3P50A

Structure of propofol bound to a pentameric ligand-gated ion channel, glic
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of general anaesthetics bound to a pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3p50A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3p50A01
4ZK1A 4TWHA 3WTOA 4QH4A 3U8NA 2W8GA 4COFA 4ALXA 4ZZBA 4ZR6A 3SQ6A 2XQ5A 3U8KA 3TLVA 4ILAA 5BP0A 4Z91A 4NZBA 3WTKA 3SIOA 4TWFA 4AFGA 4D01A 3P4WA 2WNJA 5HEJA 2ZJVA 2LLYA 4ZRUA 3WTMA 4TNVA 4X5TA 5J5GA 3TLUA 4HQPA 5L4HA 4TWDA 5KZUA 2YN6A 4PIRA 4NPPA 3RIFA 2BYRA 3SH1A 3JAEA 5HCMA 4B5DA 4LMJA 5JMEA 2PH9A 3IGQA 5L4EA 4ILBA 2BYPA 2LKGA 3LSVA 3UQ7A 4QH5A 4DBMA 3UU8A 4ILCA 3EAMA 3JAFA 3RI5A 4A98A 2VL0A 2WNCA 4AFTA 2BJ0A 2BYSA 4IL9A 5J5FA 3JADA 2WNLA 3WTJA 5HEHA 1UV6A 3TLSA 3RIAA 4LMLA 4HFIA 3ZKRA 2XZ6A 3U8MA 3SQ9A 4EZ1A 2Y7YA 4F8HA 5CFBA 3TLWA 3TLTA 2XYSA 3UU3A 5J5HA 5HCJA 2WN9A 2XNUA 5BW2A 5LG3A 1I9BA 4XK9A 3ZDGA 5AFMA 4QACA 4UM1A 3WTLA 5HEUA 2BYNA 3C84A 3WTNA 3UU4A 4UY2A 4LMKA 1UW6A 2BR8A 4HFEA 5AFMB 4UXUA 3UU5A 5HEGA 5KE4A 4IL4A 2XYTA 2LKHA 2XQ8A 2C9TA 1OEDE 3T4MA 5AINA 2KSRA 5AFJA 2XQAA 2YOEA 2BYQA 2QC1B 2XNTA 4ZJTA 4A97A 5AFHA 4QABA 3WIPA 4BFQA 2LM2A 3EI0A 2BG9B 2XZ5A 3GUAA 3UQ4A 4HFHA 5AFNA 2YMDA 4HFBA 4HFDA 1OEDB 4Z90A 5CO5A 2M6BA 3U8JA 2XQ3A 4XHEA 2XQ9A 3UUBA 4ZZCA 4ZJSA 3PMZA 2MAWA 2XQ6A 2XQ4A 3WTIA 3RQUA 2Y58A 5FJVA 4UM3P 5LXBA 4TNWA 2BG9E 2X00D 2XQ7A 2W8FA 2PGZA 3P50A 3RQWA 1UX2A 4QAAA 4UM3A 2BG9A 5AFKA 2X00A 5TVCA 4WV9A 4AFHA 2UZ6A 3PEOA 3WTHA 3EHZA 4QH1A 2M6IA 5J0ZA 3U8LA 2BR7A 5SYOA 2Y56A 5BRXA 2WZYA 2YMEA 5J5IA 4BQTA 1OEDC 2XNVA 4ZK4A 2Y54A 4UM3S 3ZDHA 2Y57A 2BG9C 3C79A 4HFCA 5HEOA 5L47A 2ZJUA 5AFLA 2YKSA 4FRRA 3UU6A 1OEDA 4IREA 5IUXA 3RHWA
chains in the Genus database with same CATH superfamily
1LRZA 4YTMA 2XUEA 5EZYE 3T1HT 1VRBA 5ABGA 3T8OA 4Z91A 3AECA 2UXBT 2X51A 3DJBA 3ZCIA 5DQWA 2B1EA 2LLYA 5J5GA 3ESLA 3TLUA 3VHLA 2CRBA 4AKLA 3PUAA 1HX1B 5E0OA 1FEWA 4PIRA 4LF7T 4XZCA 2PG8A 2X0LB 3AVRA 2FJDA 1BR1A 5ADXL 5LMNT 1WYCA 2VL0A 3AEFA 4OYKA 4I4TE 1M62A 2V6YB 4I0UA 1I9BA 3WTLA 5LJMA 3WTNA 4PFPA 4LMKA 1HNWT 4NIQA 2LSGA 2KSRA 2V6YA 5AFJA 1WR0A 4GYRA 3MJXA 3NRXA 4ISSA 4FJOA 4HEAA 3AXJA 3H3AA 4CI2B 3SS1A 2VK9A 4ZJSA 3PMZA 5JDHA 5HWYA 2E9XC 4C91A 4UM3A 2XM2A 1NWMX 3MACA 3C50A 1XNRT 3PUZF 3N9PA 2LOSA 4IE6A 2UXDT 2CM0A 2W2UA 2YKSA 2I6HA 3LDQB 2CCQA 3C51A 3QB5K 4MALA 2IC6A 3ZMTB 4O4HE 5BP0A 4ASKA 2JQKA 3FZLB 3P4WA 3AA7B 2ZJVA 1MNDA 2HH7A 3HR0A 4JI1T 3LK3B 4EEBA 2K5BB 5LHIB 4U7IA 3RX6A 3IHRA 4B3RT 2XPKA 4ILCA 2NW9A 3CWZB 5FXWA 5CB4E 4B3MT 2PBIA 2BJ0A 5HEHA 3RIAA 5AQTB 2XAQB 4YFSA 2IIUA 3TLWA 4V1Av 2XNUA 1IAPA 1N34T 4U7YA 3ZDGA 2WCAA 4M1PA 4XBFB 2I0MA 4YY3T 4DV2T 2JJ9A 4GOUA 1X79A 5CGMA 4UVBB 4DR5T 2WM9A 2HHHT 4CI3B 2OA5A 2ODVA 3IF8B 2V5CA 4YSXA 2EHOB 2PJQA 3GUAA 4X1IE 3K3QC 1QUUA 3AE5A 2LE8A 2E9XD 4IDOA 4AKHA 4LFAT 4IGUA 3E22E 4TV9E 1UX5A 4IHJE 3PEOA 2BR7A 3FZMB 2XAFB 3N9LA 4PK5A 1OEDC 2XNVA 2WAUA 2BS4A 4MBQA 4KHZF 5AFUL 5AFLA 4AXPA 4EXTA 3CK6A 3KINB 3EDUA 3RYCE 1QLBA 4ZZBA 1ZV4X 4D01A 4B3ST 4H9RC 2WNJA 5EK3A 1T8BA 2CXLA 2CPTA 3FB2A 5J1GA 4CN1A 4NPPA 1MIYA 2WBLA 4LMJA 3N9NA 2QYWA 3EVYA 5JDNA 3O1JA 3UT5E 2W62A 5F3JA 4UVAB 4GKKT 2EHOA 4ZS3A 3OJAA 5JTGA 3UFGA 2WQYA 4C90A 4PJNA 2L9QA 1XDOA 2XQYA 3PUYF 2WDVA 2DHRA 3VRAA 3AE3A 4JUYA 2X0YA 1HNXT 2CBIA 3N2OA 2NW7A 2KINB 2QA7A 3PURA 4NXMT 5FY7A 4YXDA 4XHEA 3IA3A 2ZLYA 5FNVE 4A5XA 1LVKA 2IC9A 3E0ZA 4DO0A 4U72A 4QAAA 4GYSA 4JEHB 5AFKA 2ZMAA 1H7CA 1SE7A 3HA4A 5SYOA 2J47A 1V9DA 4BQTA 2Y54A 3CKDA 4X66T 1SA0E 3VRBA 5L47A 2ZJUA 2NTXA 4EV6A 4IREA 3O1IA 4MHCA 2JRKA 4TWHA 2QGSA 3WTOA 4COFA 3ZYMA 2UUBT 3NBXX 3SIOA 5AQUB 5TAOA 4JI8T 2LM9A 2Q9QC 3W15B 4I55E 5JQGE 2M67A 4DV3T 4CXWA 1OXZA 3RIUC 4UV9B 4AFTA 3AXJB 2BYSA 2J4GA 2WP9A 3IBPA 4IE4A 4K0UA 3EABA 4F8HA 2IDOB 3ETUA 2WZHA 5LB7B 4DV1T 5A1LA 3E08A 4UXUA 2XAHB 4CZZB 4LF9T 2WY2A 2J62A 2YOEA 3H3MA 2LSIA 3WIPA 2WZIA 3NZQA 1J5ET 2XZ5A 2CMRA 4HFHA 2VKJA 3C4WA 2A2FX 4WZXA 2FJBA 2OV9A 2DL1A 1N33T 1KF6A 2DCFA 3MZKB 4YJ2E 5HXHA 2E2AA 5J0ZA 5LMUT 3P7IA 2K48A 2YDRA 2HPJA 2ZM6T 3Q9DA 2Y48B 2VKHA 3F57A 4ZXLA 3CPZA 4UF0A 4FRRA 1OEDA 3ZC1A 3U3IA 2WMOA 3U8NA 3HKBE 3TLVA 4ILAA 1XZYA 5BR8T 3WTKA 2VKDA 4X20E 3ZMZB 5HEJA 4OK0A 3RRCA 3UUMA 4TN7B 3J9X1 3JCFA 2E5LT 1VCSA 3M3ZB 3X1DA 5AQJB 2LHNA 3HKEE 5CJ5A 3VR8A 4E7ZA 3C4ZA 4IDNA 2Q9QA 2A3DA 3AA0B 1NEKA 2Y7YA 5CFBA 2X66A 2WWVA 1CUNA 5EK2A 2V7MA 3MA9A 1MNEA 4BJNA 3AEDA 2C9TA 3P8CD 4QABA 5L3CB 3T1YT 3GN5B 4IE7A 4PFOA 4CN6A 3KDSE 2ZM8A 3H37A 3N2KE 2L3LA 2X68A 2D5UA 4ADZA 4UVCB 3J7Yq 1HG2A 3N9QA 2BG9A 3KVAA 2DLRA 4GKJT 1LKXA 3TKLB 2YU2A 1WCRA 3PUXF 3ZDHA 4IDZA 2BG9C 1HFAA 1UX4A 2SPCA 3QK6A 5LYJE 4Z8XA 5IUXA 5C2TA 2LRKA 4U2YA 2YDQA 3U8KA 5FYMA 3ZMUB 1O3XA 3ZJ1A 2E9XA 3LK2B 4JV5T 5KZUA 3SH1A 3U78A 2V7IA 2PH9A 2WS3A 2YU1A 4ILBA 3WTJA 2CLYC 1HCIA 1G73A 1KNPA 5FY1A 4DUZT 5HEUA 3ZPOA 4EYYR 4HFEA 3BK9A 3UTKA 4EYUA 2HN2A 4G2AA 2BYQA 2BKOA 3P4PA 3VR9A 2D2SA 4HFDA 4HGAA 1UGOA 1HNZT 2XQ9A 2XQ6A 2XQ4A 5KX5E 3WTIA 1L0VA 5JREA 4TNWA 4X62T 3KBUA 3AB3B 4DIDB 2W0GA 3QNUA 2M6IA 1S35A 1IJ6A 5LBMA 2W4XA 2WZYA 3ANWA 4YJ3E 1S94A 3LBXA 3KV9A 4HFCA 2VQET 5L3EB 2IMLA 2CHNA 3RHWA 2Z6EA 1VOMA 5JR9B 2W8GA 4ZR6A 2BBJA 2X9YA 4OHFA 2A72A 4PW8A 4QXCB 4TWDA 1E2AA 2BYRA 2Y6XA 2K3WA 3LK42 4DR6T 3C64A 2BS3A 2KZ7B 4JYAT 2FJAA 3UUXB 3RGLA 2WNCA 2J1DG 5J5FA 4AISA 2WNLA 3VKHA 4PK4A 4LMLA 3U8MA 3SQ9A 5J5HA 2BVMA 1ZHCA 2V7LA 5BW2A 3L09A 3AEGA 5AFMB 4QX8B 1D0XA 3T4MA 5AQQB 4H63H 3SFDA 2VB6A 2ZM2A 2L8KA 3ZEFB 5JRCB 2ODUA 4LFBT 4O4IE 2MTQA 2XQ3A 4G63A 3UUNA 2MBGA 3RQUA 4QXHB 4OYJA 2LJLA 5IYZE 3AE6A 3CQXC 4AQFC 2V26A 4WNKA 1IBLT 5L3BB 4YTNA 5AQNB 1G8XA 5JVDE 4JI0T 5JR9C 3ONLC 4TUYE 2NR4A 3OYXA 1IJ5A 3A5XA 2XTLA 3AE4A 4UELA 5AQLB 1HTJF 1N32T 3FXEB 4ZI2D 3K3NA 2KWHA 2VASA 2UXXB 4UV8B 1LVFA 2CWOA 3EUHA 4WBNE 3JAEA 4B5DA 4LF8T 2ACZA 4WYVA 4EB6E 2VVNA 5FKYA 5ETWA 5ABEA 3O9XA 5FXZA 3OPCA 2A9UA 4A56A 5HWXA 2RPAA 1Y64B 4P1NA 5JDGA 5KE4A 2XYTA 3HL6A 1D0ZA 2FUPA 1OEDE 3SWHA 2H3RA 2C5KT 5AQOB 4KP3C 2Q9QB 1JNZA 2CLYB 3UQ4A 1UUSA 2UU9T 3ZT5A 5F5WA 4U74A 2KLQA 3MXZA 5LHGB 4I50E 5L3FB 3PUWF 3PUSA 3NKZA 3FZFB 3KV4A 4WV9A 4LF6T 4ZI3D 3VU7H 2K24A 3MKDA 5BRXA 4F6RC 3WAKA 4L9IA 3I9WA 2H89A 3CIRA 5C3JA 3UU6A 3WAJA 2W61A 4UF0B 2KWIB 5L2LA 3ZSTA 2WB5A 1WFDA 4GK5E 2B76A 3PTRB 3ZYLA 4AFGA 5LHHB 1I6ZA 2KNDA 5JDFA 2V8SV 2RA1A 4X1YE 5DJQC 4IT4A 5J2UE 2BZBA 4YTPA 2X9HA 4CXXA 4KX6A 3Q5DA 1IZNB 2LSYA 5L4EA 2BVLA 3LSVA 3PUGA 4QH5A 1D0YA 4CXYA 5HXSA 4IL9A 2F4VT 3ZLIA 3TLSA 1XNQT 2JPFA 1X9BA 3UU3A 4QACA 2DWKA 4DVDA 4CI1B 2BR8A 4IE5A 3UU5A 5AQHB 4IL4A 4PJJA 3AE7A 3OKQA 5HXRA 4P09A 2XM1A 1ZP0A 3LG7A 1E7PA 2KMFA 3ZYKA 2UUAT 4YLHA 4AQFA 4U33A 4H9SE 2MOZA 4IE0A 3QB5A 1UX2A 3K1SA 3AAIA 5TVCA 3KFWX 2PFVA 5FP3A 1FJGT 2YMEA 4KI0F 3C79A 2CEAA 4CN4A 3HKCE 3RYHE 4WW0A 2NWBA 2BKNA 2JQQA 2W00A 2JIWA 2MYSA 2AXDS 4NUVA 1HX8A 3PE0A 4OX9T 3EDVA 3RYIE 4AQYT 2WSSV 4AQGA 2BYPA 4AIUA 3FXDB 4BJMA 5JDQA 3JAFA 4A98A 2K9AA 4EAHA 4QXBB 2UUCT 4U31A 1WYBA 3AE1A 2LOPA 4ZHQE 4K0KT 4AKRB 3Q5EA 2BYNA 3C84A 2RP4A 4ZI3C 3UU4A 3ZN1B 4TZ4C 2IHR1 1E1HB 4JBWF 3ONJA 2KXPB 2YDSA 5AQVB 3F2EA 4QX7B 3ZT7A 5AINA 3GA8A 2LM2A 3V5SA 5HAXA 2XAGB 4DV6T 1HF8A 2UXNB 2YMDA 4QWNB 2N1GA 4JI4T 2M6BA 3C4XA 3I0QA 2DWGA 5FJVA 2VURA 3AEEA 2XQ7A 1GQEA 3R6NA 4DV0T 4L5GA 3CVRA 2UZ6A 5LGNB 2Y56A 5J5IA 3AAAB 1BR0A 3I1AA 2LHRA 2NOXA 3RPUA 3O1HA 3BQIA 4PK6A 3K8PC 2WU2A 1WLXA 5HXCA 2X67A 3ZJ2A 4UXNB 1ZEEA 4FI5A 4DV4T 4DNDA 1N36T 5IHYA 5L4HA 2YN6A 1D1AA 3VKGA 5HCMA 3IGQA 4X1KE 1FIOA 1W9RA 3JC6D 5JRCA 2WU5A 1UK5A 4ILUA 1UV6A 4DV7T 2UXCT 2D0UA 3V5UA 3ZKRA 4GIWA 5M4YA 4ANJA 2R6GF 5AFMA 4UM1A 1B7TA 3ZT6A 4DBQA 3CMLA 5ABFA 3SOLA 1NENA 2PTFA 3CX6B 4U3CA 1KK7A 2XQAA 4QHOA 3EI0A 1HR0T 3L39A 3PU3A 3HI2A 4HE8A 4ZOLE 3P4QA 3PUVF 1OWAA 1IBMT 3R84B 4HTEA 4U2ZA 4B3TT 4ZI2C 4UM3P 2W8FA 3KBTA 3OBVE 2ZM0A 1YW0A 3AE8A 3AE2A 4NXNT 2CHOA 3WTHA 3U8LA 2CXFA 2W67A 5AQPB 4ZK4A 4UM3S 2YEVC 4LFCT 3P4RA 5HEOA 3SFEA 1YXRA 3RYFE 2VKOA 4KHPT 3SQ6A 4NZBA 5KMGP 3RC8A 3RF1A 5LG4A 4OFZA 1XDPA 2E5VA 2ACXA 4ZRUA 1T98A 4TNVA 2LEHA 4X5TA 4DV5T 1J1JA 2IAKA 2JMHA 5AQGB 3NRYA 2V7JA 2LKGA 3EAMA 3IEEA 4AKGA 5JDMA 1XMQT 4O4LE 3JADA 3KVBA 4O2BE 3ANWB 3DP7A 5FVLA 2XZ6A 5FMNA 1T72A 5HCJA 5LG3A 2BS2A 4ZI7E 2XZEA 1UW6A 1BR4A 4EGWA 3AEBA 2CXDA 5LGTB 2LSKA 3FZKB 5FL0A 4GK0E 1IBKT 5AFNA 2W66A 5H6RB 1XMOT 1UURA 2DNXA 4Z90A 2CBJA 1MMAA 2BBHA 2CA5A 2WDRA 3OYZA 3UUBA 1WRDA 2MAWA 5LA6E 2Q9QD 4TV8E 3Q5WA 5LXBA 2E8IA 1MIWA 4HN9A 4LF5T 5IWAT 1Y01A 4DR2T 5L3GB 1YKEB 5H6QB 3NWIA 1W0AA 3PDYA 3S4UA 5FXXA 1U4QA 2D0TA 1KNZA 4ZK1A 4QH4A 1U5PA 2X9XA 4TWFA 1D1BA 2H88A 3C98B 3RLFF 4KBMB 4MFRA 3LFMA 3JC6C 3N5LA 5LP6E 4P0AA 1T7SA 3MK7C 4IIJE 5JMEA 4YHHT 3CQCB 2V7KA 3UQ7A 1W0BA 4EEDA 2OLTA 3UU8A 4DBMA 4AKIA 3FBLA 3FZHB 4HKAA 3OVUA 5AQKB 2N9DA 4DR1T 1D1CA 4EZ1A 4WBOA 2NP9A 3B13A 4IDQA 1VCTA 4XK9A 4DUYT 4I43B 2JQ9A 4H9PC 3Q5XA 4UY2A 5DQVA 1KFYA 2W63A 5HXEA 4HWFA 3PV0F 2XNTA 5AFHA 4DBRA 2BDEA 1MMGA 3CX8B 5LCYA 2BG9B 3ABVA 4HFBA 1OEDB 4DR7T 4ZZCA 5JR9A 4DMWA 2D9DA 2BKPA 4TX5A 4ERRA 5LBQB 2Y58A 2AE9A 4HWIB 2PGZA 4KMCA 4AFHA 3M65A 1NAFA 2JMKA 5LXTE 1SHZC 5FVKA 3PU8A 3AA6B 2X9WA 5CA1E 2H7VC 3DTOA 2KT9A 1YKHB 4Q25A 2XSBA 3PUQA 3A8YC 4AI6A 3B5MA 3OTOT 1M7KA 2XQ5A 1HG5A 4DR3T 4UEMA 1EZ3A 5LNKA 3N9OA 1ZOYA 2C0SA 2WWUA 2XJ7A 2WDQA 4IDPA 4HQPA 2NTYA 3AE9A 4EZ4A 1SUMB 1QSDA 4KUMB 4O2AE 5AQIB 1MMNA 2WMNA 4YSZA 3KV6A 2LRLA 5BMVE 1DU2A 2P9BA 3RC3A 2QVAA 4L0RA 4HFIA 2CE7A 4N78D 4PJMA 1Z0PA 3NZPA 2XSAA 1BR2A 4UIGA 2YINA 4O4JE 4NUUA 2LKHA 2XQ8A 3NVOA 4PNIA 3QOFA 4EIWA 2QC1B 4A97A 3BQLA 4JI3T 4BFQA 2VVSA 3F31A 3SRZA 3UFEA 5CO5A 3U8JA 5FXVA 4ISTA 4JLEA 4BA9A 1KNRA 3ZSSA 2HN1A 2EHOD 2BG9E 2FBWA 4P0BA 4HWDA 2E9XB 3A7MA 3BQKA 1US7B 2DI4A 5FY0A 5EK4A 3D0TA 2Y57A 3AAEB 2LT3A 4JI6T 2YK0A 2XAJB 3LJCA 4JI2T 3AA1B 2C5IT 5CA0E 4YHJA 5F8PA 5LGUB 3LBXB 2GK9A 2N2NA 2EHOC 5JDLA 3ONXA 2IW5B 3L3PA 3ETVA 5GONE 3RIFA 3B57A 5ABHA 5KXJA 5AQRB 1ZKEA 5HYAA 3WI3A 1MMDA 4H9OC 2XYSA 3TLTA 2WN9A 2V5DA 3QC9A 2JQHA 4JI7T 2IUBA 3ZC0A 3PJAJ 5AQSB 2VQFT 3K3OA 1HS7A 3KV5A 1W09A 1Z8UA 1FMVA 1UCUA 1R8IA 4EOZB 4HWCA 4QKNA 4J2CA 3GN5A 5C8YE 4PAGA 2VL8A 2NW8A 3GWHA 4X64T 2X0HA 2XASB 4MLKA 3P4SA 3FBZA 3Q2MA 4H63V 4H9NC 4ZEYA 2X00D 5JH7E 2FJEA 2I59A 3FHNA 1CHUA 3PJAA 3EHZA 4QH1A 5J2TE 1YQ3A 2C5JA 3G06A 1XWMA 3HKDE 4HFVA 2QRXA 2H7OA 1MIVA 5KDMC 2V6XA 2VWAA 1FMWA 4LF4T 3I0OA 4E7SA 5L3DB 4ALXA 1J5WA 1YD8G 3I9YA 2V1DB 2HPLA 2XY8B 4CQIA 4DR4T 3O4XE 5LJNA 3WTMA 1KEYA 4UR9A 2CWYA 2G0UA 5AQFB 2MPKA 3RI5A 1AJ3A 3RIUA 3N2GE 1I94T 4PJLA 3QUJA 5DABA 4JI5T 2Y8DA 4ZS2A 4H9QC 3N9MA 3RKOA 3AEAA 4XAXB 3AVSA 5HEGA 4YT0A 3UULA 3CQGB 4X65T 4JEUB 4ZJTA 1YQ4A 4HWHA 5FL1A 4O8SA 5ABFB 2ES0A 2XHEB 5AQMB 1WR6A 2LSJA 3RKGA 4DMVA 3P50A 3RQWA 3ZMVB 4B6XA 2X00A 3RRWA 3ZN0B 4BAYB 4YSYA 3ZCJA 1JNRA 3CX7B 5LOVE 3RH3A 4EZHA 3GMIA 3ZMSB 3L8RA
chains in the Genus database with same CATH topology
4ZK1A 4TWHA 3WTOA 4QH4A 3U8NA 2W8GA 4COFA 4ALXA 4ZZBA 4ZR6A 3SQ6A 2XQ5A 3U8KA 3TLVA 4ILAA 5BP0A 4Z91A 4NZBA 3WTKA 3SIOA 4TWFA 4AFGA 4D01A 3P4WA 2WNJA 5HEJA 2ZJVA 2LLYA 4ZRUA 3WTMA 4TNVA 4X5TA 5J5GA 3TLUA 4HQPA 5L4HA 4TWDA 5KZUA 2YN6A 4PIRA 4NPPA 3RIFA 2BYRA 3SH1A 3JAEA 5HCMA 4B5DA 4LMJA 5JMEA 2PH9A 3IGQA 5L4EA 4ILBA 2BYPA 2LKGA 3LSVA 3UQ7A 4QH5A 4DBMA 3UU8A 4ILCA 3EAMA 3JAFA 3RI5A 4A98A 2VL0A 2WNCA 4AFTA 2BJ0A 2BYSA 4IL9A 5J5FA 3JADA 2WNLA 3WTJA 5HEHA 1UV6A 3TLSA 3RIAA 4LMLA 4HFIA 3ZKRA 2XZ6A 3U8MA 3SQ9A 4EZ1A 2Y7YA 4F8HA 5CFBA 3TLWA 3TLTA 2XYSA 3UU3A 5J5HA 5HCJA 2WN9A 2XNUA 5BW2A 5LG3A 1I9BA 4XK9A 3ZDGA 5AFMA 4QACA 4UM1A 3WTLA 5HEUA 2BYNA 3C84A 3WTNA 3UU4A 4UY2A 4LMKA 1UW6A 2BR8A 4HFEA 5AFMB 4UXUA 3UU5A 5HEGA 5KE4A 4IL4A 2XYTA 2LKHA 2XQ8A 2C9TA 1OEDE 3T4MA 5AINA 2KSRA 5AFJA 2XQAA 2YOEA 2BYQA 2QC1B 2XNTA 4ZJTA 4A97A 5AFHA 4QABA 3WIPA 4BFQA 2LM2A 3EI0A 2BG9B 2XZ5A 3GUAA 3UQ4A 4HFHA 5AFNA 2YMDA 4HFBA 4HFDA 1OEDB 4Z90A 5CO5A 2M6BA 3U8JA 2XQ3A 4XHEA 2XQ9A 3UUBA 4ZZCA 4ZJSA 3PMZA 2MAWA 2XQ6A 2XQ4A 3WTIA 3RQUA 2Y58A 5FJVA 4UM3P 5LXBA 4TNWA 2BG9E 2X00D 2XQ7A 2W8FA 2PGZA 3P50A 3RQWA 1UX2A 4QAAA 4UM3A 2BG9A 5AFKA 2X00A 5TVCA 4WV9A 4AFHA 2UZ6A 3PEOA 3WTHA 3EHZA 4QH1A 2M6IA 5J0ZA 3U8LA 2BR7A 5SYOA 2Y56A 5BRXA 2WZYA 2YMEA 5J5IA 4BQTA 1OEDC 2XNVA 4ZK4A 2Y54A 4UM3S 3ZDHA 2Y57A 2BG9C 3C79A 4HFCA 5HEOA 5L47A 2ZJUA 5AFLA 2YKSA 4FRRA 3UU6A 1OEDA 4IREA 5IUXA 3RHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZK1 A;  4TWH A;  3WTO A;  4QH4 A;  3U8N A;  2W8G A;  4COF A;  4ALX A;  4ZZB A;  4ZR6 A;  3SQ6 A;  2XQ5 A;  3U8K A;  3TLV A;  4ILA A;  5BP0 A;  4Z91 A;  4NZB A;  3WTK A;  3SIO A;  4TWF A;  4AFG A;  4D01 A;  3P4W A;  2WNJ A;  5HEJ A;  2ZJV A;  2LLY A;  4ZRU A;  3WTM A;  4TNV A;  4X5T A;  5J5G A;  3TLU A;  4HQP A;  5L4H A;  4TWD A;  5KZU A;  2YN6 A;  4PIR A;  4NPP A;  3RIF A;  2BYR A;  3SH1 A;  3JAE A;  5HCM A;  4B5D A;  4LMJ A;  5JME A;  2PH9 A;  3IGQ A;  5L4E A;  4ILB A;  2BYP A;  2LKG A;  3LSV A;  3UQ7 A;  4QH5 A;  4DBM A;  3UU8 A;  4ILC A;  3EAM A;  3JAF A;  3RI5 A;  4A98 A;  2VL0 A;  2WNC A;  4AFT A;  2BJ0 A;  2BYS A;  4IL9 A;  5J5F A;  3JAD A;  2WNL A;  3WTJ A;  5HEH A;  1UV6 A;  3TLS A;  3RIA A;  4LML A;  4HFI A;  3ZKR A;  2XZ6 A;  3U8M A;  3SQ9 A;  4EZ1 A;  2Y7Y A;  4F8H A;  5CFB A;  3TLW A;  3TLT A;  2XYS A;  3UU3 A;  5J5H A;  5HCJ A;  2WN9 A;  2XNU A;  5BW2 A;  5LG3 A;  1I9B A;  4XK9 A;  3ZDG A;  5AFM A;  4QAC A;  4UM1 A;  3WTL A;  5HEU A;  2BYN A;  3C84 A;  3WTN A;  3UU4 A;  4UY2 A;  4LMK A;  1UW6 A;  2BR8 A;  4HFE A;  5AFM B;  4UXU A;  3UU5 A;  5HEG A;  5KE4 A;  4IL4 A;  2XYT A;  2LKH A;  2XQ8 A;  2C9T A;  1OED E;  3T4M A;  5AIN A;  2KSR A;  5AFJ A;  2XQA A;  2YOE A;  2BYQ A;  2QC1 B;  2XNT A;  4ZJT A;  4A97 A;  5AFH A;  4QAB A;  3WIP A;  4BFQ A;  2LM2 A;  3EI0 A;  2BG9 B;  2XZ5 A;  3GUA A;  3UQ4 A;  4HFH A;  5AFN A;  2YMD A;  4HFB A;  4HFD A;  1OED B;  4Z90 A;  5CO5 A;  2M6B A;  3U8J A;  2XQ3 A;  4XHE A;  2XQ9 A;  3UUB A;  4ZZC A;  4ZJS A;  3PMZ A;  2MAW A;  2XQ6 A;  2XQ4 A;  3WTI A;  3RQU A;  2Y58 A;  5FJV A;  4UM3 P;  5LXB A;  4TNW A;  2BG9 E;  2X00 D;  2XQ7 A;  2W8F A;  2PGZ A;  3P50 A;  3RQW A;  1UX2 A;  4QAA A;  4UM3 A;  2BG9 A;  5AFK A;  2X00 A;  5TVC A;  4WV9 A;  4AFH A;  2UZ6 A;  3PEO A;  3WTH A;  3EHZ A;  4QH1 A;  2M6I A;  5J0Z A;  3U8L A;  2BR7 A;  5SYO A;  2Y56 A;  5BRX A;  2WZY A;  2YME A;  5J5I A;  4BQT A;  1OED C;  2XNV A;  4ZK4 A;  2Y54 A;  4UM3 S;  3ZDH A;  2Y57 A;  2BG9 C;  3C79 A;  4HFC A;  5HEO A;  5L47 A;  2ZJU A;  5AFL A;  2YKS A;  4FRR A;  3UU6 A;  1OED A;  4IRE A;  5IUX A;  3RHW A; 
#chains in the Genus database with same CATH topology
 1LRZ A;  4YTM A;  2XUE A;  5EZY E;  3T1H T;  1VRB A;  5ABG A;  3T8O A;  4Z91 A;  3AEC A;  2UXB T;  2X51 A;  3DJB A;  3ZCI A;  5DQW A;  2B1E A;  2LLY A;  5J5G A;  3ESL A;  3TLU A;  3VHL A;  2CRB A;  4AKL A;  3PUA A;  1HX1 B;  5E0O A;  1FEW A;  4PIR A;  4LF7 T;  4XZC A;  2PG8 A;  2X0L B;  3AVR A;  2FJD A;  1BR1 A;  5ADX L;  5LMN T;  1WYC A;  2VL0 A;  3AEF A;  4OYK A;  4I4T E;  1M62 A;  2V6Y B;  4I0U A;  1I9B A;  3WTL A;  5LJM A;  3WTN A;  4PFP A;  4LMK A;  1HNW T;  4NIQ A;  2LSG A;  2KSR A;  2V6Y A;  5AFJ A;  1WR0 A;  4GYR A;  3MJX A;  3NRX A;  4ISS A;  4FJO A;  4HEA A;  3AXJ A;  3H3A A;  4CI2 B;  3SS1 A;  2VK9 A;  4ZJS A;  3PMZ A;  5JDH A;  5HWY A;  2E9X C;  4C91 A;  4UM3 A;  2XM2 A;  1NWM X;  3MAC A;  3C50 A;  1XNR T;  3PUZ F;  3N9P A;  2LOS A;  4IE6 A;  2UXD T;  2CM0 A;  2W2U A;  2YKS A;  2I6H A;  3LDQ B;  2CCQ A;  3C51 A;  3QB5 K;  4MAL A;  2IC6 A;  3ZMT B;  4O4H E;  5BP0 A;  4ASK A;  2JQK A;  3FZL B;  3P4W A;  3AA7 B;  2ZJV A;  1MND A;  2HH7 A;  3HR0 A;  4JI1 T;  3LK3 B;  4EEB A;  2K5B B;  5LHI B;  4U7I A;  3RX6 A;  3IHR A;  4B3R T;  2XPK A;  4ILC A;  2NW9 A;  3CWZ B;  5FXW A;  5CB4 E;  4B3M T;  2PBI A;  2BJ0 A;  5HEH A;  3RIA A;  5AQT B;  2XAQ B;  4YFS A;  2IIU A;  3TLW A;  4V1A v;  2XNU A;  1IAP A;  1N34 T;  4U7Y A;  3ZDG A;  2WCA A;  4M1P A;  4XBF B;  2I0M A;  4YY3 T;  4DV2 T;  2JJ9 A;  4GOU A;  1X79 A;  5CGM A;  4UVB B;  4DR5 T;  2WM9 A;  2HHH T;  4CI3 B;  2OA5 A;  2ODV A;  3IF8 B;  2V5C A;  4YSX A;  2EHO B;  2PJQ A;  3GUA A;  4X1I E;  3K3Q C;  1QUU A;  3AE5 A;  2LE8 A;  2E9X D;  4IDO A;  4AKH A;  4LFA T;  4IGU A;  3E22 E;  4TV9 E;  1UX5 A;  4IHJ E;  3PEO A;  2BR7 A;  3FZM B;  2XAF B;  3N9L A;  4PK5 A;  1OED C;  2XNV A;  2WAU A;  2BS4 A;  4MBQ A;  4KHZ F;  5AFU L;  5AFL A;  4AXP A;  4EXT A;  3CK6 A;  3KIN B;  3EDU A;  3RYC E;  1QLB A;  4ZZB A;  1ZV4 X;  4D01 A;  4B3S T;  4H9R C;  2WNJ A;  5EK3 A;  1T8B A;  2CXL A;  2CPT A;  3FB2 A;  5J1G A;  4CN1 A;  4NPP A;  1MIY A;  2WBL A;  4LMJ A;  3N9N A;  2QYW A;  3EVY A;  5JDN A;  3O1J A;  3UT5 E;  2W62 A;  5F3J A;  4UVA B;  4GKK T;  2EHO A;  4ZS3 A;  3OJA A;  5JTG A;  3UFG A;  2WQY A;  4C90 A;  4PJN A;  2L9Q A;  1XDO A;  2XQY A;  3PUY F;  2WDV A;  2DHR A;  3VRA A;  3AE3 A;  4JUY A;  2X0Y A;  1HNX T;  2CBI A;  3N2O A;  2NW7 A;  2KIN B;  2QA7 A;  3PUR A;  4NXM T;  5FY7 A;  4YXD A;  4XHE A;  3IA3 A;  2ZLY A;  5FNV E;  4A5X A;  1LVK A;  2IC9 A;  3E0Z A;  4DO0 A;  4U72 A;  4QAA A;  4GYS A;  4JEH B;  5AFK A;  2ZMA A;  1H7C A;  1SE7 A;  3HA4 A;  5SYO A;  2J47 A;  1V9D A;  4BQT A;  2Y54 A;  3CKD A;  4X66 T;  1SA0 E;  3VRB A;  5L47 A;  2ZJU A;  2NTX A;  4EV6 A;  4IRE A;  3O1I A;  4MHC A;  2JRK A;  4TWH A;  2QGS A;  3WTO A;  4COF A;  3ZYM A;  2UUB T;  3NBX X;  3SIO A;  5AQU B;  5TAO A;  4JI8 T;  2LM9 A;  2Q9Q C;  3W15 B;  4I55 E;  5JQG E;  2M67 A;  4DV3 T;  4CXW A;  1OXZ A;  3RIU C;  4UV9 B;  4AFT A;  3AXJ B;  2BYS A;  2J4G A;  2WP9 A;  3IBP A;  4IE4 A;  4K0U A;  3EAB A;  4F8H A;  2IDO B;  3ETU A;  2WZH A;  5LB7 B;  4DV1 T;  5A1L A;  3E08 A;  4UXU A;  2XAH B;  4CZZ B;  4LF9 T;  2WY2 A;  2J62 A;  2YOE A;  3H3M A;  2LSI A;  3WIP A;  2WZI A;  3NZQ A;  1J5E T;  2XZ5 A;  2CMR A;  4HFH A;  2VKJ A;  3C4W A;  2A2F X;  4WZX A;  2FJB A;  2OV9 A;  2DL1 A;  1N33 T;  1KF6 A;  2DCF A;  3MZK B;  4YJ2 E;  5HXH A;  2E2A A;  5J0Z A;  5LMU T;  3P7I A;  2K48 A;  2YDR A;  2HPJ A;  2ZM6 T;  3Q9D A;  2Y48 B;  2VKH A;  3F57 A;  4ZXL A;  3CPZ A;  4UF0 A;  4FRR A;  1OED A;  3ZC1 A;  3U3I A;  2WMO A;  3U8N A;  3HKB E;  3TLV A;  4ILA A;  1XZY A;  5BR8 T;  3WTK A;  2VKD A;  4X20 E;  3ZMZ B;  5HEJ A;  4OK0 A;  3RRC A;  3UUM A;  4TN7 B;  3J9X 1;  3JCF A;  2E5L T;  1VCS A;  3M3Z B;  3X1D A;  5AQJ B;  2LHN A;  3HKE E;  5CJ5 A;  3VR8 A;  4E7Z A;  3C4Z A;  4IDN A;  2Q9Q A;  2A3D A;  3AA0 B;  1NEK A;  2Y7Y A;  5CFB A;  2X66 A;  2WWV A;  1CUN A;  5EK2 A;  2V7M A;  3MA9 A;  1MNE A;  4BJN A;  3AED A;  2C9T A;  3P8C D;  4QAB A;  5L3C B;  3T1Y T;  3GN5 B;  4IE7 A;  4PFO A;  4CN6 A;  3KDS E;  2ZM8 A;  3H37 A;  3N2K E;  2L3L A;  2X68 A;  2D5U A;  4ADZ A;  4UVC B;  3J7Y q;  1HG2 A;  3N9Q A;  2BG9 A;  3KVA A;  2DLR A;  4GKJ T;  1LKX A;  3TKL B;  2YU2 A;  1WCR A;  3PUX F;  3ZDH A;  4IDZ A;  2BG9 C;  1HFA A;  1UX4 A;  2SPC A;  3QK6 A;  5LYJ E;  4Z8X A;  5IUX A;  5C2T A;  2LRK A;  4U2Y A;  2YDQ A;  3U8K A;  5FYM A;  3ZMU B;  1O3X A;  3ZJ1 A;  2E9X A;  3LK2 B;  4JV5 T;  5KZU A;  3SH1 A;  3U78 A;  2V7I A;  2PH9 A;  2WS3 A;  2YU1 A;  4ILB A;  3WTJ A;  2CLY C;  1HCI A;  1G73 A;  1KNP A;  5FY1 A;  4DUZ T;  5HEU A;  3ZPO A;  4EYY R;  4HFE A;  3BK9 A;  3UTK A;  4EYU A;  2HN2 A;  4G2A A;  2BYQ A;  2BKO A;  3P4P A;  3VR9 A;  2D2S A;  4HFD A;  4HGA A;  1UGO A;  1HNZ T;  2XQ9 A;  2XQ6 A;  2XQ4 A;  5KX5 E;  3WTI A;  1L0V A;  5JRE A;  4TNW A;  4X62 T;  3KBU A;  3AB3 B;  4DID B;  2W0G A;  3QNU A;  2M6I A;  1S35 A;  1IJ6 A;  5LBM A;  2W4X A;  2WZY A;  3ANW A;  4YJ3 E;  1S94 A;  3LBX A;  3KV9 A;  4HFC A;  2VQE T;  5L3E B;  2IML A;  2CHN A;  3RHW A;  2Z6E A;  1VOM A;  5JR9 B;  2W8G A;  4ZR6 A;  2BBJ A;  2X9Y A;  4OHF A;  2A72 A;  4PW8 A;  4QXC B;  4TWD A;  1E2A A;  2BYR A;  2Y6X A;  2K3W A;  3LK4 2;  4DR6 T;  3C64 A;  2BS3 A;  2KZ7 B;  4JYA T;  2FJA A;  3UUX B;  3RGL A;  2WNC A;  2J1D G;  5J5F A;  4AIS A;  2WNL A;  3VKH A;  4PK4 A;  4LML A;  3U8M A;  3SQ9 A;  5J5H A;  2BVM A;  1ZHC A;  2V7L A;  5BW2 A;  3L09 A;  3AEG A;  5AFM B;  4QX8 B;  1D0X A;  3T4M A;  5AQQ B;  4H63 H;  3SFD A;  2VB6 A;  2ZM2 A;  2L8K A;  3ZEF B;  5JRC B;  2ODU A;  4LFB T;  4O4I E;  2MTQ A;  2XQ3 A;  4G63 A;  3UUN A;  2MBG A;  3RQU A;  4QXH B;  4OYJ A;  2LJL A;  5IYZ E;  3AE6 A;  3CQX C;  4AQF C;  2V26 A;  4WNK A;  1IBL T;  5L3B B;  4YTN A;  5AQN B;  1G8X A;  5JVD E;  4JI0 T;  5JR9 C;  3ONL C;  4TUY E;  2NR4 A;  3OYX A;  1IJ5 A;  3A5X A;  2XTL A;  3AE4 A;  4UEL A;  5AQL B;  1HTJ F;  1N32 T;  3FXE B;  4ZI2 D;  3K3N A;  2KWH A;  2VAS A;  2UXX B;  4UV8 B;  1LVF A;  2CWO A;  3EUH A;  4WBN E;  3JAE A;  4B5D A;  4LF8 T;  2ACZ A;  4WYV A;  4EB6 E;  2VVN A;  5FKY A;  5ETW A;  5ABE A;  3O9X A;  5FXZ A;  3OPC A;  2A9U A;  4A56 A;  5HWX A;  2RPA A;  1Y64 B;  4P1N A;  5JDG A;  5KE4 A;  2XYT A;  3HL6 A;  1D0Z A;  2FUP A;  1OED E;  3SWH A;  2H3R A;  2C5K T;  5AQO B;  4KP3 C;  2Q9Q B;  1JNZ A;  2CLY B;  3UQ4 A;  1UUS A;  2UU9 T;  3ZT5 A;  5F5W A;  4U74 A;  2KLQ A;  3MXZ A;  5LHG B;  4I50 E;  5L3F B;  3PUW F;  3PUS A;  3NKZ A;  3FZF B;  3KV4 A;  4WV9 A;  4LF6 T;  4ZI3 D;  3VU7 H;  2K24 A;  3MKD A;  5BRX A;  4F6R C;  3WAK A;  4L9I A;  3I9W A;  2H89 A;  3CIR A;  5C3J A;  3UU6 A;  3WAJ A;  2W61 A;  4UF0 B;  2KWI B;  5L2L A;  3ZST A;  2WB5 A;  1WFD A;  4GK5 E;  2B76 A;  3PTR B;  3ZYL A;  4AFG A;  5LHH B;  1I6Z A;  2KND A;  5JDF A;  2V8S V;  2RA1 A;  4X1Y E;  5DJQ C;  4IT4 A;  5J2U E;  2BZB A;  4YTP A;  2X9H A;  4CXX A;  4KX6 A;  3Q5D A;  1IZN B;  2LSY A;  5L4E A;  2BVL A;  3LSV A;  3PUG A;  4QH5 A;  1D0Y A;  4CXY A;  5HXS A;  4IL9 A;  2F4V T;  3ZLI A;  3TLS A;  1XNQ T;  2JPF A;  1X9B A;  3UU3 A;  4QAC A;  2DWK A;  4DVD A;  4CI1 B;  2BR8 A;  4IE5 A;  3UU5 A;  5AQH B;  4IL4 A;  4PJJ A;  3AE7 A;  3OKQ A;  5HXR A;  4P09 A;  2XM1 A;  1ZP0 A;  3LG7 A;  1E7P A;  2KMF A;  3ZYK A;  2UUA T;  4YLH A;  4AQF A;  4U33 A;  4H9S E;  2MOZ A;  4IE0 A;  3QB5 A;  1UX2 A;  3K1S A;  3AAI A;  5TVC A;  3KFW X;  2PFV A;  5FP3 A;  1FJG T;  2YME A;  4KI0 F;  3C79 A;  2CEA A;  4CN4 A;  3HKC E;  3RYH E;  4WW0 A;  2NWB A;  2BKN A;  2JQQ A;  2W00 A;  2JIW A;  2MYS A;  2AXD S;  4NUV A;  1HX8 A;  3PE0 A;  4OX9 T;  3EDV A;  3RYI E;  4AQY T;  2WSS V;  4AQG A;  2BYP A;  4AIU A;  3FXD B;  4BJM A;  5JDQ A;  3JAF A;  4A98 A;  2K9A A;  4EAH A;  4QXB B;  2UUC T;  4U31 A;  1WYB A;  3AE1 A;  2LOP A;  4ZHQ E;  4K0K T;  4AKR B;  3Q5E A;  2BYN A;  3C84 A;  2RP4 A;  4ZI3 C;  3UU4 A;  3ZN1 B;  4TZ4 C;  2IHR 1;  1E1H B;  4JBW F;  3ONJ A;  2KXP B;  2YDS A;  5AQV B;  3F2E A;  4QX7 B;  3ZT7 A;  5AIN A;  3GA8 A;  2LM2 A;  3V5S A;  5HAX A;  2XAG B;  4DV6 T;  1HF8 A;  2UXN B;  2YMD A;  4QWN B;  2N1G A;  4JI4 T;  2M6B A;  3C4X A;  3I0Q A;  2DWG A;  5FJV A;  2VUR A;  3AEE A;  2XQ7 A;  1GQE A;  3R6N A;  4DV0 T;  4L5G A;  3CVR A;  2UZ6 A;  5LGN B;  2Y56 A;  5J5I A;  3AAA B;  1BR0 A;  3I1A A;  2LHR A;  2NOX A;  3RPU A;  3O1H A;  3BQI A;  4PK6 A;  3K8P C;  2WU2 A;  1WLX A;  5HXC A;  2X67 A;  3ZJ2 A;  4UXN B;  1ZEE A;  4FI5 A;  4DV4 T;  4DND A;  1N36 T;  5IHY A;  5L4H A;  2YN6 A;  1D1A A;  3VKG A;  5HCM A;  3IGQ A;  4X1K E;  1FIO A;  1W9R A;  3JC6 D;  5JRC A;  2WU5 A;  1UK5 A;  4ILU A;  1UV6 A;  4DV7 T;  2UXC T;  2D0U A;  3V5U A;  3ZKR A;  4GIW A;  5M4Y A;  4ANJ A;  2R6G F;  5AFM A;  4UM1 A;  1B7T A;  3ZT6 A;  4DBQ A;  3CML A;  5ABF A;  3SOL A;  1NEN A;  2PTF A;  3CX6 B;  4U3C A;  1KK7 A;  2XQA A;  4QHO A;  3EI0 A;  1HR0 T;  3L39 A;  3PU3 A;  3HI2 A;  4HE8 A;  4ZOL E;  3P4Q A;  3PUV F;  1OWA A;  1IBM T;  3R84 B;  4HTE A;  4U2Z A;  4B3T T;  4ZI2 C;  4UM3 P;  2W8F A;  3KBT A;  3OBV E;  2ZM0 A;  1YW0 A;  3AE8 A;  3AE2 A;  4NXN T;  2CHO A;  3WTH A;  3U8L A;  2CXF A;  2W67 A;  5AQP B;  4ZK4 A;  4UM3 S;  2YEV C;  4LFC T;  3P4R A;  5HEO A;  3SFE A;  1YXR A;  3RYF E;  2VKO A;  4KHP T;  3SQ6 A;  4NZB A;  5KMG P;  3RC8 A;  3RF1 A;  5LG4 A;  4OFZ A;  1XDP A;  2E5V A;  2ACX A;  4ZRU A;  1T98 A;  4TNV A;  2LEH A;  4X5T A;  4DV5 T;  1J1J A;  2IAK A;  2JMH A;  5AQG B;  3NRY A;  2V7J A;  2LKG A;  3EAM A;  3IEE A;  4AKG A;  5JDM A;  1XMQ T;  4O4L E;  3JAD A;  3KVB A;  4O2B E;  3ANW B;  3DP7 A;  5FVL A;  2XZ6 A;  5FMN A;  1T72 A;  5HCJ A;  5LG3 A;  2BS2 A;  4ZI7 E;  2XZE A;  1UW6 A;  1BR4 A;  4EGW A;  3AEB A;  2CXD A;  5LGT B;  2LSK A;  3FZK B;  5FL0 A;  4GK0 E;  1IBK T;  5AFN A;  2W66 A;  5H6R B;  1XMO T;  1UUR A;  2DNX A;  4Z90 A;  2CBJ A;  1MMA A;  2BBH A;  2CA5 A;  2WDR A;  3OYZ A;  3UUB A;  1WRD A;  2MAW A;  5LA6 E;  2Q9Q D;  4TV8 E;  3Q5W A;  5LXB A;  2E8I A;  1MIW A;  4HN9 A;  4LF5 T;  5IWA T;  1Y01 A;  4DR2 T;  5L3G B;  1YKE B;  5H6Q B;  3NWI A;  1W0A A;  3PDY A;  3S4U A;  5FXX A;  1U4Q A;  2D0T A;  1KNZ A;  4ZK1 A;  4QH4 A;  1U5P A;  2X9X A;  4TWF A;  1D1B A;  2H88 A;  3C98 B;  3RLF F;  4KBM B;  4MFR A;  3LFM A;  3JC6 C;  3N5L A;  5LP6 E;  4P0A A;  1T7S A;  3MK7 C;  4IIJ E;  5JME A;  4YHH T;  3CQC B;  2V7K A;  3UQ7 A;  1W0B A;  4EED A;  2OLT A;  3UU8 A;  4DBM A;  4AKI A;  3FBL A;  3FZH B;  4HKA A;  3OVU A;  5AQK B;  2N9D A;  4DR1 T;  1D1C A;  4EZ1 A;  4WBO A;  2NP9 A;  3B13 A;  4IDQ A;  1VCT A;  4XK9 A;  4DUY T;  4I43 B;  2JQ9 A;  4H9P C;  3Q5X A;  4UY2 A;  5DQV A;  1KFY A;  2W63 A;  5HXE A;  4HWF A;  3PV0 F;  2XNT A;  5AFH A;  4DBR A;  2BDE A;  1MMG A;  3CX8 B;  5LCY A;  2BG9 B;  3ABV A;  4HFB A;  1OED B;  4DR7 T;  4ZZC A;  5JR9 A;  4DMW A;  2D9D A;  2BKP A;  4TX5 A;  4ERR A;  5LBQ B;  2Y58 A;  2AE9 A;  4HWI B;  2PGZ A;  4KMC A;  4AFH A;  3M65 A;  1NAF A;  2JMK A;  5LXT E;  1SHZ C;  5FVK A;  3PU8 A;  3AA6 B;  2X9W A;  5CA1 E;  2H7V C;  3DTO A;  2KT9 A;  1YKH B;  4Q25 A;  2XSB A;  3PUQ A;  3A8Y C;  4AI6 A;  3B5M A;  3OTO T;  1M7K A;  2XQ5 A;  1HG5 A;  4DR3 T;  4UEM A;  1EZ3 A;  5LNK A;  3N9O A;  1ZOY A;  2C0S A;  2WWU A;  2XJ7 A;  2WDQ A;  4IDP A;  4HQP A;  2NTY A;  3AE9 A;  4EZ4 A;  1SUM B;  1QSD A;  4KUM B;  4O2A E;  5AQI B;  1MMN A;  2WMN A;  4YSZ A;  3KV6 A;  2LRL A;  5BMV E;  1DU2 A;  2P9B A;  3RC3 A;  2QVA A;  4L0R A;  4HFI A;  2CE7 A;  4N78 D;  4PJM A;  1Z0P A;  3NZP A;  2XSA A;  1BR2 A;  4UIG A;  2YIN A;  4O4J E;  4NUU A;  2LKH A;  2XQ8 A;  3NVO A;  4PNI A;  3QOF A;  4EIW A;  2QC1 B;  4A97 A;  3BQL A;  4JI3 T;  4BFQ A;  2VVS A;  3F31 A;  3SRZ A;  3UFE A;  5CO5 A;  3U8J A;  5FXV A;  4IST A;  4JLE A;  4BA9 A;  1KNR A;  3ZSS A;  2HN1 A;  2EHO D;  2BG9 E;  2FBW A;  4P0B A;  4HWD A;  2E9X B;  3A7M A;  3BQK A;  1US7 B;  2DI4 A;  5FY0 A;  5EK4 A;  3D0T A;  2Y57 A;  3AAE B;  2LT3 A;  4JI6 T;  2YK0 A;  2XAJ B;  3LJC A;  4JI2 T;  3AA1 B;  2C5I T;  5CA0 E;  4YHJ A;  5F8P A;  5LGU B;  3LBX B;  2GK9 A;  2N2N A;  2EHO C;  5JDL A;  3ONX A;  2IW5 B;  3L3P A;  3ETV A;  5GON E;  3RIF A;  3B57 A;  5ABH A;  5KXJ A;  5AQR B;  1ZKE A;  5HYA A;  3WI3 A;  1MMD A;  4H9O C;  2XYS A;  3TLT A;  2WN9 A;  2V5D A;  3QC9 A;  2JQH A;  4JI7 T;  2IUB A;  3ZC0 A;  3PJA J;  5AQS B;  2VQF T;  3K3O A;  1HS7 A;  3KV5 A;  1W09 A;  1Z8U A;  1FMV A;  1UCU A;  1R8I A;  4EOZ B;  4HWC A;  4QKN A;  4J2C A;  3GN5 A;  5C8Y E;  4PAG A;  2VL8 A;  2NW8 A;  3GWH A;  4X64 T;  2X0H A;  2XAS B;  4MLK A;  3P4S A;  3FBZ A;  3Q2M A;  4H63 V;  4H9N C;  4ZEY A;  2X00 D;  5JH7 E;  2FJE A;  2I59 A;  3FHN A;  1CHU A;  3PJA A;  3EHZ A;  4QH1 A;  5J2T E;  1YQ3 A;  2C5J A;  3G06 A;  1XWM A;  3HKD E;  4HFV A;  2QRX A;  2H7O A;  1MIV A;  5KDM C;  2V6X A;  2VWA A;  1FMW A;  4LF4 T;  3I0O A;  4E7S A;  5L3D B;  4ALX A;  1J5W A;  1YD8 G;  3I9Y A;  2V1D B;  2HPL A;  2XY8 B;  4CQI A;  4DR4 T;  3O4X E;  5LJN A;  3WTM A;  1KEY A;  4UR9 A;  2CWY A;  2G0U A;  5AQF B;  2MPK A;  3RI5 A;  1AJ3 A;  3RIU A;  3N2G E;  1I94 T;  4PJL A;  3QUJ A;  5DAB A;  4JI5 T;  2Y8D A;  4ZS2 A;  4H9Q C;  3N9M A;  3RKO A;  3AEA A;  4XAX B;  3AVS A;  5HEG A;  4YT0 A;  3UUL A;  3CQG B;  4X65 T;  4JEU B;  4ZJT A;  1YQ4 A;  4HWH A;  5FL1 A;  4O8S A;  5ABF B;  2ES0 A;  2XHE B;  5AQM B;  1WR6 A;  2LSJ A;  3RKG A;  4DMV A;  3P50 A;  3RQW A;  3ZMV B;  4B6X A;  2X00 A;  3RRW A;  3ZN0 B;  4BAY B;  4YSY A;  3ZCJ A;  1JNR A;  3CX7 B;  5LOV E;  3RH3 A;  4EZH A;  3GMI A;  3ZMS B;  3L8R A; 
#chains in the Genus database with same CATH homology
 4ZK1 A;  4TWH A;  3WTO A;  4QH4 A;  3U8N A;  2W8G A;  4COF A;  4ALX A;  4ZZB A;  4ZR6 A;  3SQ6 A;  2XQ5 A;  3U8K A;  3TLV A;  4ILA A;  5BP0 A;  4Z91 A;  4NZB A;  3WTK A;  3SIO A;  4TWF A;  4AFG A;  4D01 A;  3P4W A;  2WNJ A;  5HEJ A;  2ZJV A;  2LLY A;  4ZRU A;  3WTM A;  4TNV A;  4X5T A;  5J5G A;  3TLU A;  4HQP A;  5L4H A;  4TWD A;  5KZU A;  2YN6 A;  4PIR A;  4NPP A;  3RIF A;  2BYR A;  3SH1 A;  3JAE A;  5HCM A;  4B5D A;  4LMJ A;  5JME A;  2PH9 A;  3IGQ A;  5L4E A;  4ILB A;  2BYP A;  2LKG A;  3LSV A;  3UQ7 A;  4QH5 A;  4DBM A;  3UU8 A;  4ILC A;  3EAM A;  3JAF A;  3RI5 A;  4A98 A;  2VL0 A;  2WNC A;  4AFT A;  2BJ0 A;  2BYS A;  4IL9 A;  5J5F A;  3JAD A;  2WNL A;  3WTJ A;  5HEH A;  1UV6 A;  3TLS A;  3RIA A;  4LML A;  4HFI A;  3ZKR A;  2XZ6 A;  3U8M A;  3SQ9 A;  4EZ1 A;  2Y7Y A;  4F8H A;  5CFB A;  3TLW A;  3TLT A;  2XYS A;  3UU3 A;  5J5H A;  5HCJ A;  2WN9 A;  2XNU A;  5BW2 A;  5LG3 A;  1I9B A;  4XK9 A;  3ZDG A;  5AFM A;  4QAC A;  4UM1 A;  3WTL A;  5HEU A;  2BYN A;  3C84 A;  3WTN A;  3UU4 A;  4UY2 A;  4LMK A;  1UW6 A;  2BR8 A;  4HFE A;  5AFM B;  4UXU A;  3UU5 A;  5HEG A;  5KE4 A;  4IL4 A;  2XYT A;  2LKH A;  2XQ8 A;  2C9T A;  1OED E;  3T4M A;  5AIN A;  2KSR A;  5AFJ A;  2XQA A;  2YOE A;  2BYQ A;  2QC1 B;  2XNT A;  4ZJT A;  4A97 A;  5AFH A;  4QAB A;  3WIP A;  4BFQ A;  2LM2 A;  3EI0 A;  2BG9 B;  2XZ5 A;  3GUA A;  3UQ4 A;  4HFH A;  5AFN A;  2YMD A;  4HFB A;  4HFD A;  1OED B;  4Z90 A;  5CO5 A;  2M6B A;  3U8J A;  2XQ3 A;  4XHE A;  2XQ9 A;  3UUB A;  4ZZC A;  4ZJS A;  3PMZ A;  2MAW A;  2XQ6 A;  2XQ4 A;  3WTI A;  3RQU A;  2Y58 A;  5FJV A;  4UM3 P;  5LXB A;  4TNW A;  2BG9 E;  2X00 D;  2XQ7 A;  2W8F A;  2PGZ A;  3P50 A;  3RQW A;  1UX2 A;  4QAA A;  4UM3 A;  2BG9 A;  5AFK A;  2X00 A;  5TVC A;  4WV9 A;  4AFH A;  2UZ6 A;  3PEO A;  3WTH A;  3EHZ A;  4QH1 A;  2M6I A;  5J0Z A;  3U8L A;  2BR7 A;  5SYO A;  2Y56 A;  5BRX A;  2WZY A;  2YME A;  5J5I A;  4BQT A;  1OED C;  2XNV A;  4ZK4 A;  2Y54 A;  4UM3 S;  3ZDH A;  2Y57 A;  2BG9 C;  3C79 A;  4HFC A;  5HEO A;  5L47 A;  2ZJU A;  5AFL A;  2YKS A;  4FRR A;  3UU6 A;  1OED A;  4IRE A;  5IUX A;  3RHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...