  3UUL A;  2X51 A;  5EK4 A;  3O1H A;  2CWY A;  2VWA A;  3VR9 A;  5LOV E;  5HWY A;  4BA9 A;  3FBZ A;  3I0O A;  1KNZ A;  2H3R A;  5CB4 E;  2FBW A;  1MMG A;  2V1D B;  2W0G A;  3WTL A;  2GK9 A;  2LRK A;  2WZI A;  4ZJS A;  1JNR A;  2E9X B;  3RC8 A;  4UM3 S;  4TWD A;  3UU5 A;  1OED B;  4IHJ E;  4G63 A;  3EHZ A;  5AFM A;  2LM9 A;  5LHG B;  2JMH A;  4YTP A;  2WS3 A;  4TUY E;  2NW7 A;  5JQG E;  3E22 E;  2WNL A;  2QRX A;  5J0Z A;  2UZ6 A;  3K8P C;  3UUB A;  1VRB A;  3OYZ A;  2E2A A;  4AXP A;  2HHH T;  4IDN A;  3C50 A;  3TLV A;  1CUN A;  5L3C B;  4TV9 E;  1SE7 A;  3PTR B;  4YXD A;  2J47 A;  3LK4 2;  2JMK A;  4LF5 T;  3QB5 A;  1HG2 A;  2BG9 B;  3BQL A;  3ONJ A;  4PIR A;  2MOZ A;  1M62 A;  2W62 A;  5AQN B;  2D0T A;  1BR4 A;  2CXF A;  5TVC A;  3ZJ1 A;  4DV1 T;  2LT3 A;  2XQ3 A;  2W8G A;  5DQW A;  1D0Y A;  3CQC B;  1WR0 A;  3F57 A;  1D1A A;  1XNR T;  2LOP A;  5AQT B;  2ZJV A;  1HTJ F;  2CXD A;  4PJJ A;  4QXH B;  4BFQ A;  3PUX F;  4HFD A;  5IWA T;  3AXJ A;  4TWH A;  4ZI2 C;  2X00 A;  3J7Y q;  5JRC B;  2BS4 A;  1LVF A;  2XUE A;  3WTI A;  4H9R C;  2CEA A;  3P7I A;  4ZZB A;  5AQU B;  3TLW A;  1U5P A;  2UU9 T;  3AE7 A;  3F31 A;  2CLY C;  4DBQ A;  2X0Y A;  2DL1 A;  2A72 A;  1LRZ A;  4G2A A;  2L9Q A;  4CZZ B;  5JR9 C;  4EXT A;  2WWV A;  2DI4 A;  3QOF A;  4JLE A;  2JQQ A;  2WNC A;  4AKH A;  3FZH B;  4EZ1 A;  4HGA A;  3EDV A;  3PUZ F;  5HEG A;  2V6Y B;  4AKI A;  2Q9Q C;  4YSX A;  5JDN A;  2X9Y A;  2CBJ A;  1HX1 B;  4TV8 E;  3OJA A;  2IIU A;  4U7I A;  4NUV A;  3S4U A;  2F4V T;  1UW6 A;  3M65 A;  2FUP A;  1G8X A;  3RGL A;  3ZN1 B;  5HCJ A;  2V5D A;  2Q9Q D;  4ZS2 A;  4O4H E;  4DV7 T;  2IUB A;  3PU8 A;  3C4X A;  2KWH A;  3AEC A;  1T7S A;  2JPF A;  3U8M A;  2LKH A;  3L3P A;  3U8K A;  5FXX A;  4ZR6 A;  5KZU A;  2LSJ A;  2BYQ A;  3KV6 A;  2C0S A;  3T1H T;  2XZ6 A;  2ODV A;  5JRE A;  1HNZ T;  2B76 A;  3CX8 B;  2WU2 A;  3PUS A;  4GIW A;  2J4G A;  5JME A;  5AQR B;  1YW0 A;  4YTN A;  3RIA A;  1OWA A;  2CLY B;  5FY7 A;  3L09 A;  3LDQ B;  3I9Y A;  1WCR A;  2DNX A;  4QH1 A;  2N1G A;  4CXW A;  3OVU A;  3N2O A;  4DMV A;  5JR9 B;  5HEH A;  2QYW A;  2EHO A;  3CQX C;  4Q25 A;  4AQF A;  5CA0 E;  3IGQ A;  5AQI B;  2Q9Q B;  5L4E A;  3ZDG A;  5AQV B;  3HL6 A;  4BJM A;  1IBK T;  4J2C A;  2WBL A;  3ETV A;  4E7Z A;  2XQ5 A;  1XNQ T;  3WI3 A;  3WIP A;  4I50 E;  3PUG A;  2WB5 A;  4WZX A;  5LG4 A;  2JJ9 A;  2A9U A;  5AQF B;  4QXC B;  2BVL A;  3RI5 A;  3L8R A;  5CFB A;  4MFR A;  3WAK A;  3AE4 A;  3I0Q A;  3RYH E;  2LE8 A;  1XDP A;  3RRC A;  3KBT A;  4LF4 T;  4I4T E;  4UVA B;  5FXV A;  3N9M A;  2MTQ A;  2YKS A;  3WTJ A;  2VKJ A;  3CPZ A;  4JI7 T;  2CBI A;  4U2Y A;  3FB2 A;  3F2E A;  5IYZ E;  5BW2 A;  3DP7 A;  4ZEY A;  3FZM B;  1YQ4 A;  3M3Z B;  3CX7 B;  3ZT7 A;  4YLH A;  4UEM A;  1DU2 A;  5HEO A;  3IA3 A;  2W66 A;  5ABG A;  4GK0 E;  4IE7 A;  2CRB A;  4K0K T;  3WTH A;  4CN4 A;  2WDV A;  5EK3 A;  3HA4 A;  3RC3 A;  4O4J E;  3H3A A;  3NKZ A;  3ZN0 B;  3P4Q A;  3SS1 A;  3N5L A;  4LF7 T;  3UUX B;  2FJB A;  3KBU A;  5ABF A;  2BYP A;  4ANJ A;  1HCI A;  3QB5 K;  3KVB A;  5HYA A;  3A5X A;  4LF8 T;  2Y6X A;  2LLY A;  4QH5 A;  4AI6 A;  2X9W A;  5J1G A;  2YOE A;  3LG7 A;  3NWI A;  1SHZ C;  1MND A;  3ZMU B;  2QA7 A;  3P4S A;  5TAO A;  2NTY A;  4F6R C;  1YXR A;  5AQS B;  5AQH B;  3HR0 A;  4DV2 T;  4ZK1 A;  2VB6 A;  5AIN A;  3N2G E;  2FJE A;  5J5I A;  3ZDH A;  4TNW A;  2J62 A;  4EB6 E;  4CN1 A;  4PK5 A;  1E7P A;  3AE6 A;  3HKD E;  3RF1 A;  5LXT E;  1NWM X;  3C51 A;  3GUA A;  4XAX B;  2MBG A;  2XYS A;  4QWN B;  4CI2 B;  4TNV A;  4JI3 T;  3K3O A;  3OYX A;  4GOU A;  5J5G A;  2XY8 B;  2DWG A;  2CWO A;  1H7C A;  4F8H A;  4KHZ F;  4FJO A;  5LJN A;  2CE7 A;  2HN2 A;  4WW0 A;  2XYT A;  3CKD A;  5F8P A;  4HFH A;  1T72 A;  3JCF A;  4UM3 A;  1QLB A;  2NWB A;  3UUM A;  3KV9 A;  4NIQ A;  3UU4 A;  4MAL A;  5JTG A;  1MMN A;  4WNK A;  4UF0 B;  5FJV A;  5HCM A;  3LBX A;  4U7Y A;  4EV6 A;  4LFC T;  5LMU T;  5CA1 E;  1IJ5 A;  1KK7 A;  2G0U A;  5C8Y E;  3RYF E;  1IBL T;  4KBM B;  3SQ9 A;  5LBM A;  3ESL A;  2XAQ B;  2UXN B;  3AVR A;  3C4W A;  1UUR A;  1V9D A;  5LNK A;  3PE0 A;  1J1J A;  2RP4 A;  4O4I E;  4EAH A;  3EUH A;  2BBJ A;  3C84 A;  4I55 E;  4GKJ T;  5FY1 A;  2M6I A;  4L9I A;  2D9D A;  1UX2 A;  4XZC A;  1FMW A;  2ZJU A;  1D1C A; 
#chains in the Genus database with same CATH homology
 2YKS A;  2PGZ A;  4WV9 A;  4XK9 A;  4ZJS A;  3T4M A;  3WTJ A;  2X00 A;  2Y57 A;  4HFC A;  4UM3 S;  4UM1 A;  4TWD A;  3UU5 A;  1OED B;  3WTI A;  2KSR A;  5JME A;  2XZ5 A;  3JAE A;  3RIA A;  4UM3 P;  2XQ4 A;  3GUA A;  1OED E;  2MAW A;  2XYS A;  5L4H A;  3EAM A;  4ZZB A;  2BR7 A;  2WNJ A;  4QAC A;  3TLW A;  5BW2 A;  3WTO A;  3SQ6 A;  2XQ9 A;  4TNV A;  3EHZ A;  3U8N A;  2Y54 A;  1I9B A;  4QH1 A;  4AFH A;  5AFM A;  3WTK A;  4HQP A;  5KE4 A;  2LM2 A;  3EI0 A;  4AFT A;  1OED C;  5J5G A;  2YME A;  5IUX A;  3RIF A;  4QAA A;  4HFE A;  5HEH A;  3U8L A;  4ILA A;  2QC1 B;  5AFJ A;  3RHW A;  3SH1 A;  4F8H A;  2WNL A;  3P4W A;  4A97 A;  5L47 A;  5LXB A;  3P50 A;  5HEO A;  3ZKR A;  5J0Z A;  2UZ6 A;  2XYT A;  5CO5 A;  4QAB A;  3UUB A;  2BR8 A;  2BYN A;  4DBM A;  2BYR A;  3U8J A;  4HFH A;  4UY2 A;  5AFM B;  3WTH A;  3IGQ A;  2BJ0 A;  4NPP A;  4AFG A;  3JAD A;  4UM3 A;  4BQT A;  3UU8 A;  4COF A;  4X5T A;  3UU4 A;  2BG9 E;  2YN6 A;  2WNC A;  4B5D A;  4EZ1 A;  5SYO A;  5L4E A;  5FJV A;  3TLV A;  2W8F A;  5HCM A;  2C9T A;  4TWF A;  2BG9 A;  2XNU A;  3TLT A;  3ZDG A;  4Z90 A;  2XQ6 A;  3JAF A;  2BYP A;  2VL0 A;  4IRE A;  4LMK A;  4IL9 A;  5HEG A;  5HEU A;  3WTM A;  5BRX A;  3PEO A;  2XQ5 A;  2PH9 A;  4HFI A;  4ILC A;  5LG3 A;  2X00 D;  2M6B A;  2XNT A;  3WIP A;  2XQ7 A;  2LLY A;  4QH5 A;  3TLS A;  4LMJ A;  3UU3 A;  2Y58 A;  3UU6 A;  2YOE A;  2BG9 B;  3RQW A;  3LSV A;  4ZRU A;  4PIR A;  3SQ9 A;  2XNV A;  5BP0 A;  1UW6 A;  3SIO A;  2BYS A;  3TLU A;  5TVC A;  5AFL A;  5AFK A;  5HCJ A;  5J5F A;  4HFB A;  4ZK4 A;  4LML A;  2XQ3 A;  5AFH A;  2YMD A;  2Y56 A;  3PMZ A;  2BG9 C;  2W8G A;  3RI5 A;  4IL4 A;  1UV6 A;  3C79 A;  3WTN A;  5CFB A;  4XHE A;  4ZJT A;  2XQA A;  3C84 A;  4NZB A;  3U8M A;  4ALX A;  2LKH A;  3U8K A;  3UQ4 A;  3UQ7 A;  3RQU A;  4ZR6 A;  2Y7Y A;  5KZU A;  2WZY A;  5AFN A;  2BYQ A;  4QH4 A;  1OED A;  2WN9 A;  2M6I A;  5HEJ A;  2ZJV A;  4ZK1 A;  5J5H A;  4UXU A;  5AIN A;  4Z91 A;  4D01 A;  4ILB A;  4ZZC A;  1UX2 A;  2LKG A;  4FRR A;  4BFQ A;  2XZ6 A;  5J5I A;  3ZDH A;  4TNW A;  2XQ8 A;  4HFD A;  3WTL A;  4A98 A;  2ZJU A;  4TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...