3P50A

Structure of propofol bound to a pentameric ligand-gated ion channel, glic
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title X-ray structures of general anaesthetics bound to a pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3p50A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3p50A01
3U8LA 2WNCA 2Y57A 3RIAA 4ILBA 4HFIA 5HEUA 3TLSA 3P4WA 4LMLA 4IL4A 4X5TA 2LKHA 5HEJA 2XYTA 4QAAA 2BYQA 4AFHA 2YKSA 3UQ4A 4ZJTA 5AFNA 3UU3A 2PGZA 3C84A 2XQ3A 4EZ1A 5BRXA 1OEDA 5LXBA 2XQ8A 3JADA 3U8MA 2BJ0A 5BP0A 3LSVA 5KZUA 2PH9A 2BR8A 5AFKA 1UV6A 4ZR6A 4ILAA 4UXUA 4TWDA 2Y7YA 1OEDB 4ALXA 2XQ5A 2BYRA 4XHEA 4HFHA 4IL9A 3ZKRA 2BG9A 3U8JA 4A98A 2BG9E 4ZZBA 4QABA 3EHZA 3SH1A 4ZK4A 5HCJA 5J5IA 3U8NA 2WN9A 4BQTA 4WV9A 4HFBA 2W8FA 2XQ7A 4ZJSA 3ZDGA 4BFQA 3UUBA 2LM2A 3PMZA 2BG9B 5LG3A 2M6IA 3RI5A 4ZZCA 5CFBA 2VL0A 2XZ5A 3WTKA 4F8HA 5CO5A 3RHWA 2Y56A 1UX2A 2BYSA 2WZYA 4ZRUA 2YMDA 3EI0A 2WNJA 3UU5A 4QH4A 4LMJA 1OEDE 3WTJA 3UU8A 2ZJUA 3UQ7A 4XK9A 5JMEA 2Y58A 5HEOA 5L47A 3JAEA 4TNVA 2C9TA 4UM3A 2MAWA 5L4EA 4FRRA 5BW2A 2BR7A 4HFCA 3SQ9A 3JAFA 4TWFA 3U8KA 2UZ6A 3RIFA 5J0ZA 1OEDC 3WTNA 4UM3S 4A97A 3TLWA 2BYPA 2ZJVA 5SYOA 3WTLA 4NPPA 5AFMA 2XQ4A 4UM1A 4AFTA 5IUXA 2LKGA 2XQ9A 3SQ6A 5KE4A 4TWHA 4ZK1A 4ILCA 4TNWA 5L4HA 3GUAA 2BG9C 4UM3P 2KSRA 3WIPA 2YOEA 2XQ6A 5J5FA 3WTMA 5J5GA 4LMKA 2XQAA 2YN6A 2M6BA 4QH1A 3RQUA 5AFLA 3SIOA 2X00D 2LLYA 2XNTA 3WTOA 4DBMA 4B5DA 4COFA 2X00A 5HCMA 4AFGA 5FJVA 3TLUA 3RQWA 5HEGA 3UU4A 2BYNA 3UU6A 4NZBA 4Z90A 2QC1B 3WTHA 4HFEA 1UW6A 3ZDHA 5TVCA 3P50A 4HQPA 4Z91A 4QACA 3IGQA 4PIRA 5AINA 5HEHA 4QH5A 3TLVA 2Y54A 1I9BA 2XNVA 2W8GA 5AFJA 2WNLA 3TLTA 2XYSA 4IREA 5J5HA 5AFMB 4D01A 5AFHA 2XZ6A 3PEOA 4HFDA 3EAMA 2XNUA 3WTIA 2YMEA 4UY2A 3T4MA 3C79A
chains in the Genus database with same CATH superfamily
2CWOA 3ZCJA 3O1HA 3VHLA 4FI5A 5LNKA 4ERRA 3VU7H 2JPFA 3HKDE 5FYMA 3I1AA 5FXXA 2XQYA 1OEDB 4HFHA 2DWGA 3FB2A 2FUPA 5ABFA 5AQVB 1XMOT 5HXRA 5FY0A 4WV9A 4BFQA 5JR9A 4EIWA 2E2AA 3RHWA 2ACXA 4YHHT 1MIVA 3KBUA 2C0SA 2J4GA 3N9NA 2CRBA 2X66A 2D0TA 4JEUB 3P7IA 4YHJA 2MAWA 4JI8T 4KI0F 5AQIB 5J0ZA 3TLWA 1IBMT 3PUSA 2WZIA 4UM1A 4AI6A 5KE4A 3GUAA 4UM3P 4AKHA 2LSIA 3MKDA 3SIOA 2IHR1 4WW0A 1AJ3A 1E2AA 3ZJ1A 4YFSA 1H7CA 3PUZF 3WTHA 1G8XA 2E9XC 4ILUA 4EOZB 2Y6XA 5E0OA 5AQSB 2A3DA 1X79A 4PAGA 5AQTB 2A2FX 5FVLA 3TLVA 4H9RC 3ZYKA 2W8GA 2D5UA 4TZ4C 3N2KE 4YY3T 3CKDA 2XNUA 3ZPOA 3VKHA 2EHOB 3IF8B 4ILBA 3UTKA 3N5LA 4CQIA 3RYIE 5EK2A 2XUEA 2LJLA 5L3DB 3V5UA 2JQ9A 4AFHA 2BBHA 5F5WA 4LFCT 4O4JE 3UU3A 3FZLB 1XWMA 5C2TA 3RH3A 5KZUA 2WDVA 1HR0T 3I9YA 5LJMA 1UX4A 2XQ5A 2D9DA 4IL9A 4EZHA 3FZMB 3RIUC 1D1AA 4PJJA 3FZFB 1MNEA 3B13A 2VKOA 3ZYMA 2NR4A 3DJBA 3UFGA 5J1GA 1MMAA 5L4EA 3QK6A 4AQFC 3NBXX 4PK6A 4DV4T 2Q9QA 3A5XA 2XAQB 4B3ST 2XQ9A 4JI7T 1I6ZA 4TNWA 4QHOA 3FZHB 4Q25A 4TX5A 3RQUA 3FXEB 1WLXA 3JCFA 5H6QB 3C4XA 1HNZT 4P0BA 4COFA 5HCMA 3PUYF 2Y48B 3ZMSB 2ZLYA 1HS7A 5L2LA 3P50A 4Z91A 3IGQA 3AE8A 4IE0A 3AA1B 3I0OA 4I4TE 5DQVA 2PBIA 3SFDA 3U8LA 3T1YT 4DO0A 2V8SV 4KX6A 2JIWA 5HEJA 4TV9E 1BR0A 2PGZA 4B6XA 2XQ3A 4EZ1A 5BRXA 1HX8A 2FJAA 3PURA 4UF0B 3SS1A 4XAXB 5EK3A 3PU3A 2BYRA 3C51A 2BG9A 2MTQA 2UUAT 2WMNA 1YD8G 4ZZCA 3WTKA 2VL0A 5JDHA 2H88A 2KNDA 5FP3A 5CB4E 2XASB 2YDSA 4G2AA 2XPKA 2OV9A 5JRCB 1I94T 4HFCA 1FMVA 3JAFA 4L0RA 3CX7B 4ASKA 5JDGA 2LHRA 3AEEA 3ONLC 4OX9T 2ZJVA 4H9NC 5AQRB 4X64T 2P9BA 3N9PA 4EB6E 3MJXA 5FNVE 1IJ5A 4U3CA 3RPUA 3WI3A 2ZM6T 4ZK1A 3OBVE 3BQKA 3PUWF 3LK42 1KEYA 3AE2A 3QOFA 2ES0A 2CXDA 4CI3B 2J62A 5JDMA 1D0XA 1VCSA 2XNVA 4X1IE 1W0AA 1JNRA 2WM9A 3MZKB 4D01A 1ZV4X 3VKGA 1HG5A 2LSKA 3QB5K 3RIAA 3J7Yq 3CIRA 2HPJA 1DU2A 3ZJ2A 3H37A 3VR9A 5FY1A 4KP3C 5KXJA 2XAHB 4ALXA 3M65A 3QC9A 4A98A 2BG9E 2VQFT 1J1JA 5FL0A 5CJ5A 4MALA 1IBLT 5LG3A 2XZ5A 3Q9DA 4H9OC 2QRXA 5AQMB 3RKGA 2WNJA 2KWIB 2E9XA 5FXZA 1N33T 2V7LA 4UR9A 5LJNA 1UK5A 4ZOLE 4HEAA 3I9WA 4JI6T 4A97A 3WTLA 2IC9A 4UXNB 3AB3B 2KSRA 4YXDA 5LBMA 4DR5T 4IDNA 3L8RA 1IZNB 5FL1A 4CI1B 5H6RB 3UU4A 1NWMX 4PJLA 4DR4T 3R84B 3GA8A 2Y54A 2B76A 3RIUA 1KFYA 2EHOD 1XDPA 1SHZC 2XAJB 4DV0T 3N9QA 5C8YE 4HFIA 2VKHA 5DJQC 3AVRA 4AQFA 3H3MA 3N2OA 4MBQA 5LXBA 1QUUA 4YSYA 2KT9A 2IIUA 5JDFA 3FXDB 1R8IA 3EHZA 4LFAT 1BR4A 3EDVA 3ZT5A 3ZMTB 4AKGA 4DNDA 4UVCB 2M67A 3ANWA 2VWAA 1SE7A 4DUYT 2W0GA 4QXHB 2CCQA 4IHJE 2MPKA 4UM3S 3D0TA 5SYOA 2GK9A 4NPPA 2LSJA 4TWHA 2PFVA 3WIPA 2YOEA 5LG4A 2XQAA 4QX8B 3AE1A 4H9PC 2NW8A 1T8BA 4TN7B 2YEVC 1WR0A 3QNUA 5HEGA 3ZMUB 2ODVA 4I0UA 1WCRA 4HWHA 3RF1A 2VURA 5KMGP 3NZPA 5LB7B 1W09A 1FIOA 4AKRB 4M1PA 3KINB 2V6YA 1V9DA 5BMVE 3PUXF 1S35A 4PK5A 4X20E 4EGWA 3TLSA 2V7JA 1MMGA 2KLQA 4L5GA 4PW8A 5JRCA 4HWDA 3AECA 2BJ0A 5BP0A 3LSVA 4CN6A 4YJ2E 4DV2T 2BR8A 1ZOYA 5AQPB 1SA0E 5A1LA 3GN5B 4E7ZA 2W62A 3DP7A 4JLEA 4DV7T 3MACA 3U8NA 2ACZA 2W8FA 2E8IA 3E08A 2BYSA 1Y01A 2WWUA 5LHHB 3UU5A 4OHFA 5HEOA 4U74A 3ZC0A 2BS3A 3AXJA 1CUNA 3F31A 3PTRB 1X9BA 3WTNA 1OEDC 4HWCA 2D2SA 4UVBB 4OYJA 3EUHA 2LKGA 4ZXLA 4HWIB 3GWHA 3CX6B 5J5FA 3NKZA 4KHPT 2YN6A 2X00D 4DBMA 3CMLA 1HX1B 5FJVA 5ABGA 3C98B 2UUCT 4X1KE 2XY8B 2XTLA 1Z8UA 1YQ4A 4A5XA 2CPTA 1I9BA 5HXSA 4IDOA 4QWNB 4EXTA 1NEKA 4QXBB 1KNZA 2AXDS 2MYSA 3AAEB 2RP4A 2PG8A 3O9XA 3JC6D 1KK7A 4ZJTA 4O4LE 4X1YE 3F57A 3HKEE 4EV6A 3OYZA 4ILAA 2CBJA 2H89A 2WZHA 3N9OA 3K1SA 1YKEB 3K8PC 4MFRA 2XQ7A 2L9QA 3UUXB 2M6IA 2BS4A 3Q5DA 3AE4A 2QYWA 3V5SA 4CXYA 3AE9A 5LHGB 4ISSA 3UU8A 4DR6T 2XAGB 4V1Av 3K3QC 2DWKA 4OYKA 5J2TE 2PTFA 4AQYT 3CQCB 2X0YA 3RC3A 2WMOA 4GYSA 1NAFA 4JI0T 2WDQA 2WWVA 3OPCA 5AFUL 1Z0PA 1L0VA 2BZBA 4H9QC 4QH1A 2BVLA 3AE7A 2OLTA 2DNXA 3PDYA 4LF4T 4EYYR 5LMNT 3IEEA 5TVCA 2MBGA 3CPZA 3O1IA 4DBRA 5ETWA 3A7MA 5HEHA 3RYHE 3HR0A 5J2UE 2UXBT 2WBLA 2MOZA 2LE8A 4X65T 4U2YA 3PEOA 5LP6E 1HNXT 4BJNA 1MNDA 2NP9A 4JEHB 1VCTA 2V7IA 1O3XA 2CBIA 2DCFA 4B3TT 5AQHB 2CE7A 3CX8B 5CGMA 5AFNA 5AQFB 4XZCA 5EK4A 4TWDA 3AAAB 3ZKRA 4QABA 2JQQA 3AA6B 4K0UA 5CFBA 4BJMA 2D0UA 2Y56A 1D0ZA 3PV0F 3F2EA 4IT4A 1LKXA 3K3OA 5HXCA 4AIUA 3UT5E 2WAUA 3JAEA 3H3AA 3HL6A 3ETUA 2RPAA 1NENA 2UZ6A 4Z8XA 4LF7T 4DMWA 2KWHA 2B1EA 3LK3B 5JDLA 4L9IA 5HXHA 4DV3T 2CM0A 4ZS2A 2DL1A 4YT0A 4LMKA 5LHIB 2XNTA 3CWZB 2LSYA 3LBXA 4CI2B 5L3CB 1UW6A 3O4XE 2W61A 5HYAA 3FBLA 4PIRA 2CLYB 3ZC1A 4PJNA 3TLTA 4AISA 2IAKA 3KBTA 1MMNA 4X5TA 4EYUA 5AQOB 2NTYA 3ABVA 5FXWA 2YKSA 3PUGA 3C84A 4IE7A 1OEDA 5LOVE 3U8MA 1T72A 4U31A 1JNZA 4ZR6A 2HH7A 2LHNA 2WB5A 4AKIA 3ZDGA 2X9YA 1U5PA 1UGOA 3PMZA 2H7VC 5ABFB 1VRBA 1UX2A 4ZRUA 5JVDE 1XNRT 4LMJA 5JR9B 4CXXA 3UQ7A 2VKDA 5F3JA 3BQLA 3B5MA 2H3RA 1W9RA 3JC6C 5GONE 3O1JA 4WYVA 3ZMVB 2YDRA 4UEMA 4JI3T 1ZKEA 3KVBA 5HXEA 2LRLA 5J5GA 3ZT6A 4DV1T 2X0LB 2ZM8A 4DR7T 2LEHA 1T98A 3SOLA 2XZEA 4QACA 4LF6T 5AQNB 1FJGT 4CN1A 4I43B 1J5WA 3QUJA 5BR8T 2X51A 2EHOA 4IREA 2XZ6A 3WAKA 3DTOA 3S4UA 3TKLB 4J2CA 4JV5T 2N9DA 3C79A 5AQQB 3RGLA 2BDEA 4KMCA 3P4WA 2JJ9A 4NUUA 4JI4T 4U72A 5TAOA 2E5LT 2BVMA 2X9WA 5HWXA 5C3JA 5L3GB 4F6RC 4CZZB 3EVYA 4I55E 3RYFE 4ZK4A 3KV9A 3X1DA 3QB5A 4JI2T 2ODUA 3HA4A 1YQ3A 4XK9A 2Y58A 1GQEA 2KMFA 1FMWA 4GIWA 2ZMAA 3ZSTA 1YKHB 2W00A 5EZYE 4DUZT 3ESLA 2VB6A 4X66T 2WP9A 4LFBT 1IAPA 4DV5T 5L3FB 2Q9QB 3IBPA 3UULA 5AFLA 4UVAB 3AEAA 4YLHA 3TLUA 1QLBA 2CHNA 2WU5A 5CA0E 4ZEYA 4NXMT 5AINA 3AAIA 4YSZA 3Q5EA 1N32T 3MA9A 5AFJA 3FBZA 4OK0A 2WNLA 2XYSA 2V1DB 5LGUB 2WU2A 1HTJF 2KZ7B 2JMHA 3RLFF 4IE6A 2CA5A 2WNCA 1ZHCA 1EZ3A 2FJDA 1SUMB 4UF0A 1M62A 3P4RA 4TUYE 4JBWF 3P8CD 2XQ8A 2DHRA 3JADA 2C5JA 2WS3A 3CQXC 2PH9A 5KX5E 2V7MA 3L09A 1MIYA 2A72A 4IE4A 2LM9A 5ABHA 5HCJA 5LA6E 2I59A 3VRBA 2CXFA 2FJEA 2BG9B 2DLRA 4ZI2D 5FXVA 2FBWA 3AE5A 4DIDB 3MK7C 3VRAA 2YMDA 2YINA 3CK6A 4QH4A 5LXTE 5FY7A 4O4HE 5L47A 2F4VT 3RKOA 4P09A 2X0HA 2ZM2A 3RIFA 4WBOA 5JDNA 2QA7A 4DR3T 5LBQB 2JQHA 3KVAA 4HTEA 1HF8A 1UX5A 4ADZA 5JREA 1E7PA 2LLYA 4HE8A 4O4IE 4PK4A 2NTXA 2X00A 2N2NA 3R6NA 2XSAA 4QX7B 4Z90A 2L8KA 4I50E 1UURA 4UIGA 4NIQA 3AA0B 4QH5A 2XAFB 4C90A 3LDQB 2XM2A 4E7SA 4ZI3D 5AFMB 2W4XA 3OKQA 1VOMA 3WTIA 4U2ZA 2WQYA 1N36T 2YU2A 2X67A 2IUBA 4C91A 1HNWT 1Y64B 5HEUA 3ZT7A 4LMLA 1LVKA 3KDSE 4HN9A 4IDPA 5CA1E 4EEBA 2JQKA 4DR2T 3MXZA 4MHCA 4YSXA 4UXUA 3I0QA 4BAYB 4P1NA 2HPLA 3SRZA 4AXPA 2WN9A 2JMKA 4GOUA 5IYZE 4ZJSA 2CEAA 3RI5A 3C4ZA 3N9MA 5M4YA 4HGAA 2WZYA 3NWIA 3Q5XA 3WTJA 4H63V 2NW7A 5JDQA 3HKBE 2QGSA 4HKAA 2E9XB 3KV5A 5BW2A 4TWFA 2K3WA 2V7KA 2BKOA 2IMLA 2IW5B 4CXWA 1MIWA 3RC8A 2EHOC 5AQJB 2WCAA 2CWYA 4QKNA 1HG2A 4X62T 5L4HA 1ZEEA 3OTOT 1J5ET 3GMIA 2VVSA 4EEDA 3B57A 2V6XA 3RQWA 2BYNA 2XHEB 3AE6A 2XM1A 5DQWA 5HWYA 2RA1A 5JTGA 4B3RT 1XNQT 4HFVA 1W0BA 2V5DA 2V5CA 3CQGB 4IE5A 2C5KT 2YMEA 1YXRA 5JQGE 4HWFA 5JH7E 3NZQA 2X68A 2BS2A 3ZN0B 4G63A 2XYTA 4DMVA 5L3EB 4H9SE 1KNPA 4IDZA 2LOPA 1QSDA 2VQET 4U7YA 5AFKA 2W67A 2BBJA 2UXNB 3N2GE 1OWAA 4ZZBA 3SH1A 5LCYA 3AVSA 4GKJT 3N9LA 5F8PA 1B7TA 1S94A 5AQLB 5CO5A 4WNKA 5ABEA 3Q5WA 4ANJA 1T7SA 4H63H 2HHHT 5LYJE 5AQGB 2C9TA 1KNRA 4LF5T 2Q9QD 3ANWB 4KBMB 5LMUT 2BYPA 3WAJA 1G73A 4O2AE 2NWBA 1BR2A 3RRWA 1IBKT 3NRXA 4AFTA 5IUXA 2XSBA 3P4SA 3OJAA 4ILCA 2XQ6A 2YU1A 3U78A 2M6BA 3EDUA 3T1HT 4GK0E 3BK9A 1WYCA 4PFPA 4NZBA 2W2UA 5LGTB 4ZI2C 4JYAT 1OXZA 2FJBA 2LSGA 3VR8A 2I6HA 3PUVF 1BR1A 3E0ZA 2K48A 1HFAA 3NVOA 3HKCE 1FEWA 2UXDT 1WFDA 4ZI7E 2JRKA 4UY2A 2HN2A 3PE0A 1MMDA 3AA7B 2A9UA 3OVUA 3LFMA 2V6YB 2LKHA 5FVKA 2UXCT 3P4QA 2XJ7A 3UQ4A 3RYCE 5DABA 3GN5A 2PJQA 2K5BB 3FHNA 2CLYC 4O2BE 1XMQT 4LF8T 3NRYA 3PUAA 2Y7YA 3HI2A 2C5IT 4XBFB 2YDQA 3CVRA 2KINB 4AQGA 4HFBA 3C64A 4N78D 3FZKB 3PU8A 4ZI3C 3T8OA 4EAHA 3C50A 2VASA 2X9HA 3EI0A 3ZSSA 2ZJUA 1WR6A 1HCIA 4JI5T 1LRZA 5L3BB 3M3ZB 3ETVA 4YTMA 3AXJB 2IC6A 3ZN1B 5AFMA 2WY2A 4ZS3A 3KV4A 3A8YC 4NXNT 3SQ6A 3L3PA 4FJOA 3SWHA 2UXXB 1XDOA 3WTMA 1IJ6A 3J9X1 4B5DA 3AEBA 5JR9C 4WBNE 1LVFA 3RX6A 2QC1B 2AE9A 1E1HB 2WSSV 2VK9A 4DVDA 2J47A 3SFEA 3W15B 4GK5E 5AFHA 2X9XA 4HFDA 5KDMC 3UUMA 1XZYA 3T4MA 4KHZF 3OYXA 2I0MA 2W63A 3AE3A 4KUMB 2NW9A 5ADXL 3C4WA 4IL4A 5HAXA 4U7IA 2BYQA 3PJAA 2J1DG 4A56A 2CMRA 4MLKA 4OFZA 4BA9A 1ZP0A 3PJAJ 3Q2MA 4GYRA 3U8JA 5FMNA 4PFOA 2N1GA 4BQTA 3KFWX 3UUBA 2LM2A 3BQIA 1D1CA 2E9XD 4NUVA 1YW0A 4K0KT 5JMEA 1OEDE 3KV6A 2SPCA 4TNVA 2BKPA 4UM3A 3E22E 2L3LA 2BR7A 3SQ9A 5LGNB 3LK2B 1D0YA 2R6GF 2Z6EA 2K9AA 1UUSA 5AQKB 4IGUA 2LRKA 3L39A 3ZLIA 2IDOB 3WTOA 2H7OA 3UU6A 2HN1A 2K24A 4QXCB 4DV6T 2NOXA 2UUBT 4AKLA 4P0AA 2VVNA 5J5HA 1UCUA 2Q9QC 4UV9B 3AEFA 1WYBA 3EAMA 2KXPB 3UUNA 2Y57A 5AQUB 4EZ4A 2Y8DA 4DBQA 4TV8E 4QAAA 4LF9T 5IWAT 3AEDA 4U33A 2CXLA 4YJ3E 1UV6A 4YTNA 3LJCA 3LG7A 3G06A 4XHEA 3PUQA 2CHOA 2YK0A 2ZM0A 1N34T 4UELA 1D1BA 4PNIA 2LT3A 1M7KA 2LOSA 3EABA 5J5IA 4YTPA 1WRDA 2VL8A 4F8HA 1CHUA 3ZCIA 4JUYA 2BKNA 4PJMA 2UU9T 3AEGA 3ZMZB 4DR1T 4WZXA 2WDRA 4FRRA 1U4QA 3U8KA 2VKJA 3ONJA 4JI1T 4CN4A 2XQ4A 2W66A 3P4PA 4B3MT 2BG9C 4ZHQE 4IIJE 3IA3A 2G0UA 2DI4A 2V26A 2E5VA 3U3IA 3IHRA 4UV8B 4AFGA 3K3NA 2QVAA 5IHYA 3ONXA 4HFEA 3ZDHA 1US7B 3LBXB 3ZYLA 4HQPA 5FKYA 2OA5A 1KF6A 3ZEFB 4IDQA 4O8SA 4GKKT 3RRCA 4ISTA 3UFEA
chains in the Genus database with same CATH topology
3U8LA 2WNCA 2Y57A 3RIAA 4ILBA 4HFIA 5HEUA 3TLSA 3P4WA 4LMLA 4IL4A 4X5TA 2LKHA 5HEJA 2XYTA 4QAAA 2BYQA 4AFHA 2YKSA 3UQ4A 4ZJTA 5AFNA 3UU3A 2PGZA 3C84A 2XQ3A 4EZ1A 5BRXA 1OEDA 5LXBA 2XQ8A 3JADA 3U8MA 2BJ0A 5BP0A 3LSVA 5KZUA 2PH9A 2BR8A 5AFKA 1UV6A 4ZR6A 4ILAA 4UXUA 4TWDA 2Y7YA 1OEDB 4ALXA 2XQ5A 2BYRA 4XHEA 4HFHA 4IL9A 3ZKRA 2BG9A 3U8JA 4A98A 2BG9E 4ZZBA 4QABA 3EHZA 3SH1A 4ZK4A 5HCJA 5J5IA 3U8NA 2WN9A 4BQTA 4WV9A 4HFBA 2W8FA 2XQ7A 4ZJSA 3ZDGA 4BFQA 3UUBA 2LM2A 3PMZA 2BG9B 5LG3A 2M6IA 3RI5A 4ZZCA 5CFBA 2VL0A 2XZ5A 3WTKA 4F8HA 5CO5A 3RHWA 2Y56A 1UX2A 2BYSA 2WZYA 4ZRUA 2YMDA 3EI0A 2WNJA 3UU5A 4QH4A 4LMJA 1OEDE 3WTJA 3UU8A 2ZJUA 3UQ7A 4XK9A 5JMEA 2Y58A 5HEOA 5L47A 3JAEA 4TNVA 2C9TA 4UM3A 2MAWA 5L4EA 4FRRA 5BW2A 2BR7A 4HFCA 3SQ9A 3JAFA 4TWFA 3U8KA 2UZ6A 3RIFA 5J0ZA 1OEDC 3WTNA 4UM3S 4A97A 3TLWA 2BYPA 2ZJVA 5SYOA 3WTLA 4NPPA 5AFMA 2XQ4A 4UM1A 4AFTA 5IUXA 2LKGA 2XQ9A 3SQ6A 5KE4A 4TWHA 4ZK1A 4ILCA 4TNWA 5L4HA 3GUAA 2BG9C 4UM3P 2KSRA 3WIPA 2YOEA 2XQ6A 5J5FA 3WTMA 5J5GA 4LMKA 2XQAA 2YN6A 2M6BA 4QH1A 3RQUA 5AFLA 3SIOA 2X00D 2LLYA 2XNTA 3WTOA 4DBMA 4B5DA 4COFA 2X00A 5HCMA 4AFGA 5FJVA 3TLUA 3RQWA 5HEGA 3UU4A 2BYNA 3UU6A 4NZBA 4Z90A 2QC1B 3WTHA 4HFEA 1UW6A 3ZDHA 5TVCA 3P50A 4HQPA 4Z91A 4QACA 3IGQA 4PIRA 5AINA 5HEHA 4QH5A 3TLVA 2Y54A 1I9BA 2XNVA 2W8GA 5AFJA 2WNLA 3TLTA 2XYSA 4IREA 5J5HA 5AFMB 4D01A 5AFHA 2XZ6A 3PEOA 4HFDA 3EAMA 2XNUA 3WTIA 2YMEA 4UY2A 3T4MA 3C79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8L A;  2WNC A;  2Y57 A;  3RIA A;  4ILB A;  4HFI A;  5HEU A;  3TLS A;  3P4W A;  4LML A;  4IL4 A;  4X5T A;  2LKH A;  5HEJ A;  2XYT A;  4QAA A;  2BYQ A;  4AFH A;  2YKS A;  3UQ4 A;  4ZJT A;  5AFN A;  3UU3 A;  2PGZ A;  3C84 A;  2XQ3 A;  4EZ1 A;  5BRX A;  1OED A;  5LXB A;  2XQ8 A;  3JAD A;  3U8M A;  2BJ0 A;  5BP0 A;  3LSV A;  5KZU A;  2PH9 A;  2BR8 A;  5AFK A;  1UV6 A;  4ZR6 A;  4ILA A;  4UXU A;  4TWD A;  2Y7Y A;  1OED B;  4ALX A;  2XQ5 A;  2BYR A;  4XHE A;  4HFH A;  4IL9 A;  3ZKR A;  2BG9 A;  3U8J A;  4A98 A;  2BG9 E;  4ZZB A;  4QAB A;  3EHZ A;  3SH1 A;  4ZK4 A;  5HCJ A;  5J5I A;  3U8N A;  2WN9 A;  4BQT A;  4WV9 A;  4HFB A;  2W8F A;  2XQ7 A;  4ZJS A;  3ZDG A;  4BFQ A;  3UUB A;  2LM2 A;  3PMZ A;  2BG9 B;  5LG3 A;  2M6I A;  3RI5 A;  4ZZC A;  5CFB A;  2VL0 A;  2XZ5 A;  3WTK A;  4F8H A;  5CO5 A;  3RHW A;  2Y56 A;  1UX2 A;  2BYS A;  2WZY A;  4ZRU A;  2YMD A;  3EI0 A;  2WNJ A;  3UU5 A;  4QH4 A;  4LMJ A;  1OED E;  3WTJ A;  3UU8 A;  2ZJU A;  3UQ7 A;  4XK9 A;  5JME A;  2Y58 A;  5HEO A;  5L47 A;  3JAE A;  4TNV A;  2C9T A;  4UM3 A;  2MAW A;  5L4E A;  4FRR A;  5BW2 A;  2BR7 A;  4HFC A;  3SQ9 A;  3JAF A;  4TWF A;  3U8K A;  2UZ6 A;  3RIF A;  5J0Z A;  1OED C;  3WTN A;  4UM3 S;  4A97 A;  3TLW A;  2BYP A;  2ZJV A;  5SYO A;  3WTL A;  4NPP A;  5AFM A;  2XQ4 A;  4UM1 A;  4AFT A;  5IUX A;  2LKG A;  2XQ9 A;  3SQ6 A;  5KE4 A;  4TWH A;  4ZK1 A;  4ILC A;  4TNW A;  5L4H A;  3GUA A;  2BG9 C;  4UM3 P;  2KSR A;  3WIP A;  2YOE A;  2XQ6 A;  5J5F A;  3WTM A;  5J5G A;  4LMK A;  2XQA A;  2YN6 A;  2M6B A;  4QH1 A;  3RQU A;  5AFL A;  3SIO A;  2X00 D;  2LLY A;  2XNT A;  3WTO A;  4DBM A;  4B5D A;  4COF A;  2X00 A;  5HCM A;  4AFG A;  5FJV A;  3TLU A;  3RQW A;  5HEG A;  3UU4 A;  2BYN A;  3UU6 A;  4NZB A;  4Z90 A;  2QC1 B;  3WTH A;  4HFE A;  1UW6 A;  3ZDH A;  5TVC A;  3P50 A;  4HQP A;  4Z91 A;  4QAC A;  3IGQ A;  4PIR A;  5AIN A;  5HEH A;  4QH5 A;  3TLV A;  2Y54 A;  1I9B A;  2XNV A;  2W8G A;  5AFJ A;  2WNL A;  3TLT A;  2XYS A;  4IRE A;  5J5H A;  5AFM B;  4D01 A;  5AFH A;  2XZ6 A;  3PEO A;  4HFD A;  3EAM A;  2XNU A;  3WTI A;  2YME A;  4UY2 A;  3T4M A;  3C79 A; 
#chains in the Genus database with same CATH topology
 2CWO A;  3ZCJ A;  3O1H A;  3VHL A;  4FI5 A;  5LNK A;  4ERR A;  3VU7 H;  2JPF A;  3HKD E;  5FYM A;  3I1A A;  5FXX A;  2XQY A;  1OED B;  4HFH A;  2DWG A;  3FB2 A;  2FUP A;  5ABF A;  5AQV B;  1XMO T;  5HXR A;  5FY0 A;  4WV9 A;  4BFQ A;  5JR9 A;  4EIW A;  2E2A A;  3RHW A;  2ACX A;  4YHH T;  1MIV A;  3KBU A;  2C0S A;  2J4G A;  3N9N A;  2CRB A;  2X66 A;  2D0T A;  4JEU B;  3P7I A;  4YHJ A;  2MAW A;  4JI8 T;  4KI0 F;  5AQI B;  5J0Z A;  3TLW A;  1IBM T;  3PUS A;  2WZI A;  4UM1 A;  4AI6 A;  5KE4 A;  3GUA A;  4UM3 P;  4AKH A;  2LSI A;  3MKD A;  3SIO A;  2IHR 1;  4WW0 A;  1AJ3 A;  1E2A A;  3ZJ1 A;  4YFS A;  1H7C A;  3PUZ F;  3WTH A;  1G8X A;  2E9X C;  4ILU A;  4EOZ B;  2Y6X A;  5E0O A;  5AQS B;  2A3D A;  1X79 A;  4PAG A;  5AQT B;  2A2F X;  5FVL A;  3TLV A;  4H9R C;  3ZYK A;  2W8G A;  2D5U A;  4TZ4 C;  3N2K E;  4YY3 T;  3CKD A;  2XNU A;  3ZPO A;  3VKH A;  2EHO B;  3IF8 B;  4ILB A;  3UTK A;  3N5L A;  4CQI A;  3RYI E;  5EK2 A;  2XUE A;  2LJL A;  5L3D B;  3V5U A;  2JQ9 A;  4AFH A;  2BBH A;  5F5W A;  4LFC T;  4O4J E;  3UU3 A;  3FZL B;  1XWM A;  5C2T A;  3RH3 A;  5KZU A;  2WDV A;  1HR0 T;  3I9Y A;  5LJM A;  1UX4 A;  2XQ5 A;  2D9D A;  4IL9 A;  4EZH A;  3FZM B;  3RIU C;  1D1A A;  4PJJ A;  3FZF B;  1MNE A;  3B13 A;  2VKO A;  3ZYM A;  2NR4 A;  3DJB A;  3UFG A;  5J1G A;  1MMA A;  5L4E A;  3QK6 A;  4AQF C;  3NBX X;  4PK6 A;  4DV4 T;  2Q9Q A;  3A5X A;  2XAQ B;  4B3S T;  2XQ9 A;  4JI7 T;  1I6Z A;  4TNW A;  4QHO A;  3FZH B;  4Q25 A;  4TX5 A;  3RQU A;  3FXE B;  1WLX A;  3JCF A;  5H6Q B;  3C4X A;  1HNZ T;  4P0B A;  4COF A;  5HCM A;  3PUY F;  2Y48 B;  3ZMS B;  2ZLY A;  1HS7 A;  5L2L A;  3P50 A;  4Z91 A;  3IGQ A;  3AE8 A;  4IE0 A;  3AA1 B;  3I0O A;  4I4T E;  5DQV A;  2PBI A;  3SFD A;  3U8L A;  3T1Y T;  4DO0 A;  2V8S V;  4KX6 A;  2JIW A;  5HEJ A;  4TV9 E;  1BR0 A;  2PGZ A;  4B6X A;  2XQ3 A;  4EZ1 A;  5BRX A;  1HX8 A;  2FJA A;  3PUR A;  4UF0 B;  3SS1 A;  4XAX B;  5EK3 A;  3PU3 A;  2BYR A;  3C51 A;  2BG9 A;  2MTQ A;  2UUA T;  2WMN A;  1YD8 G;  4ZZC A;  3WTK A;  2VL0 A;  5JDH A;  2H88 A;  2KND A;  5FP3 A;  5CB4 E;  2XAS B;  2YDS A;  4G2A A;  2XPK A;  2OV9 A;  5JRC B;  1I94 T;  4HFC A;  1FMV A;  3JAF A;  4L0R A;  3CX7 B;  4ASK A;  5JDG A;  2LHR A;  3AEE A;  3ONL C;  4OX9 T;  2ZJV A;  4H9N C;  5AQR B;  4X64 T;  2P9B A;  3N9P A;  4EB6 E;  3MJX A;  5FNV E;  1IJ5 A;  4U3C A;  3RPU A;  3WI3 A;  2ZM6 T;  4ZK1 A;  3OBV E;  3BQK A;  3PUW F;  3LK4 2;  1KEY A;  3AE2 A;  3QOF A;  2ES0 A;  2CXD A;  4CI3 B;  2J62 A;  5JDM A;  1D0X A;  1VCS A;  2XNV A;  4X1I E;  1W0A A;  1JNR A;  2WM9 A;  3MZK B;  4D01 A;  1ZV4 X;  3VKG A;  1HG5 A;  2LSK A;  3QB5 K;  3RIA A;  3J7Y q;  3CIR A;  2HPJ A;  1DU2 A;  3ZJ2 A;  3H37 A;  3VR9 A;  5FY1 A;  4KP3 C;  5KXJ A;  2XAH B;  4ALX A;  3M65 A;  3QC9 A;  4A98 A;  2BG9 E;  2VQF T;  1J1J A;  5FL0 A;  5CJ5 A;  4MAL A;  1IBL T;  5LG3 A;  2XZ5 A;  3Q9D A;  4H9O C;  2QRX A;  5AQM B;  3RKG A;  2WNJ A;  2KWI B;  2E9X A;  5FXZ A;  1N33 T;  2V7L A;  4UR9 A;  5LJN A;  1UK5 A;  4ZOL E;  4HEA A;  3I9W A;  4JI6 T;  4A97 A;  3WTL A;  2IC9 A;  4UXN B;  3AB3 B;  2KSR A;  4YXD A;  5LBM A;  4DR5 T;  4IDN A;  3L8R A;  1IZN B;  5FL1 A;  4CI1 B;  5H6R B;  3UU4 A;  1NWM X;  4PJL A;  4DR4 T;  3R84 B;  3GA8 A;  2Y54 A;  2B76 A;  3RIU A;  1KFY A;  2EHO D;  1XDP A;  1SHZ C;  2XAJ B;  4DV0 T;  3N9Q A;  5C8Y E;  4HFI A;  2VKH A;  5DJQ C;  3AVR A;  4AQF A;  3H3M A;  3N2O A;  4MBQ A;  5LXB A;  1QUU A;  4YSY A;  2KT9 A;  2IIU A;  5JDF A;  3FXD B;  1R8I A;  3EHZ A;  4LFA T;  1BR4 A;  3EDV A;  3ZT5 A;  3ZMT B;  4AKG A;  4DND A;  4UVC B;  2M67 A;  3ANW A;  2VWA A;  1SE7 A;  4DUY T;  2W0G A;  4QXH B;  2CCQ A;  4IHJ E;  2MPK A;  4UM3 S;  3D0T A;  5SYO A;  2GK9 A;  4NPP A;  2LSJ A;  4TWH A;  2PFV A;  3WIP A;  2YOE A;  5LG4 A;  2XQA A;  4QX8 B;  3AE1 A;  4H9P C;  2NW8 A;  1T8B A;  4TN7 B;  2YEV C;  1WR0 A;  3QNU A;  5HEG A;  3ZMU B;  2ODV A;  4I0U A;  1WCR A;  4HWH A;  3RF1 A;  2VUR A;  5KMG P;  3NZP A;  5LB7 B;  1W09 A;  1FIO A;  4AKR B;  4M1P A;  3KIN B;  2V6Y A;  1V9D A;  5BMV E;  3PUX F;  1S35 A;  4PK5 A;  4X20 E;  4EGW A;  3TLS A;  2V7J A;  1MMG A;  2KLQ A;  4L5G A;  4PW8 A;  5JRC A;  4HWD A;  3AEC A;  2BJ0 A;  5BP0 A;  3LSV A;  4CN6 A;  4YJ2 E;  4DV2 T;  2BR8 A;  1ZOY A;  5AQP B;  1SA0 E;  5A1L A;  3GN5 B;  4E7Z A;  2W62 A;  3DP7 A;  4JLE A;  4DV7 T;  3MAC A;  3U8N A;  2ACZ A;  2W8F A;  2E8I A;  3E08 A;  2BYS A;  1Y01 A;  2WWU A;  5LHH B;  3UU5 A;  4OHF A;  5HEO A;  4U74 A;  3ZC0 A;  2BS3 A;  3AXJ A;  1CUN A;  3F31 A;  3PTR B;  1X9B A;  3WTN A;  1OED C;  4HWC A;  2D2S A;  4UVB B;  4OYJ A;  3EUH A;  2LKG A;  4ZXL A;  4HWI B;  3GWH A;  3CX6 B;  5J5F A;  3NKZ A;  4KHP T;  2YN6 A;  2X00 D;  4DBM A;  3CML A;  1HX1 B;  5FJV A;  5ABG A;  3C98 B;  2UUC T;  4X1K E;  2XY8 B;  2XTL A;  1Z8U A;  1YQ4 A;  4A5X A;  2CPT A;  1I9B A;  5HXS A;  4IDO A;  4QWN B;  4EXT A;  1NEK A;  4QXB B;  1KNZ A;  2AXD S;  2MYS A;  3AAE B;  2RP4 A;  2PG8 A;  3O9X A;  3JC6 D;  1KK7 A;  4ZJT A;  4O4L E;  4X1Y E;  3F57 A;  3HKE E;  4EV6 A;  3OYZ A;  4ILA A;  2CBJ A;  2H89 A;  2WZH A;  3N9O A;  3K1S A;  1YKE B;  3K8P C;  4MFR A;  2XQ7 A;  2L9Q A;  3UUX B;  2M6I A;  2BS4 A;  3Q5D A;  3AE4 A;  2QYW A;  3V5S A;  4CXY A;  3AE9 A;  5LHG B;  4ISS A;  3UU8 A;  4DR6 T;  2XAG B;  4V1A v;  3K3Q C;  2DWK A;  4OYK A;  5J2T E;  2PTF A;  4AQY T;  3CQC B;  2X0Y A;  3RC3 A;  2WMO A;  4GYS A;  1NAF A;  4JI0 T;  2WDQ A;  2WWV A;  3OPC A;  5AFU L;  1Z0P A;  1L0V A;  2BZB A;  4H9Q C;  4QH1 A;  2BVL A;  3AE7 A;  2OLT A;  2DNX A;  3PDY A;  4LF4 T;  4EYY R;  5LMN T;  3IEE A;  5TVC A;  2MBG A;  3CPZ A;  3O1I A;  4DBR A;  5ETW A;  3A7M A;  5HEH A;  3RYH E;  3HR0 A;  5J2U E;  2UXB T;  2WBL A;  2MOZ A;  2LE8 A;  4X65 T;  4U2Y A;  3PEO A;  5LP6 E;  1HNX T;  4BJN A;  1MND A;  2NP9 A;  4JEH B;  1VCT A;  2V7I A;  1O3X A;  2CBI A;  2DCF A;  4B3T T;  5AQH B;  2CE7 A;  3CX8 B;  5CGM A;  5AFN A;  5AQF B;  4XZC A;  5EK4 A;  4TWD A;  3AAA B;  3ZKR A;  4QAB A;  2JQQ A;  3AA6 B;  4K0U A;  5CFB A;  4BJM A;  2D0U A;  2Y56 A;  1D0Z A;  3PV0 F;  3F2E A;  4IT4 A;  1LKX A;  3K3O A;  5HXC A;  4AIU A;  3UT5 E;  2WAU A;  3JAE A;  3H3A A;  3HL6 A;  3ETU A;  2RPA A;  1NEN A;  2UZ6 A;  4Z8X A;  4LF7 T;  4DMW A;  2KWH A;  2B1E A;  3LK3 B;  5JDL A;  4L9I A;  5HXH A;  4DV3 T;  2CM0 A;  4ZS2 A;  2DL1 A;  4YT0 A;  4LMK A;  5LHI B;  2XNT A;  3CWZ B;  2LSY A;  3LBX A;  4CI2 B;  5L3C B;  1UW6 A;  3O4X E;  2W61 A;  5HYA A;  3FBL A;  4PIR A;  2CLY B;  3ZC1 A;  4PJN A;  3TLT A;  4AIS A;  2IAK A;  3KBT A;  1MMN A;  4X5T A;  4EYU A;  5AQO B;  2NTY A;  3ABV A;  5FXW A;  2YKS A;  3PUG A;  3C84 A;  4IE7 A;  1OED A;  5LOV E;  3U8M A;  1T72 A;  4U31 A;  1JNZ A;  4ZR6 A;  2HH7 A;  2LHN A;  2WB5 A;  4AKI A;  3ZDG A;  2X9Y A;  1U5P A;  1UGO A;  3PMZ A;  2H7V C;  5ABF B;  1VRB A;  1UX2 A;  4ZRU A;  5JVD E;  1XNR T;  4LMJ A;  5JR9 B;  4CXX A;  3UQ7 A;  2VKD A;  5F3J A;  3BQL A;  3B5M A;  2H3R A;  1W9R A;  3JC6 C;  5GON E;  3O1J A;  4WYV A;  3ZMV B;  2YDR A;  4UEM A;  4JI3 T;  1ZKE A;  3KVB A;  5HXE A;  2LRL A;  5J5G A;  3ZT6 A;  4DV1 T;  2X0L B;  2ZM8 A;  4DR7 T;  2LEH A;  1T98 A;  3SOL A;  2XZE A;  4QAC A;  4LF6 T;  5AQN B;  1FJG T;  4CN1 A;  4I43 B;  1J5W A;  3QUJ A;  5BR8 T;  2X51 A;  2EHO A;  4IRE A;  2XZ6 A;  3WAK A;  3DTO A;  3S4U A;  3TKL B;  4J2C A;  4JV5 T;  2N9D A;  3C79 A;  5AQQ B;  3RGL A;  2BDE A;  4KMC A;  3P4W A;  2JJ9 A;  4NUU A;  4JI4 T;  4U72 A;  5TAO A;  2E5L T;  2BVM A;  2X9W A;  5HWX A;  5C3J A;  5L3G B;  4F6R C;  4CZZ B;  3EVY A;  4I55 E;  3RYF E;  4ZK4 A;  3KV9 A;  3X1D A;  3QB5 A;  4JI2 T;  2ODU A;  3HA4 A;  1YQ3 A;  4XK9 A;  2Y58 A;  1GQE A;  2KMF A;  1FMW A;  4GIW A;  2ZMA A;  3ZST A;  1YKH B;  2W00 A;  5EZY E;  4DUZ T;  3ESL A;  2VB6 A;  4X66 T;  2WP9 A;  4LFB T;  1IAP A;  4DV5 T;  5L3F B;  2Q9Q B;  3IBP A;  3UUL A;  5AFL A;  4UVA B;  3AEA A;  4YLH A;  3TLU A;  1QLB A;  2CHN A;  2WU5 A;  5CA0 E;  4ZEY A;  4NXM T;  5AIN A;  3AAI A;  4YSZ A;  3Q5E A;  1N32 T;  3MA9 A;  5AFJ A;  3FBZ A;  4OK0 A;  2WNL A;  2XYS A;  2V1D B;  5LGU B;  2WU2 A;  1HTJ F;  2KZ7 B;  2JMH A;  3RLF F;  4IE6 A;  2CA5 A;  2WNC A;  1ZHC A;  1EZ3 A;  2FJD A;  1SUM B;  4UF0 A;  1M62 A;  3P4R A;  4TUY E;  4JBW F;  3P8C D;  2XQ8 A;  2DHR A;  3JAD A;  2C5J A;  2WS3 A;  3CQX C;  2PH9 A;  5KX5 E;  2V7M A;  3L09 A;  1MIY A;  2A72 A;  4IE4 A;  2LM9 A;  5ABH A;  5HCJ A;  5LA6 E;  2I59 A;  3VRB A;  2CXF A;  2FJE A;  2BG9 B;  2DLR A;  4ZI2 D;  5FXV A;  2FBW A;  3AE5 A;  4DID B;  3MK7 C;  3VRA A;  2YMD A;  2YIN A;  3CK6 A;  4QH4 A;  5LXT E;  5FY7 A;  4O4H E;  5L47 A;  2F4V T;  3RKO A;  4P09 A;  2X0H A;  2ZM2 A;  3RIF A;  4WBO A;  5JDN A;  2QA7 A;  4DR3 T;  5LBQ B;  2JQH A;  3KVA A;  4HTE A;  1HF8 A;  1UX5 A;  4ADZ A;  5JRE A;  1E7P A;  2LLY A;  4HE8 A;  4O4I E;  4PK4 A;  2NTX A;  2X00 A;  2N2N A;  3R6N A;  2XSA A;  4QX7 B;  4Z90 A;  2L8K A;  4I50 E;  1UUR A;  4UIG A;  4NIQ A;  3AA0 B;  4QH5 A;  2XAF B;  4C90 A;  3LDQ B;  2XM2 A;  4E7S A;  4ZI3 D;  5AFM B;  2W4X A;  3OKQ A;  1VOM A;  3WTI A;  4U2Z A;  2WQY A;  1N36 T;  2YU2 A;  2X67 A;  2IUB A;  4C91 A;  1HNW T;  1Y64 B;  5HEU A;  3ZT7 A;  4LML A;  1LVK A;  3KDS E;  4HN9 A;  4IDP A;  5CA1 E;  4EEB A;  2JQK A;  4DR2 T;  3MXZ A;  4MHC A;  4YSX A;  4UXU A;  3I0Q A;  4BAY B;  4P1N A;  2HPL A;  3SRZ A;  4AXP A;  2WN9 A;  2JMK A;  4GOU A;  5IYZ E;  4ZJS A;  2CEA A;  3RI5 A;  3C4Z A;  3N9M A;  5M4Y A;  4HGA A;  2WZY A;  3NWI A;  3Q5X A;  3WTJ A;  4H63 V;  2NW7 A;  5JDQ A;  3HKB E;  2QGS A;  4HKA A;  2E9X B;  3KV5 A;  5BW2 A;  4TWF A;  2K3W A;  2V7K A;  2BKO A;  2IML A;  2IW5 B;  4CXW A;  1MIW A;  3RC8 A;  2EHO C;  5AQJ B;  2WCA A;  2CWY A;  4QKN A;  1HG2 A;  4X62 T;  5L4H A;  1ZEE A;  3OTO T;  1J5E T;  3GMI A;  2VVS A;  4EED A;  3B57 A;  2V6X A;  3RQW A;  2BYN A;  2XHE B;  3AE6 A;  2XM1 A;  5DQW A;  5HWY A;  2RA1 A;  5JTG A;  4B3R T;  1XNQ T;  4HFV A;  1W0B A;  2V5D A;  2V5C A;  3CQG B;  4IE5 A;  2C5K T;  2YME A;  1YXR A;  5JQG E;  4HWF A;  5JH7 E;  3NZQ A;  2X68 A;  2BS2 A;  3ZN0 B;  4G63 A;  2XYT A;  4DMV A;  5L3E B;  4H9S E;  1KNP A;  4IDZ A;  2LOP A;  1QSD A;  2VQE T;  4U7Y A;  5AFK A;  2W67 A;  2BBJ A;  2UXN B;  3N2G E;  1OWA A;  4ZZB A;  3SH1 A;  5LCY A;  3AVS A;  4GKJ T;  3N9L A;  5F8P A;  1B7T A;  1S94 A;  5AQL B;  5CO5 A;  4WNK A;  5ABE A;  3Q5W A;  4ANJ A;  1T7S A;  4H63 H;  2HHH T;  5LYJ E;  5AQG B;  2C9T A;  1KNR A;  4LF5 T;  2Q9Q D;  3ANW B;  4KBM B;  5LMU T;  2BYP A;  3WAJ A;  1G73 A;  4O2A E;  2NWB A;  1BR2 A;  3RRW A;  1IBK T;  3NRX A;  4AFT A;  5IUX A;  2XSB A;  3P4S A;  3OJA A;  4ILC A;  2XQ6 A;  2YU1 A;  3U78 A;  2M6B A;  3EDU A;  3T1H T;  4GK0 E;  3BK9 A;  1WYC A;  4PFP A;  4NZB A;  2W2U A;  5LGT B;  4ZI2 C;  4JYA T;  1OXZ A;  2FJB A;  2LSG A;  3VR8 A;  2I6H A;  3PUV F;  1BR1 A;  3E0Z A;  2K48 A;  1HFA A;  3NVO A;  3HKC E;  1FEW A;  2UXD T;  1WFD A;  4ZI7 E;  2JRK A;  4UY2 A;  2HN2 A;  3PE0 A;  1MMD A;  3AA7 B;  2A9U A;  3OVU A;  3LFM A;  2V6Y B;  2LKH A;  5FVK A;  2UXC T;  3P4Q A;  2XJ7 A;  3UQ4 A;  3RYC E;  5DAB A;  3GN5 A;  2PJQ A;  2K5B B;  3FHN A;  2CLY C;  4O2B E;  1XMQ T;  4LF8 T;  3NRY A;  3PUA A;  2Y7Y A;  3HI2 A;  2C5I T;  4XBF B;  2YDQ A;  3CVR A;  2KIN B;  4AQG A;  4HFB A;  3C64 A;  4N78 D;  3FZK B;  3PU8 A;  4ZI3 C;  3T8O A;  4EAH A;  3C50 A;  2VAS A;  2X9H A;  3EI0 A;  3ZSS A;  2ZJU A;  1WR6 A;  1HCI A;  4JI5 T;  1LRZ A;  5L3B B;  3M3Z B;  3ETV A;  4YTM A;  3AXJ B;  2IC6 A;  3ZN1 B;  5AFM A;  2WY2 A;  4ZS3 A;  3KV4 A;  3A8Y C;  4NXN T;  3SQ6 A;  3L3P A;  4FJO A;  3SWH A;  2UXX B;  1XDO A;  3WTM A;  1IJ6 A;  3J9X 1;  4B5D A;  3AEB A;  5JR9 C;  4WBN E;  1LVF A;  3RX6 A;  2QC1 B;  2AE9 A;  1E1H B;  2WSS V;  2VK9 A;  4DVD A;  2J47 A;  3SFE A;  3W15 B;  4GK5 E;  5AFH A;  2X9X A;  4HFD A;  5KDM C;  3UUM A;  1XZY A;  3T4M A;  4KHZ F;  3OYX A;  2I0M A;  2W63 A;  3AE3 A;  4KUM B;  2NW9 A;  5ADX L;  3C4W A;  4IL4 A;  5HAX A;  4U7I A;  2BYQ A;  3PJA A;  2J1D G;  4A56 A;  2CMR A;  4MLK A;  4OFZ A;  4BA9 A;  1ZP0 A;  3PJA J;  3Q2M A;  4GYR A;  3U8J A;  5FMN A;  4PFO A;  2N1G A;  4BQT A;  3KFW X;  3UUB A;  2LM2 A;  3BQI A;  1D1C A;  2E9X D;  4NUV A;  1YW0 A;  4K0K T;  5JME A;  1OED E;  3KV6 A;  2SPC A;  4TNV A;  2BKP A;  4UM3 A;  3E22 E;  2L3L A;  2BR7 A;  3SQ9 A;  5LGN B;  3LK2 B;  1D0Y A;  2R6G F;  2Z6E A;  2K9A A;  1UUS A;  5AQK B;  4IGU A;  2LRK A;  3L39 A;  3ZLI A;  2IDO B;  3WTO A;  2H7O A;  3UU6 A;  2HN1 A;  2K24 A;  4QXC B;  4DV6 T;  2NOX A;  2UUB T;  4AKL A;  4P0A A;  2VVN A;  5J5H A;  1UCU A;  2Q9Q C;  4UV9 B;  3AEF A;  1WYB A;  3EAM A;  2KXP B;  3UUN A;  2Y57 A;  5AQU B;  4EZ4 A;  2Y8D A;  4DBQ A;  4TV8 E;  4QAA A;  4LF9 T;  5IWA T;  3AED A;  4U33 A;  2CXL A;  4YJ3 E;  1UV6 A;  4YTN A;  3LJC A;  3LG7 A;  3G06 A;  4XHE A;  3PUQ A;  2CHO A;  2YK0 A;  2ZM0 A;  1N34 T;  4UEL A;  1D1B A;  4PNI A;  2LT3 A;  1M7K A;  2LOS A;  3EAB A;  5J5I A;  4YTP A;  1WRD A;  2VL8 A;  4F8H A;  1CHU A;  3ZCI A;  4JUY A;  2BKN A;  4PJM A;  2UU9 T;  3AEG A;  3ZMZ B;  4DR1 T;  4WZX A;  2WDR A;  4FRR A;  1U4Q A;  3U8K A;  2VKJ A;  3ONJ A;  4JI1 T;  4CN4 A;  2XQ4 A;  2W66 A;  3P4P A;  4B3M T;  2BG9 C;  4ZHQ E;  4IIJ E;  3IA3 A;  2G0U A;  2DI4 A;  2V26 A;  2E5V A;  3U3I A;  3IHR A;  4UV8 B;  4AFG A;  3K3N A;  2QVA A;  5IHY A;  3ONX A;  4HFE A;  3ZDH A;  1US7 B;  3LBX B;  3ZYL A;  4HQP A;  5FKY A;  2OA5 A;  1KF6 A;  3ZEF B;  4IDQ A;  4O8S A;  4GKK T;  3RRC A;  4IST A;  3UFE A; 
#chains in the Genus database with same CATH homology
 3U8L A;  2WNC A;  2Y57 A;  3RIA A;  4ILB A;  4HFI A;  5HEU A;  3TLS A;  3P4W A;  4LML A;  4IL4 A;  4X5T A;  2LKH A;  5HEJ A;  2XYT A;  4QAA A;  2BYQ A;  4AFH A;  2YKS A;  3UQ4 A;  4ZJT A;  5AFN A;  3UU3 A;  2PGZ A;  3C84 A;  2XQ3 A;  4EZ1 A;  5BRX A;  1OED A;  5LXB A;  2XQ8 A;  3JAD A;  3U8M A;  2BJ0 A;  5BP0 A;  3LSV A;  5KZU A;  2PH9 A;  2BR8 A;  5AFK A;  1UV6 A;  4ZR6 A;  4ILA A;  4UXU A;  4TWD A;  2Y7Y A;  1OED B;  4ALX A;  2XQ5 A;  2BYR A;  4XHE A;  4HFH A;  4IL9 A;  3ZKR A;  2BG9 A;  3U8J A;  4A98 A;  2BG9 E;  4ZZB A;  4QAB A;  3EHZ A;  3SH1 A;  4ZK4 A;  5HCJ A;  5J5I A;  3U8N A;  2WN9 A;  4BQT A;  4WV9 A;  4HFB A;  2W8F A;  2XQ7 A;  4ZJS A;  3ZDG A;  4BFQ A;  3UUB A;  2LM2 A;  3PMZ A;  2BG9 B;  5LG3 A;  2M6I A;  3RI5 A;  4ZZC A;  5CFB A;  2VL0 A;  2XZ5 A;  3WTK A;  4F8H A;  5CO5 A;  3RHW A;  2Y56 A;  1UX2 A;  2BYS A;  2WZY A;  4ZRU A;  2YMD A;  3EI0 A;  2WNJ A;  3UU5 A;  4QH4 A;  4LMJ A;  1OED E;  3WTJ A;  3UU8 A;  2ZJU A;  3UQ7 A;  4XK9 A;  5JME A;  2Y58 A;  5HEO A;  5L47 A;  3JAE A;  4TNV A;  2C9T A;  4UM3 A;  2MAW A;  5L4E A;  4FRR A;  5BW2 A;  2BR7 A;  4HFC A;  3SQ9 A;  3JAF A;  4TWF A;  3U8K A;  2UZ6 A;  3RIF A;  5J0Z A;  1OED C;  3WTN A;  4UM3 S;  4A97 A;  3TLW A;  2BYP A;  2ZJV A;  5SYO A;  3WTL A;  4NPP A;  5AFM A;  2XQ4 A;  4UM1 A;  4AFT A;  5IUX A;  2LKG A;  2XQ9 A;  3SQ6 A;  5KE4 A;  4TWH A;  4ZK1 A;  4ILC A;  4TNW A;  5L4H A;  3GUA A;  2BG9 C;  4UM3 P;  2KSR A;  3WIP A;  2YOE A;  2XQ6 A;  5J5F A;  3WTM A;  5J5G A;  4LMK A;  2XQA A;  2YN6 A;  2M6B A;  4QH1 A;  3RQU A;  5AFL A;  3SIO A;  2X00 D;  2LLY A;  2XNT A;  3WTO A;  4DBM A;  4B5D A;  4COF A;  2X00 A;  5HCM A;  4AFG A;  5FJV A;  3TLU A;  3RQW A;  5HEG A;  3UU4 A;  2BYN A;  3UU6 A;  4NZB A;  4Z90 A;  2QC1 B;  3WTH A;  4HFE A;  1UW6 A;  3ZDH A;  5TVC A;  3P50 A;  4HQP A;  4Z91 A;  4QAC A;  3IGQ A;  4PIR A;  5AIN A;  5HEH A;  4QH5 A;  3TLV A;  2Y54 A;  1I9B A;  2XNV A;  2W8G A;  5AFJ A;  2WNL A;  3TLT A;  2XYS A;  4IRE A;  5J5H A;  5AFM B;  4D01 A;  5AFH A;  2XZ6 A;  3PEO A;  4HFD A;  3EAM A;  2XNU A;  3WTI A;  2YME A;  4UY2 A;  3T4M A;  3C79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...