4QH1A

The glic pentameric ligand-gated ion channel (wild-type) in complex with bromoacetate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein, transport protein
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh1A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh1A01
4AFGA 2Y7YA 3JAFA 4TNWA 2XNUA 5CO5A 3TLUA 2BR8A 2UZ6A 2XQ6A 3RHWA 2YKSA 4HQPA 3GUAA 3WTKA 5AFMA 3C84A 4ZZBA 1OEDE 2XQ8A 1UW6A 5AFJA 5KZUA 5SYOA 2YMEA 2WNCA 4HFDA 5BW2A 4AFTA 2BG9E 3RQWA 4QAAA 4QH4A 3SH1A 4TWFA 3C79A 3U8KA 2YN6A 1OEDB 4ALXA 5J5GA 5JMEA 3RI5A 5J0ZA 2PH9A 2XYTA 2LKGA 5BP0A 2LKHA 5J5FA 4COFA 5HEUA 2BG9B 3UU4A 3JAEA 5L4EA 3SIOA 4TWDA 4Z91A 3TLWA 1UX2A 2YOEA 4F8HA 2W8FA 4NPPA 3UU8A 2Y56A 2X00D 4ILBA 2BJ0A 3U8JA 3WTNA 2MAWA 4QH5A 2XNTA 3UU5A 2VL0A 3U8LA 4BQTA 4LMJA 2BYQA 2W8GA 4ZR6A 4QH1A 3SQ6A 4UY2A 2BYRA 3UQ7A 4AFHA 3UUBA 3RQUA 2ZJVA 3P4WA 3EI0A 5HCMA 2M6IA 1UV6A 3WTHA 3RIFA 5L4HA 3WTJA 4HFBA 3WTIA 4HFIA 3LSVA 3PMZA 4UM3P 3U8MA 5HEOA 3WTLA 4HFHA 4A97A 3P50A 2YMDA 4UM1A 3U8NA 5AFMB 5HEHA 3TLSA 3ZKRA 4B5DA 4XK9A 4NZBA 2XQ9A 4HFCA 2Y57A 2WZYA 2XQ5A 1I9BA 3WTOA 2KSRA 2LM2A 4ZZCA 3ZDGA 2WN9A 2QC1B 4ZJSA 2Y54A 5KE4A 4D01A 5HCJA 4BFQA 5AINA 2LLYA 3TLTA 4IL9A 3IGQA 3WIPA 4HFEA 2BYPA 4ZK1A 5TVCA 5AFKA 2X00A 4ZJTA 3SQ9A 2XYSA 4X5TA 3PEOA 4QACA 5L47A 1OEDA 3UU3A 3UQ4A 2WNJA 2C9TA 5IUXA 4LMLA 3TLVA 2XQ4A 4ILAA 4LMKA 4ILCA 2BYNA 3WTMA 3RIAA 5AFLA 5CFBA 2BG9A 1OEDC 2PGZA 4DBMA 5AFHA 3UU6A 4IREA 3T4MA 2BYSA 4PIRA 5LG3A 4FRRA 4UM3A 2XZ6A 2BG9C 5J5HA 2XNVA 4Z90A 2Y58A 5FJVA 5BRXA 2ZJUA 2WNLA 2XQAA 4QABA 4A98A 4UXUA 4ZK4A 5AFNA 5LXBA 5HEJA 2XQ3A 4ZRUA 3ZDHA 2XZ5A 4EZ1A 3JADA 2BR7A 5HEGA 4UM3S 5J5IA 2M6BA 3EAMA 4TWHA 4TNVA 2XQ7A 4IL4A 4XHEA 4WV9A 3EHZA
chains in the Genus database with same CATH superfamily
4BJMA 3TLUA 3Q5WA 2FJDA 3ZJ2A 1U5PA 2QVAA 4X1KE 2H89A 5AFUL 5CJ5A 3OJAA 3V5UA 2X9WA 1G8XA 1KFYA 3UTKA 4UVAB 2CXFA 2HN2A 3LK2B 1US7B 2LSJA 2WS3A 4DV0T 3ZC1A 4DR5T 4GIWA 3FXDB 3LSVA 3PUGA 4B5DA 3Q5EA 2XQ9A 4NXNT 4YTNA 1ZOYA 2ES0A 4OYJA 4X1IE 4TN7B 5KE4A 2W62A 4ZOLE 3PJAJ 2N2NA 5FKYA 4F6RC 2BYPA 2WP9A 2NTYA 4K0UA 3ZYMA 5IUXA 1D0XA 3RRCA 3RRWA 4O4JE 2LSKA 3WI3A 1XNQT 3F2EA 5J5HA 5CGMA 3I0QA 3MA9A 4JI3T 4ZK4A 2IC9A 4DUZT 4KX6A 4I4TE 4FJOA 2CLYB 5HEGA 4KMCA 2WU2A 4TNVA 4HEAA 2VL8A 3AAIA 2LEHA 2C0SA 4AIUA 5LYJE 5KZUA 2XAQB 4ZI2C 4LFAT 3L09A 1M62A 3AEEA 4B3MT 5HXSA 2BKNA 4EZ4A 3KV6A 3N2KE 5A1LA 3J7Yq 4QXHB 2E5VA 5LG4A 2LKGA 5J5FA 2UUBT 3ZPOA 4UVCB 2JIWA 2JJ9A 2DI4A 3MKDA 4X64T 3UUMA 3EDVA 3H37A 5AQQB 2VQFT 2VL0A 4EEBA 3N5LA 1NAFA 5J2UE 4QXCB 3SQ6A 2UXBT 4WNKA 1HCIA 5H6RB 1KNRA 3WTIA 2L3LA 3U78A 3VKGA 5EK2A 1ZP0A 3ZKRA 4AKHA 1KNPA 2CHOA 3ETUA 1I9BA 3P4PA 4WBNE 2WDQA 5AQFB 4DV7T 4PJJA 3ZDGA 1G73A 5DABA 4ZI2D 4U74A 3ZCJA 3IHRA 4DR3T 3ONLC 2DWKA 3KV9A 3H3AA 1L0VA 2X9YA 3ZMTB 2BYNA 5AFLA 2FJEA 5KMGP 3ZCIA 2DHRA 3ZLIA 4DBRA 4FRRA 2BG9C 4YJ3E 5LJNA 4YFSA 2WWVA 2ZJUA 4I0UA 3FZMB 5HEJA 2JQKA 4XAXB 4AKRB 3BQIA 3OPCA 3PURA 3AE5A 3EHZA 3RF1A 2C5IT 3JAFA 3MZKB 3PUXF 3B13A 4BJNA 4ZS3A 4WBOA 4YTMA 5FMNA 2BG9E 3N9LA 3AA0B 1GQEA 4U31A 5LXTE 4QAAA 2CXLA 2D5UA 4IDPA 3NBXX 2V5DA 2F4VT 2GK9A 1XDPA 2A3DA 2UU9T 4EYYR 5DQVA 2J62A 3L3PA 3I0OA 5JR9C 2Z6EA 4QH5A 1LKXA 4H63H 4NUUA 3IF8B 4JEHB 4U2YA 1KNZA 2XM1A 4CI2B 4LF5T 4HFHA 3U8NA 1HTJF 5ABFA 3CX7B 4EIWA 2WZYA 1JNZA 2KSRA 1WYCA 1BR2A 2QC1B 2QA7A 4D01A 4CXWA 2E8IA 5LOVE 3ZT5A 1HR0T 2H7OA 3CPZA 2KINB 2W00A 4OHFA 3UQ4A 2BKOA 2K24A 4ILAA 4LMKA 3RGLA 3O9XA 1X79A 5ETWA 3ZN1B 2WCAA 4Z90A 2R6GF 4P0BA 4HWIB 3KDSE 4EZ1A 3JADA 4FI5A 1LVKA 4B3RT 1IJ6A 1YQ3A 2ODUA 2LHNA 4QX8B 1SA0E 3RYFE 3JCFA 2BS2A 3K3OA 1D0ZA 4TNWA 2BS3A 3GUAA 5AFMA 2YMEA 4H9SE 3OBVE 3KFWX 4AFTA 3M3ZB 3L8RA 4TV9E 2XASB 1UX4A 4ALXA 2NWBA 3AEDA 3RI5A 4PFOA 1D0YA 2BG9B 1E1HB 3AB3B 4AKLA 1I94T 4TWDA 4NIQA 2YOEA 1T98A 4ZI3C 2IUBA 3VRAA 2IAKA 3D0TA 3WAJA 5IYZE 2ZLYA 3WTNA 5JREA 3Q5DA 4H9PC 2A9UA 4O4LE 4JYAT 2KLQA 4CZZB 2JQ9A 4YY3T 4B6XA 3K1SA 4O2AE 4P1NA 3ZSTA 3UT5E 1ZV4X 4ZJSA 2Y54A 3FXEB 3KVAA 4MBQA 3P7IA 4L0RA 2WDRA 2K48A 3PUZF 4ZK1A 1MNEA 3P4QA 5JR9B 3HI2A 4DR6T 2MYSA 2QGSA 4HWHA 3W15B 4HGAA 3SOLA 3IEEA 4HN9A 2KWIB 4H9QC 4ZI3D 4HWFA 2CRBA 5CB4E 2V8SV 2CBJA 4X65T 5JDGA 5AQMB 3CMLA 2BDEA 2XQ6A 2YKSA 3EVYA 4ZZBA 5SYOA 3ANWA 1Y01A 4J2CA 4TWFA 2VK9A 5FXVA 3OYZA 1D1AA 4JI5T 2ZM8A 2N1GA 3PE0A 2A2FX 3ZEFB 4ZHQE 4JBWF 1WYBA 3ZMZB 1N33T 2VVSA 4UY2A 2ZJVA 1IBMT 3P4WA 4ISTA 3WTHA 2W67A 3BK9A 4EGWA 1XMQT 2B1EA 4LF6T 4LF8T 1FMVA 2WZIA 4LF7T 2EHOC 2JMKA 2NW7A 3PUAA 2FJAA 2XY8B 2Q9QA 2JRKA 1T8BA 1JNRA 5HWYA 3KINB 3UUXB 2WM9A 3B5MA 2XAGB 3UU3A 3AA1B 5FXXA 2LT3A 3AXJB 5LMNT 4O4HE 4EYUA 4PK4A 4YT0A 5C3JA 1YXRA 2V7IA 3PUSA 2M6BA 2XAFB 4UXNB 2MPKA 4QKNA 3V5SA 4ZI7E 3RLFF 3UFEA 2QRXA 4LF9T 1Z0PA 1M7KA 3JC6D 4DBQA 3QNUA 5AQTB 2EHOD 2CM0A 5JQGE 4IDQA 2CEAA 1J5WA 4DV1T 3I9WA 3C51A 5FNVE 3VU7H 3JAEA 1J1JA 4Z91A 1E2AA 2VQET 1UX2A 4F8HA 2X00D 1D1CA 2X9HA 4EZHA 2DCFA 4CI1B 4TX5A 5CA0E 5FYMA 3N9NA 4UR9A 2HPLA 2RA1A 1UV6A 3ZMSB 1NEKA 1HX8A 3QOFA 4I50E 2YMDA 4E7SA 3LFMA 3SRZA 4ZZCA 3ZMUB 2LLYA 3IGQA 4G2AA 2N9DA 5AQIB 2KXPB 3AEAA 2XYSA 3PUQA 5FY0A 2DL1A 2J47A 2MTQA 3RIAA 1OEDC 2SPCA 5AFHA 1MIWA 3RIUC 2XQAA 4QABA 1ZKEA 4MHCA 5J5IA 4ASKA 5L2LA 2JMHA 2VKJA 5M4YA 4H63V 2EHOB 5KDMC 3HA4A 3N2GE 1WLXA 1D1BA 3CX8B 3HKCE 1OEDE 1YW0A 3FZFB 4P09A 4U2ZA 2WNCA 2V7KA 2Y48B 5F5WA 3KV5A 4ADZA 2LE8A 2CBIA 4KHPT 3AEBA 4JI7T 3U8KA 5J5GA 5BMVE 2LOPA 5LJMA 4DVDA 1HS7A 3UU4A 2EHOA 3AAAB 5HXCA 2Y56A 4IE7A 2BKPA 2IHR1 4QH1A 3OTOT 2ZM2A 3WTJA 2V6YB 5AQSB 4X20E 2BVLA 4V1Av 3ESLA 2YK0A 5LHIB 3WTOA 1BR0A 4ANJA 4IL9A 3O4XE 3AE3A 4C91A 2ODVA 2NOXA 2VVNA 2KMFA 4AISA 4LFBT 5BR8T 5AFKA 2WWUA 4QACA 3PJAA 3ZMVB 2LSYA 3O1HA 5AQLB 1R8IA 1NENA 3R6NA 5KX5E 1WRDA 2PGZA 4H9OC 4BAYB 3RKOA 1LVFA 2WY2A 4UIGA 4TZ4C 5H6QB 3C64A 2YDRA 3DJBA 4MALA 2WNLA 4HKAA 2X67A 1WR0A 4HWCA 2D2SA 1S94A 2K9AA 4TWHA 3KV4A 5J1GA 3NWIA 4JLEA 5LMUT 5CO5A 2BR8A 2CPTA 3MK7C 5ABGA 5GONE 4KP3C 3O1JA 2J4GA 2IDOB 2WQYA 3C4XA 3G06A 5F8PA 4YSXA 4YHHT 5FVKA 3GN5B 1OEDB 3ETVA 4YJ2E 4C90A 4AKIA 5FL0A 4UVBB 1HNWT 1HG2A 2KWHA 3C4WA 3N9MA 2W8FA 5LB7B 1B7TA 2MOZA 2E9XC 1VCSA 2M67A 2BYRA 3C50A 5HCMA 3QUJA 4HFBA 3T1YT 1VRBA 4QX7B 4UM3P 2W4XA 1CHUA 2BS4A 4JUYA 4AKGA 3K3NA 1MIVA 4A97A 4ZEYA 4JV5T 2C5KT 5HEHA 4LFCT 3H3MA 5JVDE 5AQOB 1NWMX 2LM2A 4NXMT 5JDHA 2V1DB 5HCJA 4IDZA 3BQLA 2W0GA 2YU1A 4HFEA 2G0UA 4X5TA 3PEOA 5HXEA 3RPUA 4O2BE 4YSYA 3T4MA 2BYSA 1VCTA 5LG3A 4UM3A 3DP7A 1HFAA 3P4RA 2Y58A 4CN1A 5FJVA 3EDUA 5AQGB 4YTPA 1UURA 1IBKT 2BR7A 2E9XD 3CQGB 3QC9A 2ZM6T 4X62T 2Y6XA 4AFGA 5LP6E 4GKJT 3CQCB 4U7IA 5EK3A 5LCYA 1SE7A 5LGTB 2WSSV 4PFPA 2YN6A 2PH9A 5TAOA 5FY1A 3K8PC 5HEUA 3ZT7A 2DLRA 2ZM0A 5JH7E 2XNTA 1IZNB 4EEDA 4G63A 5LNKA 2UXCT 2XHEB 5AQVB 4EB6E 4UV8B 3FBZA 3FB2A 3LG7A 5EZYE 4OFZA 2UXDT 2L8KA 4CN4A 4XK9A 3ZYKA 4NZBA 2CWYA 5L3EB 2CCQA 1W9RA 5ABHA 4BFQA 2XJ7A 3RKGA 2YDSA 4CN6A 4IDOA 3RC3A 5JDMA 2WNJA 3SFEA 2LSIA 4LMLA 4IE5A 1IJ5A 2PJQA 2BG9A 3ONXA 5L3FB 4UEMA 2E9XB 5HXRA 1OWAA 3T1HT 2NTXA 1BR4A 3E22E 4ZRUA 4IE4A 3AECA 1LRZA 2BVMA 4QXBB 4M1PA 4AQFC 3RHWA 4H9NC 3WTKA 2IIUA 5AQKB 1N36T 4Z8XA 3B57A 4EV6A 1IAPA 3RQWA 2YDQA 1UUSA 2FJBA 4UF0B 3EUHA 3X1DA 4YLHA 5BP0A 5JDNA 1BR1A 4I43B 2CMRA 3NRYA 5JR9A 1KF6A 5LHHB 1YKHB 4H9RC 5AQNB 5KXJA 3U8JA 1FEWA 2W8GA 2NW8A 5JRCB 3CK6A 2L9QA 3LBXB 2JPFA 5L3GB 1WR6A 4LF4T 3CWZB 2JQHA 3ZYLA 3O1IA 2PFVA 4AQGA 1XWMA 5FVLA 2HH7A 4AI6A 4KHZF 5CA1E 1MMDA 3HKBE 3TLTA 1H7CA 2NP9A 3ZN0B 3C4ZA 5JRCA 2BBHA 2C9TA 4HE8A 2LJLA 3AA6B 4YXDA 4IREA 4HFVA 1HX1B 2JQQA 2UXXB 3LJCA 1Z8UA 3AEGA 2V6XA 2X66A 2LSGA 3EAMA 4YHJA 2WBLA 4MFRA 4E7ZA 2XZEA 2ACXA 2Y7YA 5LGUB 2XQ8A 3AE6A 2LOSA 1T7SA 1FJGT 5LA6E 2J1DG 1HG5A 2CA5A 1UK5A 3CVRA 3SIOA 2H3RA 3MACA 3WAKA 3AXJA 3EABA 4PJLA 4LMJA 4GYSA 4CI3B 3U8MA 2NR4A 1KK7A 2CHNA 2W66A 3WTLA 4Q25A 4DV6T 4JI6T 5LGNB 2NW9A 2IC6A 4CQIA 2I0MA 5AINA 4WW0A 4UV9B 3RC8A 4PK5A 3DTOA 5TVCA 5AQJB 3SQ9A 5AQRB 2D9DA 2DNXA 5AQHB 2IW5B 3NVOA 4PIRA 2UXNB 2X0HA 2XSAA 2XZ6A 3CIRA 3UUNA 5BRXA 5LXBA 3HKEE 2XZ5A 4KUMB 5L3CB 3NRXA 2XNUA 3T8OA 4HQPA 3OVUA 4PJNA 5FP3A 1HF8A 4DR7T 4JI1T 1MIYA 5ABEA 3ZT6A 5FY7A 3NZQA 1Y64B 4WZXA 3I1AA 2K3WA 4ZXLA 2W2UA 4UELA 2QYWA 3N9QA 4EAHA 3RH3A 4GKKT 3UU8A 5LHGB 2PG8A 3UU5A 1VOMA 4AFHA 3UUBA 2X68A 5L4HA 1XDOA 5ADXL 3P50A 4UM1A 2XQ5A 3M65A 4ILUA 2E2AA 3TKLB 1SUMB 3GA8A 1J5ET 3AE7A 4IT4A 1FIOA 2X00A 3P4SA 4TV8E 4XZCA 3CKDA 1O3XA 4N78D 2XQ4A 5L3BB 2HN1A 3UU6A 3Q5XA 2W61A 3RYHE 2H88A 4DR2T 5IHYA 4A98A 1E7PA 3PU3A 2B76A 4DV2T 2D0TA 2V6YA 3OKQA 3PUYF 1W0BA 1W09A 3E0ZA 2YINA 2XAHB 3UULA 3C84A 1UW6A 1EZ3A 2HHHT 1T72A 4IIJE 2LRLA 3PUWF 2CXDA 2D0UA 2V7JA 3LK3B 3IA3A 1U4QA 2I6HA 1UX5A 5JMEA 3IBPA 2XYTA 2LKHA 4COFA 2E5LT 4AQYT 2VWAA 5E0OA 2UUAT 1MMNA 3MXZA 4ILBA 5C8YE 3SWHA 2MAWA 4ERRA 3AE8A 2AE9A 3VHLA 3ONJA 3CQXC 3AEFA 3VKHA 1I6ZA 3VR9A 5FXZA 2MBGA 2PBIA 1SHZC 3VRBA 2WU5A 5FXWA 1N32T 3J9X1 3AAEB 3Q2MA 3LDQB 3RYIE 3RX6A 4NUVA 1UGOA 3GWHA 4P0AA 3CX6B 3GN5A 5L47A 1OEDA 2XUEA 3RIUA 1YKEB 4DBMA 3AE9A 1X9BA 2DWGA 4PNIA 2WZHA 3LK42 3VR8A 3A8YC 2XM2A 2OV9A 4EOZB 4EXTA 2OLTA 4CXYA 4IDNA 1QUUA 2XQ7A 4PJMA 4WV9A 5ABFB 3QK6A 2UZ6A 2A72A 2IMLA 2W63A 4CXXA 5F3JA 3GMIA 4DO0A 4B3TT 3AVRA 2BZBA 2X51A 3ABVA 1MMGA 4IGUA 4XBFB 2LRKA 3SH1A 5DQWA 5J0ZA 2WAUA 3QB5A 3I9YA 2LM9A 2YEVC 2XPKA 3TLWA 4ZS2A 1UCUA 1HNXT 5HWXA 2Y8DA 3N9PA 3R84B 1WCRA 4ZR6A 3PDYA 3MJXA 3UQ7A 2PTFA 4WYVA 3RQUA 4JI2T 3EI0A 4U33A 5HAXA 4DNDA 4OK0A 3C98B 5LBQB 5AFMB 3TLSA 4OX9T 4HFCA 3AA7B 4OYKA 2WMNA 4L9IA 4A56A 2YU2A 4BA9A 1N34T 4YSZA 2Q9QC 4ZJTA 5C2TA 1W0AA 2CE7A 5HXHA 1KEYA 3WTMA 5CFBA 2ACZA 4GK0E 5DJQC 5EK4A 2X9XA 3L39A 4PK6A 4U7YA 1CUNA 1ZEEA 4GYRA 5HYAA 3FZHB 4UXUA 1YQ4A 4L5GA 4X1YE 2XTLA 2KNDA 2AXDS 5AQUB 2OA5A 5FL1A 5AFJA 5JDFA 2XQYA 2VURA 5L3DB 4DV5T 1MNDA 3BQKA 4JEUB 1IBLT 2P9BA 1WFDA 2Q9QD 2CWOA 2V26A 3Q9DA 2K5BB 3FZLB 2E9XA 4DIDB 4A5XA 2BYQA 5J2TE 1DU2A 4DV4T 2FUPA 2X0YA 4O8SA 3F31A 3A7MA 3KBTA 4DR1T 4DMWA 3S4UA 3HR0A 4DUYT 2LHRA 3AE4A 3PU8A 3U3IA 2FBWA 3AE1A 4MLKA 2WN9A 1MMAA 3ANWB 3FBLA 4PAGA 4U72A 2ZMAA 2V7LA 3HL6A 4UF0A 4U3CA 3TLVA 4ILCA 5JTGA 1XNRT 4O4IE 5JDLA 3KBUA 2WMOA 3NZPA 4IE6A 2VKDA 4IE0A 4DR4T 3LBXA 2HPJA 3K3QC 3FZKB 1HNZT 2KZ7B 2I59A 1QSDA 2V7MA 3NKZA 2Q9QB 3N9OA 4HFDA 5BW2A 4JI0T 4QH4A 2WB5A 3N2OA 2X0LB 3C79A 4HTEA 4GOUA 3OYXA 1V9DA 5IWAT 5L4EA 2VKOA 1ZHCA 2KT9A 3JC6C 2XAJB 4KBMB 3ZSSA 4AXPA 3E08A 1AJ3A 3PUVF 4NPPA 3P8CD 1FMWA 3SFDA 2BJ0A 3ZJ1A 2WDVA 3U8LA 4BQTA 3FHNA 4ISSA 4QWNB 4DV3T 2VB6A 3QB5K 1QLBA 2M6IA 1S35A 3RIFA 4HFIA 5AQPB 4I55E 3PMZA 4B3ST 5HEOA 5LBMA 2BBJA 2VKHA 2CLYC 3SS1A 4DMVA 4PW8A 2Y57A 4HWDA 2VASA 4K0KT 2XSBA 2H7VC 3A5XA 4X66T 1XMOT 3WIPA 3PV0F 4QHOA 3KVBA 5JDQA 4GK5E 3AE2A 2C5JA 3AVSA 4KI0F 4JI8T 3F57A 3UFGA 2XNVA 1OXZA 1YD8G 2UUCT 5AFNA 3PTRB 3ZDHA 2RP4A 2XQ3A 3ZC0A 4UM3S 2V5CA 4AQFA 3HKDE 4JI4T 2RPAA 4IL4A 4XHEA 1XZYA 3RYCE 4IHJE 4TUYE
chains in the Genus database with same CATH topology
4AFGA 2Y7YA 3JAFA 4TNWA 2XNUA 5CO5A 3TLUA 2BR8A 2UZ6A 2XQ6A 3RHWA 2YKSA 4HQPA 3GUAA 3WTKA 5AFMA 3C84A 4ZZBA 1OEDE 2XQ8A 1UW6A 5AFJA 5KZUA 5SYOA 2YMEA 2WNCA 4HFDA 5BW2A 4AFTA 2BG9E 3RQWA 4QAAA 4QH4A 3SH1A 4TWFA 3C79A 3U8KA 2YN6A 1OEDB 4ALXA 5J5GA 5JMEA 3RI5A 5J0ZA 2PH9A 2XYTA 2LKGA 5BP0A 2LKHA 5J5FA 4COFA 5HEUA 2BG9B 3UU4A 3JAEA 5L4EA 3SIOA 4TWDA 4Z91A 3TLWA 1UX2A 2YOEA 4F8HA 2W8FA 4NPPA 3UU8A 2Y56A 2X00D 4ILBA 2BJ0A 3U8JA 3WTNA 2MAWA 4QH5A 2XNTA 3UU5A 2VL0A 3U8LA 4BQTA 4LMJA 2BYQA 2W8GA 4ZR6A 4QH1A 3SQ6A 4UY2A 2BYRA 3UQ7A 4AFHA 3UUBA 3RQUA 2ZJVA 3P4WA 3EI0A 5HCMA 2M6IA 1UV6A 3WTHA 3RIFA 5L4HA 3WTJA 4HFBA 3WTIA 4HFIA 3LSVA 3PMZA 4UM3P 3U8MA 5HEOA 3WTLA 4HFHA 4A97A 3P50A 2YMDA 4UM1A 3U8NA 5AFMB 5HEHA 3TLSA 3ZKRA 4B5DA 4XK9A 4NZBA 2XQ9A 4HFCA 2Y57A 2WZYA 2XQ5A 1I9BA 3WTOA 2KSRA 2LM2A 4ZZCA 3ZDGA 2WN9A 2QC1B 4ZJSA 2Y54A 5KE4A 4D01A 5HCJA 4BFQA 5AINA 2LLYA 3TLTA 4IL9A 3IGQA 3WIPA 4HFEA 2BYPA 4ZK1A 5TVCA 5AFKA 2X00A 4ZJTA 3SQ9A 2XYSA 4X5TA 3PEOA 4QACA 5L47A 1OEDA 3UU3A 3UQ4A 2WNJA 2C9TA 5IUXA 4LMLA 3TLVA 2XQ4A 4ILAA 4LMKA 4ILCA 2BYNA 3WTMA 3RIAA 5AFLA 5CFBA 2BG9A 1OEDC 2PGZA 4DBMA 5AFHA 3UU6A 4IREA 3T4MA 2BYSA 4PIRA 5LG3A 4FRRA 4UM3A 2XZ6A 2BG9C 5J5HA 2XNVA 4Z90A 2Y58A 5FJVA 5BRXA 2ZJUA 2WNLA 2XQAA 4QABA 4A98A 4UXUA 4ZK4A 5AFNA 5LXBA 5HEJA 2XQ3A 4ZRUA 3ZDHA 2XZ5A 4EZ1A 3JADA 2BR7A 5HEGA 4UM3S 5J5IA 2M6BA 3EAMA 4TWHA 4TNVA 2XQ7A 4IL4A 4XHEA 4WV9A 3EHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AFG A;  2Y7Y A;  3JAF A;  4TNW A;  2XNU A;  5CO5 A;  3TLU A;  2BR8 A;  2UZ6 A;  2XQ6 A;  3RHW A;  2YKS A;  4HQP A;  3GUA A;  3WTK A;  5AFM A;  3C84 A;  4ZZB A;  1OED E;  2XQ8 A;  1UW6 A;  5AFJ A;  5KZU A;  5SYO A;  2YME A;  2WNC A;  4HFD A;  5BW2 A;  4AFT A;  2BG9 E;  3RQW A;  4QAA A;  4QH4 A;  3SH1 A;  4TWF A;  3C79 A;  3U8K A;  2YN6 A;  1OED B;  4ALX A;  5J5G A;  5JME A;  3RI5 A;  5J0Z A;  2PH9 A;  2XYT A;  2LKG A;  5BP0 A;  2LKH A;  5J5F A;  4COF A;  5HEU A;  2BG9 B;  3UU4 A;  3JAE A;  5L4E A;  3SIO A;  4TWD A;  4Z91 A;  3TLW A;  1UX2 A;  2YOE A;  4F8H A;  2W8F A;  4NPP A;  3UU8 A;  2Y56 A;  2X00 D;  4ILB A;  2BJ0 A;  3U8J A;  3WTN A;  2MAW A;  4QH5 A;  2XNT A;  3UU5 A;  2VL0 A;  3U8L A;  4BQT A;  4LMJ A;  2BYQ A;  2W8G A;  4ZR6 A;  4QH1 A;  3SQ6 A;  4UY2 A;  2BYR A;  3UQ7 A;  4AFH A;  3UUB A;  3RQU A;  2ZJV A;  3P4W A;  3EI0 A;  5HCM A;  2M6I A;  1UV6 A;  3WTH A;  3RIF A;  5L4H A;  3WTJ A;  4HFB A;  3WTI A;  4HFI A;  3LSV A;  3PMZ A;  4UM3 P;  3U8M A;  5HEO A;  3WTL A;  4HFH A;  4A97 A;  3P50 A;  2YMD A;  4UM1 A;  3U8N A;  5AFM B;  5HEH A;  3TLS A;  3ZKR A;  4B5D A;  4XK9 A;  4NZB A;  2XQ9 A;  4HFC A;  2Y57 A;  2WZY A;  2XQ5 A;  1I9B A;  3WTO A;  2KSR A;  2LM2 A;  4ZZC A;  3ZDG A;  2WN9 A;  2QC1 B;  4ZJS A;  2Y54 A;  5KE4 A;  4D01 A;  5HCJ A;  4BFQ A;  5AIN A;  2LLY A;  3TLT A;  4IL9 A;  3IGQ A;  3WIP A;  4HFE A;  2BYP A;  4ZK1 A;  5TVC A;  5AFK A;  2X00 A;  4ZJT A;  3SQ9 A;  2XYS A;  4X5T A;  3PEO A;  4QAC A;  5L47 A;  1OED A;  3UU3 A;  3UQ4 A;  2WNJ A;  2C9T A;  5IUX A;  4LML A;  3TLV A;  2XQ4 A;  4ILA A;  4LMK A;  4ILC A;  2BYN A;  3WTM A;  3RIA A;  5AFL A;  5CFB A;  2BG9 A;  1OED C;  2PGZ A;  4DBM A;  5AFH A;  3UU6 A;  4IRE A;  3T4M A;  2BYS A;  4PIR A;  5LG3 A;  4FRR A;  4UM3 A;  2XZ6 A;  2BG9 C;  5J5H A;  2XNV A;  4Z90 A;  2Y58 A;  5FJV A;  5BRX A;  2ZJU A;  2WNL A;  2XQA A;  4QAB A;  4A98 A;  4UXU A;  4ZK4 A;  5AFN A;  5LXB A;  5HEJ A;  2XQ3 A;  4ZRU A;  3ZDH A;  2XZ5 A;  4EZ1 A;  3JAD A;  2BR7 A;  5HEG A;  4UM3 S;  5J5I A;  2M6B A;  3EAM A;  4TWH A;  4TNV A;  2XQ7 A;  4IL4 A;  4XHE A;  4WV9 A;  3EHZ A; 
#chains in the Genus database with same CATH topology
 4BJM A;  3TLU A;  3Q5W A;  2FJD A;  3ZJ2 A;  1U5P A;  2QVA A;  4X1K E;  2H89 A;  5AFU L;  5CJ5 A;  3OJA A;  3V5U A;  2X9W A;  1G8X A;  1KFY A;  3UTK A;  4UVA B;  2CXF A;  2HN2 A;  3LK2 B;  1US7 B;  2LSJ A;  2WS3 A;  4DV0 T;  3ZC1 A;  4DR5 T;  4GIW A;  3FXD B;  3LSV A;  3PUG A;  4B5D A;  3Q5E A;  2XQ9 A;  4NXN T;  4YTN A;  1ZOY A;  2ES0 A;  4OYJ A;  4X1I E;  4TN7 B;  5KE4 A;  2W62 A;  4ZOL E;  3PJA J;  2N2N A;  5FKY A;  4F6R C;  2BYP A;  2WP9 A;  2NTY A;  4K0U A;  3ZYM A;  5IUX A;  1D0X A;  3RRC A;  3RRW A;  4O4J E;  2LSK A;  3WI3 A;  1XNQ T;  3F2E A;  5J5H A;  5CGM A;  3I0Q A;  3MA9 A;  4JI3 T;  4ZK4 A;  2IC9 A;  4DUZ T;  4KX6 A;  4I4T E;  4FJO A;  2CLY B;  5HEG A;  4KMC A;  2WU2 A;  4TNV A;  4HEA A;  2VL8 A;  3AAI A;  2LEH A;  2C0S A;  4AIU A;  5LYJ E;  5KZU A;  2XAQ B;  4ZI2 C;  4LFA T;  3L09 A;  1M62 A;  3AEE A;  4B3M T;  5HXS A;  2BKN A;  4EZ4 A;  3KV6 A;  3N2K E;  5A1L A;  3J7Y q;  4QXH B;  2E5V A;  5LG4 A;  2LKG A;  5J5F A;  2UUB T;  3ZPO A;  4UVC B;  2JIW A;  2JJ9 A;  2DI4 A;  3MKD A;  4X64 T;  3UUM A;  3EDV A;  3H37 A;  5AQQ B;  2VQF T;  2VL0 A;  4EEB A;  3N5L A;  1NAF A;  5J2U E;  4QXC B;  3SQ6 A;  2UXB T;  4WNK A;  1HCI A;  5H6R B;  1KNR A;  3WTI A;  2L3L A;  3U78 A;  3VKG A;  5EK2 A;  1ZP0 A;  3ZKR A;  4AKH A;  1KNP A;  2CHO A;  3ETU A;  1I9B A;  3P4P A;  4WBN E;  2WDQ A;  5AQF B;  4DV7 T;  4PJJ A;  3ZDG A;  1G73 A;  5DAB A;  4ZI2 D;  4U74 A;  3ZCJ A;  3IHR A;  4DR3 T;  3ONL C;  2DWK A;  3KV9 A;  3H3A A;  1L0V A;  2X9Y A;  3ZMT B;  2BYN A;  5AFL A;  2FJE A;  5KMG P;  3ZCI A;  2DHR A;  3ZLI A;  4DBR A;  4FRR A;  2BG9 C;  4YJ3 E;  5LJN A;  4YFS A;  2WWV A;  2ZJU A;  4I0U A;  3FZM B;  5HEJ A;  2JQK A;  4XAX B;  4AKR B;  3BQI A;  3OPC A;  3PUR A;  3AE5 A;  3EHZ A;  3RF1 A;  2C5I T;  3JAF A;  3MZK B;  3PUX F;  3B13 A;  4BJN A;  4ZS3 A;  4WBO A;  4YTM A;  5FMN A;  2BG9 E;  3N9L A;  3AA0 B;  1GQE A;  4U31 A;  5LXT E;  4QAA A;  2CXL A;  2D5U A;  4IDP A;  3NBX X;  2V5D A;  2F4V T;  2GK9 A;  1XDP A;  2A3D A;  2UU9 T;  4EYY R;  5DQV A;  2J62 A;  3L3P A;  3I0O A;  5JR9 C;  2Z6E A;  4QH5 A;  1LKX A;  4H63 H;  4NUU A;  3IF8 B;  4JEH B;  4U2Y A;  1KNZ A;  2XM1 A;  4CI2 B;  4LF5 T;  4HFH A;  3U8N A;  1HTJ F;  5ABF A;  3CX7 B;  4EIW A;  2WZY A;  1JNZ A;  2KSR A;  1WYC A;  1BR2 A;  2QC1 B;  2QA7 A;  4D01 A;  4CXW A;  2E8I A;  5LOV E;  3ZT5 A;  1HR0 T;  2H7O A;  3CPZ A;  2KIN B;  2W00 A;  4OHF A;  3UQ4 A;  2BKO A;  2K24 A;  4ILA A;  4LMK A;  3RGL A;  3O9X A;  1X79 A;  5ETW A;  3ZN1 B;  2WCA A;  4Z90 A;  2R6G F;  4P0B A;  4HWI B;  3KDS E;  4EZ1 A;  3JAD A;  4FI5 A;  1LVK A;  4B3R T;  1IJ6 A;  1YQ3 A;  2ODU A;  2LHN A;  4QX8 B;  1SA0 E;  3RYF E;  3JCF A;  2BS2 A;  3K3O A;  1D0Z A;  4TNW A;  2BS3 A;  3GUA A;  5AFM A;  2YME A;  4H9S E;  3OBV E;  3KFW X;  4AFT A;  3M3Z B;  3L8R A;  4TV9 E;  2XAS B;  1UX4 A;  4ALX A;  2NWB A;  3AED A;  3RI5 A;  4PFO A;  1D0Y A;  2BG9 B;  1E1H B;  3AB3 B;  4AKL A;  1I94 T;  4TWD A;  4NIQ A;  2YOE A;  1T98 A;  4ZI3 C;  2IUB A;  3VRA A;  2IAK A;  3D0T A;  3WAJ A;  5IYZ E;  2ZLY A;  3WTN A;  5JRE A;  3Q5D A;  4H9P C;  2A9U A;  4O4L E;  4JYA T;  2KLQ A;  4CZZ B;  2JQ9 A;  4YY3 T;  4B6X A;  3K1S A;  4O2A E;  4P1N A;  3ZST A;  3UT5 E;  1ZV4 X;  4ZJS A;  2Y54 A;  3FXE B;  3KVA A;  4MBQ A;  3P7I A;  4L0R A;  2WDR A;  2K48 A;  3PUZ F;  4ZK1 A;  1MNE A;  3P4Q A;  5JR9 B;  3HI2 A;  4DR6 T;  2MYS A;  2QGS A;  4HWH A;  3W15 B;  4HGA A;  3SOL A;  3IEE A;  4HN9 A;  2KWI B;  4H9Q C;  4ZI3 D;  4HWF A;  2CRB A;  5CB4 E;  2V8S V;  2CBJ A;  4X65 T;  5JDG A;  5AQM B;  3CML A;  2BDE A;  2XQ6 A;  2YKS A;  3EVY A;  4ZZB A;  5SYO A;  3ANW A;  1Y01 A;  4J2C A;  4TWF A;  2VK9 A;  5FXV A;  3OYZ A;  1D1A A;  4JI5 T;  2ZM8 A;  2N1G A;  3PE0 A;  2A2F X;  3ZEF B;  4ZHQ E;  4JBW F;  1WYB A;  3ZMZ B;  1N33 T;  2VVS A;  4UY2 A;  2ZJV A;  1IBM T;  3P4W A;  4IST A;  3WTH A;  2W67 A;  3BK9 A;  4EGW A;  1XMQ T;  2B1E A;  4LF6 T;  4LF8 T;  1FMV A;  2WZI A;  4LF7 T;  2EHO C;  2JMK A;  2NW7 A;  3PUA A;  2FJA A;  2XY8 B;  2Q9Q A;  2JRK A;  1T8B A;  1JNR A;  5HWY A;  3KIN B;  3UUX B;  2WM9 A;  3B5M A;  2XAG B;  3UU3 A;  3AA1 B;  5FXX A;  2LT3 A;  3AXJ B;  5LMN T;  4O4H E;  4EYU A;  4PK4 A;  4YT0 A;  5C3J A;  1YXR A;  2V7I A;  3PUS A;  2M6B A;  2XAF B;  4UXN B;  2MPK A;  4QKN A;  3V5S A;  4ZI7 E;  3RLF F;  3UFE A;  2QRX A;  4LF9 T;  1Z0P A;  1M7K A;  3JC6 D;  4DBQ A;  3QNU A;  5AQT B;  2EHO D;  2CM0 A;  5JQG E;  4IDQ A;  2CEA A;  1J5W A;  4DV1 T;  3I9W A;  3C51 A;  5FNV E;  3VU7 H;  3JAE A;  1J1J A;  4Z91 A;  1E2A A;  2VQE T;  1UX2 A;  4F8H A;  2X00 D;  1D1C A;  2X9H A;  4EZH A;  2DCF A;  4CI1 B;  4TX5 A;  5CA0 E;  5FYM A;  3N9N A;  4UR9 A;  2HPL A;  2RA1 A;  1UV6 A;  3ZMS B;  1NEK A;  1HX8 A;  3QOF A;  4I50 E;  2YMD A;  4E7S A;  3LFM A;  3SRZ A;  4ZZC A;  3ZMU B;  2LLY A;  3IGQ A;  4G2A A;  2N9D A;  5AQI B;  2KXP B;  3AEA A;  2XYS A;  3PUQ A;  5FY0 A;  2DL1 A;  2J47 A;  2MTQ A;  3RIA A;  1OED C;  2SPC A;  5AFH A;  1MIW A;  3RIU C;  2XQA A;  4QAB A;  1ZKE A;  4MHC A;  5J5I A;  4ASK A;  5L2L A;  2JMH A;  2VKJ A;  5M4Y A;  4H63 V;  2EHO B;  5KDM C;  3HA4 A;  3N2G E;  1WLX A;  1D1B A;  3CX8 B;  3HKC E;  1OED E;  1YW0 A;  3FZF B;  4P09 A;  4U2Z A;  2WNC A;  2V7K A;  2Y48 B;  5F5W A;  3KV5 A;  4ADZ A;  2LE8 A;  2CBI A;  4KHP T;  3AEB A;  4JI7 T;  3U8K A;  5J5G A;  5BMV E;  2LOP A;  5LJM A;  4DVD A;  1HS7 A;  3UU4 A;  2EHO A;  3AAA B;  5HXC A;  2Y56 A;  4IE7 A;  2BKP A;  2IHR 1;  4QH1 A;  3OTO T;  2ZM2 A;  3WTJ A;  2V6Y B;  5AQS B;  4X20 E;  2BVL A;  4V1A v;  3ESL A;  2YK0 A;  5LHI B;  3WTO A;  1BR0 A;  4ANJ A;  4IL9 A;  3O4X E;  3AE3 A;  4C91 A;  2ODV A;  2NOX A;  2VVN A;  2KMF A;  4AIS A;  4LFB T;  5BR8 T;  5AFK A;  2WWU A;  4QAC A;  3PJA A;  3ZMV B;  2LSY A;  3O1H A;  5AQL B;  1R8I A;  1NEN A;  3R6N A;  5KX5 E;  1WRD A;  2PGZ A;  4H9O C;  4BAY B;  3RKO A;  1LVF A;  2WY2 A;  4UIG A;  4TZ4 C;  5H6Q B;  3C64 A;  2YDR A;  3DJB A;  4MAL A;  2WNL A;  4HKA A;  2X67 A;  1WR0 A;  4HWC A;  2D2S A;  1S94 A;  2K9A A;  4TWH A;  3KV4 A;  5J1G A;  3NWI A;  4JLE A;  5LMU T;  5CO5 A;  2BR8 A;  2CPT A;  3MK7 C;  5ABG A;  5GON E;  4KP3 C;  3O1J A;  2J4G A;  2IDO B;  2WQY A;  3C4X A;  3G06 A;  5F8P A;  4YSX A;  4YHH T;  5FVK A;  3GN5 B;  1OED B;  3ETV A;  4YJ2 E;  4C90 A;  4AKI A;  5FL0 A;  4UVB B;  1HNW T;  1HG2 A;  2KWH A;  3C4W A;  3N9M A;  2W8F A;  5LB7 B;  1B7T A;  2MOZ A;  2E9X C;  1VCS A;  2M67 A;  2BYR A;  3C50 A;  5HCM A;  3QUJ A;  4HFB A;  3T1Y T;  1VRB A;  4QX7 B;  4UM3 P;  2W4X A;  1CHU A;  2BS4 A;  4JUY A;  4AKG A;  3K3N A;  1MIV A;  4A97 A;  4ZEY A;  4JV5 T;  2C5K T;  5HEH A;  4LFC T;  3H3M A;  5JVD E;  5AQO B;  1NWM X;  2LM2 A;  4NXM T;  5JDH A;  2V1D B;  5HCJ A;  4IDZ A;  3BQL A;  2W0G A;  2YU1 A;  4HFE A;  2G0U A;  4X5T A;  3PEO A;  5HXE A;  3RPU A;  4O2B E;  4YSY A;  3T4M A;  2BYS A;  1VCT A;  5LG3 A;  4UM3 A;  3DP7 A;  1HFA A;  3P4R A;  2Y58 A;  4CN1 A;  5FJV A;  3EDU A;  5AQG B;  4YTP A;  1UUR A;  1IBK T;  2BR7 A;  2E9X D;  3CQG B;  3QC9 A;  2ZM6 T;  4X62 T;  2Y6X A;  4AFG A;  5LP6 E;  4GKJ T;  3CQC B;  4U7I A;  5EK3 A;  5LCY A;  1SE7 A;  5LGT B;  2WSS V;  4PFP A;  2YN6 A;  2PH9 A;  5TAO A;  5FY1 A;  3K8P C;  5HEU A;  3ZT7 A;  2DLR A;  2ZM0 A;  5JH7 E;  2XNT A;  1IZN B;  4EED A;  4G63 A;  5LNK A;  2UXC T;  2XHE B;  5AQV B;  4EB6 E;  4UV8 B;  3FBZ A;  3FB2 A;  3LG7 A;  5EZY E;  4OFZ A;  2UXD T;  2L8K A;  4CN4 A;  4XK9 A;  3ZYK A;  4NZB A;  2CWY A;  5L3E B;  2CCQ A;  1W9R A;  5ABH A;  4BFQ A;  2XJ7 A;  3RKG A;  2YDS A;  4CN6 A;  4IDO A;  3RC3 A;  5JDM A;  2WNJ A;  3SFE A;  2LSI A;  4LML A;  4IE5 A;  1IJ5 A;  2PJQ A;  2BG9 A;  3ONX A;  5L3F B;  4UEM A;  2E9X B;  5HXR A;  1OWA A;  3T1H T;  2NTX A;  1BR4 A;  3E22 E;  4ZRU A;  4IE4 A;  3AEC A;  1LRZ A;  2BVM A;  4QXB B;  4M1P A;  4AQF C;  3RHW A;  4H9N C;  3WTK A;  2IIU A;  5AQK B;  1N36 T;  4Z8X A;  3B57 A;  4EV6 A;  1IAP A;  3RQW A;  2YDQ A;  1UUS A;  2FJB A;  4UF0 B;  3EUH A;  3X1D A;  4YLH A;  5BP0 A;  5JDN A;  1BR1 A;  4I43 B;  2CMR A;  3NRY A;  5JR9 A;  1KF6 A;  5LHH B;  1YKH B;  4H9R C;  5AQN B;  5KXJ A;  3U8J A;  1FEW A;  2W8G A;  2NW8 A;  5JRC B;  3CK6 A;  2L9Q A;  3LBX B;  2JPF A;  5L3G B;  1WR6 A;  4LF4 T;  3CWZ B;  2JQH A;  3ZYL A;  3O1I A;  2PFV A;  4AQG A;  1XWM A;  5FVL A;  2HH7 A;  4AI6 A;  4KHZ F;  5CA1 E;  1MMD A;  3HKB E;  3TLT A;  1H7C A;  2NP9 A;  3ZN0 B;  3C4Z A;  5JRC A;  2BBH A;  2C9T A;  4HE8 A;  2LJL A;  3AA6 B;  4YXD A;  4IRE A;  4HFV A;  1HX1 B;  2JQQ A;  2UXX B;  3LJC A;  1Z8U A;  3AEG A;  2V6X A;  2X66 A;  2LSG A;  3EAM A;  4YHJ A;  2WBL A;  4MFR A;  4E7Z A;  2XZE A;  2ACX A;  2Y7Y A;  5LGU B;  2XQ8 A;  3AE6 A;  2LOS A;  1T7S A;  1FJG T;  5LA6 E;  2J1D G;  1HG5 A;  2CA5 A;  1UK5 A;  3CVR A;  3SIO A;  2H3R A;  3MAC A;  3WAK A;  3AXJ A;  3EAB A;  4PJL A;  4LMJ A;  4GYS A;  4CI3 B;  3U8M A;  2NR4 A;  1KK7 A;  2CHN A;  2W66 A;  3WTL A;  4Q25 A;  4DV6 T;  4JI6 T;  5LGN B;  2NW9 A;  2IC6 A;  4CQI A;  2I0M A;  5AIN A;  4WW0 A;  4UV9 B;  3RC8 A;  4PK5 A;  3DTO A;  5TVC A;  5AQJ B;  3SQ9 A;  5AQR B;  2D9D A;  2DNX A;  5AQH B;  2IW5 B;  3NVO A;  4PIR A;  2UXN B;  2X0H A;  2XSA A;  2XZ6 A;  3CIR A;  3UUN A;  5BRX A;  5LXB A;  3HKE E;  2XZ5 A;  4KUM B;  5L3C B;  3NRX A;  2XNU A;  3T8O A;  4HQP A;  3OVU A;  4PJN A;  5FP3 A;  1HF8 A;  4DR7 T;  4JI1 T;  1MIY A;  5ABE A;  3ZT6 A;  5FY7 A;  3NZQ A;  1Y64 B;  4WZX A;  3I1A A;  2K3W A;  4ZXL A;  2W2U A;  4UEL A;  2QYW A;  3N9Q A;  4EAH A;  3RH3 A;  4GKK T;  3UU8 A;  5LHG B;  2PG8 A;  3UU5 A;  1VOM A;  4AFH A;  3UUB A;  2X68 A;  5L4H A;  1XDO A;  5ADX L;  3P50 A;  4UM1 A;  2XQ5 A;  3M65 A;  4ILU A;  2E2A A;  3TKL B;  1SUM B;  3GA8 A;  1J5E T;  3AE7 A;  4IT4 A;  1FIO A;  2X00 A;  3P4S A;  4TV8 E;  4XZC A;  3CKD A;  1O3X A;  4N78 D;  2XQ4 A;  5L3B B;  2HN1 A;  3UU6 A;  3Q5X A;  2W61 A;  3RYH E;  2H88 A;  4DR2 T;  5IHY A;  4A98 A;  1E7P A;  3PU3 A;  2B76 A;  4DV2 T;  2D0T A;  2V6Y A;  3OKQ A;  3PUY F;  1W0B A;  1W09 A;  3E0Z A;  2YIN A;  2XAH B;  3UUL A;  3C84 A;  1UW6 A;  1EZ3 A;  2HHH T;  1T72 A;  4IIJ E;  2LRL A;  3PUW F;  2CXD A;  2D0U A;  2V7J A;  3LK3 B;  3IA3 A;  1U4Q A;  2I6H A;  1UX5 A;  5JME A;  3IBP A;  2XYT A;  2LKH A;  4COF A;  2E5L T;  4AQY T;  2VWA A;  5E0O A;  2UUA T;  1MMN A;  3MXZ A;  4ILB A;  5C8Y E;  3SWH A;  2MAW A;  4ERR A;  3AE8 A;  2AE9 A;  3VHL A;  3ONJ A;  3CQX C;  3AEF A;  3VKH A;  1I6Z A;  3VR9 A;  5FXZ A;  2MBG A;  2PBI A;  1SHZ C;  3VRB A;  2WU5 A;  5FXW A;  1N32 T;  3J9X 1;  3AAE B;  3Q2M A;  3LDQ B;  3RYI E;  3RX6 A;  4NUV A;  1UGO A;  3GWH A;  4P0A A;  3CX6 B;  3GN5 A;  5L47 A;  1OED A;  2XUE A;  3RIU A;  1YKE B;  4DBM A;  3AE9 A;  1X9B A;  2DWG A;  4PNI A;  2WZH A;  3LK4 2;  3VR8 A;  3A8Y C;  2XM2 A;  2OV9 A;  4EOZ B;  4EXT A;  2OLT A;  4CXY A;  4IDN A;  1QUU A;  2XQ7 A;  4PJM A;  4WV9 A;  5ABF B;  3QK6 A;  2UZ6 A;  2A72 A;  2IML A;  2W63 A;  4CXX A;  5F3J A;  3GMI A;  4DO0 A;  4B3T T;  3AVR A;  2BZB A;  2X51 A;  3ABV A;  1MMG A;  4IGU A;  4XBF B;  2LRK A;  3SH1 A;  5DQW A;  5J0Z A;  2WAU A;  3QB5 A;  3I9Y A;  2LM9 A;  2YEV C;  2XPK A;  3TLW A;  4ZS2 A;  1UCU A;  1HNX T;  5HWX A;  2Y8D A;  3N9P A;  3R84 B;  1WCR A;  4ZR6 A;  3PDY A;  3MJX A;  3UQ7 A;  2PTF A;  4WYV A;  3RQU A;  4JI2 T;  3EI0 A;  4U33 A;  5HAX A;  4DND A;  4OK0 A;  3C98 B;  5LBQ B;  5AFM B;  3TLS A;  4OX9 T;  4HFC A;  3AA7 B;  4OYK A;  2WMN A;  4L9I A;  4A56 A;  2YU2 A;  4BA9 A;  1N34 T;  4YSZ A;  2Q9Q C;  4ZJT A;  5C2T A;  1W0A A;  2CE7 A;  5HXH A;  1KEY A;  3WTM A;  5CFB A;  2ACZ A;  4GK0 E;  5DJQ C;  5EK4 A;  2X9X A;  3L39 A;  4PK6 A;  4U7Y A;  1CUN A;  1ZEE A;  4GYR A;  5HYA A;  3FZH B;  4UXU A;  1YQ4 A;  4L5G A;  4X1Y E;  2XTL A;  2KND A;  2AXD S;  5AQU B;  2OA5 A;  5FL1 A;  5AFJ A;  5JDF A;  2XQY A;  2VUR A;  5L3D B;  4DV5 T;  1MND A;  3BQK A;  4JEU B;  1IBL T;  2P9B A;  1WFD A;  2Q9Q D;  2CWO A;  2V26 A;  3Q9D A;  2K5B B;  3FZL B;  2E9X A;  4DID B;  4A5X A;  2BYQ A;  5J2T E;  1DU2 A;  4DV4 T;  2FUP A;  2X0Y A;  4O8S A;  3F31 A;  3A7M A;  3KBT A;  4DR1 T;  4DMW A;  3S4U A;  3HR0 A;  4DUY T;  2LHR A;  3AE4 A;  3PU8 A;  3U3I A;  2FBW A;  3AE1 A;  4MLK A;  2WN9 A;  1MMA A;  3ANW B;  3FBL A;  4PAG A;  4U72 A;  2ZMA A;  2V7L A;  3HL6 A;  4UF0 A;  4U3C A;  3TLV A;  4ILC A;  5JTG A;  1XNR T;  4O4I E;  5JDL A;  3KBU A;  2WMO A;  3NZP A;  4IE6 A;  2VKD A;  4IE0 A;  4DR4 T;  3LBX A;  2HPJ A;  3K3Q C;  3FZK B;  1HNZ T;  2KZ7 B;  2I59 A;  1QSD A;  2V7M A;  3NKZ A;  2Q9Q B;  3N9O A;  4HFD A;  5BW2 A;  4JI0 T;  4QH4 A;  2WB5 A;  3N2O A;  2X0L B;  3C79 A;  4HTE A;  4GOU A;  3OYX A;  1V9D A;  5IWA T;  5L4E A;  2VKO A;  1ZHC A;  2KT9 A;  3JC6 C;  2XAJ B;  4KBM B;  3ZSS A;  4AXP A;  3E08 A;  1AJ3 A;  3PUV F;  4NPP A;  3P8C D;  1FMW A;  3SFD A;  2BJ0 A;  3ZJ1 A;  2WDV A;  3U8L A;  4BQT A;  3FHN A;  4ISS A;  4QWN B;  4DV3 T;  2VB6 A;  3QB5 K;  1QLB A;  2M6I A;  1S35 A;  3RIF A;  4HFI A;  5AQP B;  4I55 E;  3PMZ A;  4B3S T;  5HEO A;  5LBM A;  2BBJ A;  2VKH A;  2CLY C;  3SS1 A;  4DMV A;  4PW8 A;  2Y57 A;  4HWD A;  2VAS A;  4K0K T;  2XSB A;  2H7V C;  3A5X A;  4X66 T;  1XMO T;  3WIP A;  3PV0 F;  4QHO A;  3KVB A;  5JDQ A;  4GK5 E;  3AE2 A;  2C5J A;  3AVS A;  4KI0 F;  4JI8 T;  3F57 A;  3UFG A;  2XNV A;  1OXZ A;  1YD8 G;  2UUC T;  5AFN A;  3PTR B;  3ZDH A;  2RP4 A;  2XQ3 A;  3ZC0 A;  4UM3 S;  2V5C A;  4AQF A;  3HKD E;  4JI4 T;  2RPA A;  4IL4 A;  4XHE A;  1XZY A;  3RYC E;  4IHJ E;  4TUY E; 
#chains in the Genus database with same CATH homology
 4AFG A;  2Y7Y A;  3JAF A;  4TNW A;  2XNU A;  5CO5 A;  3TLU A;  2BR8 A;  2UZ6 A;  2XQ6 A;  3RHW A;  2YKS A;  4HQP A;  3GUA A;  3WTK A;  5AFM A;  3C84 A;  4ZZB A;  1OED E;  2XQ8 A;  1UW6 A;  5AFJ A;  5KZU A;  5SYO A;  2YME A;  2WNC A;  4HFD A;  5BW2 A;  4AFT A;  2BG9 E;  3RQW A;  4QAA A;  4QH4 A;  3SH1 A;  4TWF A;  3C79 A;  3U8K A;  2YN6 A;  1OED B;  4ALX A;  5J5G A;  5JME A;  3RI5 A;  5J0Z A;  2PH9 A;  2XYT A;  2LKG A;  5BP0 A;  2LKH A;  5J5F A;  4COF A;  5HEU A;  2BG9 B;  3UU4 A;  3JAE A;  5L4E A;  3SIO A;  4TWD A;  4Z91 A;  3TLW A;  1UX2 A;  2YOE A;  4F8H A;  2W8F A;  4NPP A;  3UU8 A;  2Y56 A;  2X00 D;  4ILB A;  2BJ0 A;  3U8J A;  3WTN A;  2MAW A;  4QH5 A;  2XNT A;  3UU5 A;  2VL0 A;  3U8L A;  4BQT A;  4LMJ A;  2BYQ A;  2W8G A;  4ZR6 A;  4QH1 A;  3SQ6 A;  4UY2 A;  2BYR A;  3UQ7 A;  4AFH A;  3UUB A;  3RQU A;  2ZJV A;  3P4W A;  3EI0 A;  5HCM A;  2M6I A;  1UV6 A;  3WTH A;  3RIF A;  5L4H A;  3WTJ A;  4HFB A;  3WTI A;  4HFI A;  3LSV A;  3PMZ A;  4UM3 P;  3U8M A;  5HEO A;  3WTL A;  4HFH A;  4A97 A;  3P50 A;  2YMD A;  4UM1 A;  3U8N A;  5AFM B;  5HEH A;  3TLS A;  3ZKR A;  4B5D A;  4XK9 A;  4NZB A;  2XQ9 A;  4HFC A;  2Y57 A;  2WZY A;  2XQ5 A;  1I9B A;  3WTO A;  2KSR A;  2LM2 A;  4ZZC A;  3ZDG A;  2WN9 A;  2QC1 B;  4ZJS A;  2Y54 A;  5KE4 A;  4D01 A;  5HCJ A;  4BFQ A;  5AIN A;  2LLY A;  3TLT A;  4IL9 A;  3IGQ A;  3WIP A;  4HFE A;  2BYP A;  4ZK1 A;  5TVC A;  5AFK A;  2X00 A;  4ZJT A;  3SQ9 A;  2XYS A;  4X5T A;  3PEO A;  4QAC A;  5L47 A;  1OED A;  3UU3 A;  3UQ4 A;  2WNJ A;  2C9T A;  5IUX A;  4LML A;  3TLV A;  2XQ4 A;  4ILA A;  4LMK A;  4ILC A;  2BYN A;  3WTM A;  3RIA A;  5AFL A;  5CFB A;  2BG9 A;  1OED C;  2PGZ A;  4DBM A;  5AFH A;  3UU6 A;  4IRE A;  3T4M A;  2BYS A;  4PIR A;  5LG3 A;  4FRR A;  4UM3 A;  2XZ6 A;  2BG9 C;  5J5H A;  2XNV A;  4Z90 A;  2Y58 A;  5FJV A;  5BRX A;  2ZJU A;  2WNL A;  2XQA A;  4QAB A;  4A98 A;  4UXU A;  4ZK4 A;  5AFN A;  5LXB A;  5HEJ A;  2XQ3 A;  4ZRU A;  3ZDH A;  2XZ5 A;  4EZ1 A;  3JAD A;  2BR7 A;  5HEG A;  4UM3 S;  5J5I A;  2M6B A;  3EAM A;  4TWH A;  4TNV A;  2XQ7 A;  4IL4 A;  4XHE A;  4WV9 A;  3EHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...