3P50A

Structure of propofol bound to a pentameric ligand-gated ion channel, glic
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
publication title X-ray structures of general anaesthetics bound to a pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3p50A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3p50A01
2X00A 4NPPA 5HEGA 5IUXA 5AFMB 5AFMA 3RHWA 2QC1B 3TLSA 5HEOA 4BFQA 3SQ6A 4UM3A 4X5TA 4ILAA 5J5IA 4LMJA 3SIOA 3RQWA 2VL0A 2XYTA 4UM1A 2BYPA 2BYNA 5JMEA 5HCMA 1OEDE 4Z91A 2ZJVA 5KZUA 3SQ9A 3U8MA 4A97A 3U8LA 2WN9A 2PH9A 5TVCA 5BRXA 4HFIA 2BR8A 4Z90A 4QH5A 3PEOA 5L47A 4XHEA 4COFA 3WIPA 4NZBA 2PGZA 5CO5A 5BW2A 4ZZCA 5CFBA 4LMLA 2YMEA 2BR7A 5L4HA 3TLWA 5LG3A 2W8FA 3PMZA 4FRRA 4HFHA 4UM3S 2YOEA 3TLTA 2Y57A 4BQTA 2WNJA 3WTMA 4AFHA 4ZJSA 3UU4A 2XQ6A 3JADA 2UZ6A 4UXUA 5AFKA 4TWFA 2X00D 2BG9B 5AFJA 2BG9A 4A98A 2XQ8A 1OEDC 2LM2A 2MAWA 3TLUA 4HFEA 3WTIA 5KE4A 3P50A 1UV6A 2LKGA 4XK9A 5J5GA 3EAMA 4IL4A 3UU3A 2Y7YA 2M6IA 5HEUA 2BYQA 5HCJA 2YMDA 2WNCA 2XQ7A 4EZ1A 2BJ0A 2BYRA 2WZYA 4TWDA 3RI5A 3P4WA 4UM3P 4QAAA 5L4EA 5AFLA 3WTNA 4ILBA 2LKHA 2XZ6A 3C84A 3RIFA 3ZDGA 2LLYA 2XQ5A 4ALXA 4ZJTA 5AINA 4LMKA 2KSRA 3SH1A 2M6BA 5BP0A 3U8JA 2XQ9A 3WTLA 2XQ4A 3C79A 4UY2A 3UU6A 4ZK1A 5AFHA 2Y58A 1I9BA 5J5HA 3WTHA 3LSVA 2Y56A 4F8HA 2XQ3A 4HFDA 3JAFA 1UW6A 4IREA 2XNUA 2ZJUA 3T4MA 3UU8A 2YN6A 2XNVA 3WTKA 5J0ZA 1OEDB 2BG9E 4TNWA 1OEDA 3UUBA 3TLVA 2XNTA 4ZRUA 5LXBA 3WTOA 4QABA 2BYSA 4B5DA 4ZR6A 4ZK4A 3GUAA 3EHZA 4ILCA 3ZKRA 2C9TA 3U8KA 4HQPA 5FJVA 2XYSA 3EI0A 5HEHA 3RQUA 4IL9A 3JAEA 3UQ4A 4QH4A 3RIAA 1UX2A 5AFNA 5SYOA 4HFBA 4AFTA 2WNLA 4PIRA 4ZZBA 4WV9A 2Y54A 4AFGA 3UU5A 3UQ7A 2XZ5A 3IGQA 3U8NA 3WTJA 4TNVA 2XQAA 4HFCA 5HEJA 4TWHA 2BG9C 4D01A 4DBMA 3ZDHA 4QACA 2W8GA 4QH1A 5J5FA 2YKSA
chains in the Genus database with same CATH superfamily
5DABA 3UUMA 2QC1B 4DBQA 5FY1A 5AQQB 4LMJA 1WR0A 3DP7A 5A1LA 2HPLA 3ABVA 2XAGB 3LBXB 1XNQT 3WIPA 2H7VC 4LMLA 4PJLA 2ACZA 2E5LT 3AA0B 2WMNA 5AFJA 3L8RA 2G0UA 3VU7H 2HPJA 2XM1A 3PJAJ 4UEMA 3CPZA 4JUYA 4M1PA 5JDMA 1XDPA 5ABGA 3RI5A 1MMAA 1BR0A 3V5SA 2KWHA 5AINA 5IHYA 2KSRA 1MNDA 4EOZB 3RRWA 3QOFA 2EHOA 2AE9A 3MKDA 2LHRA 2V6XA 3AEGA 3VHLA 4ZRUA 5AQMB 4CZZB 2BYSA 2V7KA 1XZYA 5LGNB 2WSSV 5FXXA 2V5CA 3RQUA 5LMNT 4HGAA 4H9QC 4CI3B 3I0OA 5C8YE 4O4HE 3AEDA 2WM9A 5L3BB 5HEJA 3AAIA 2LE8A 3L09A 4DV7T 3RC3A 4AIUA 4P0BA 3KV5A 2D0UA 3J7Yq 3N9QA 5J5IA 2XYTA 2BYNA 2OLTA 5EK3A 1GQEA 2ODUA 3FBZA 2PGZA 4AQGA 4HFHA 3N9OA 5L3FB 1O3XA 5L3EB 4DBRA 5AQRB 1IBKT 3E08A 4ZS3A 4B3MT 4TWFA 2BG9A 2LM2A 3QNUA 3AXJA 4GIWA 4I55E 1KK7A 2BJ0A 2IC9A 2D0TA 1FMVA 3JCFA 3AAEB 3CVRA 1BR4A 5JQGE 2CLYC 3R6NA 3ZMVB 3O1IA 4PK5A 4WNKA 2V6YB 5J5HA 2A2FX 4ZOLE 2CWOA 5BMVE 2X67A 2VKOA 3ZN1B 2XQYA 3P4PA 1ZEEA 5LJMA 1D0YA 3AB3B 4LF4T 2XAFB 3JC6D 2Q9QD 3A8YC 5HXCA 3SFDA 5FJVA 1XMOT 2I0MA 1LVFA 3OYZA 4AKLA 1IAPA 2CLYB 3CX8B 3C64A 1T72A 3IGQA 4PJJA 1N33T 1OWAA 4TWHA 4YY3T 3VRBA 4IE7A 5J2UE 2XZEA 4AQYT 5F8PA 1FEWA 2ZM8A 2XAJB 4UVCB 2ZLYA 2CHNA 2DLRA 5LG3A 4AKHA 2K3WA 3VR8A 5H6QB 4O4LE 1MIYA 3CQCB 2V5DA 5KDMC 5FMNA 3EVYA 2XQ6A 1I6ZA 5J2TE 2X66A 1CUNA 2MAWA 2X0LB 4YTNA 3IA3A 5AFUL 1KEYA 2VB6A 4DIDB 2L8KA 2W61A 5L3CB 3GN5A 3ZSTA 1HS7A 3ZPOA 4JI3T 4WW0A 4YFSA 2BKOA 5FY0A 4CN6A 4PW8A 4OHFA 3RPUA 4JYAT 4TNWA 1W9RA 3ZMTB 2E9XB 2C5IT 5ADXL 3CK6A 1ZOYA 4IGUA 3WTJA 3HI2A 4HFCA 3RYFE 4HTEA 3LG7A 5HEGA 4CQIA 4UM3A 3OKQA 2ODVA 3RQWA 4UM1A 1OEDE 5FKYA 5LMUT 1Z8UA 3GMIA 3AAAB 2VURA 3N2KE 3ZJ2A 4PAGA 1D0ZA 5CFBA 5L4HA 4ZI7E 4U2ZA 4AFHA 3ONXA 4QXHB 4EEDA 4DV2T 4A98A 1HG5A 1QSDA 3K8PC 3ZMSB 2CBJA 2QGSA 5HCJA 2MYSA 1UURA 3MK7C 3EUHA 2A72A 2E2AA 4DMVA 3RYCE 1G8XA 3P8CD 5J1GA 5AFHA 3LSVA 4DV1T 1R8IA 3ETVA 3N2OA 1E1HB 2BS3A 5HXSA 4DR6T 2V8SV 4KHZF 4U7YA 2H89A 3PUZF 4Q25A 1YQ3A 2NTXA 4OYJA 2CXFA 5JRCA 4B5DA 4ZK4A 2JPFA 4B3RT 4HEAA 5ABEA 5HEHA 1Z0PA 4P09A 4TV9E 4G2AA 4H9SE 3Q5WA 2J1DG 4DBMA 3M65A 4DUZT 3IF8B 3T1HT 2UXDT 1KNRA 4KP3C 2MOZA 3S4UA 5IUXA 2JQ9A 1D0XA 2XSBA 3NZQA 4J2CA 2D5UA 2WCAA 3D0TA 3NRYA 1AJ3A 4NUUA 4EAHA 2ACXA 2BR7A 3TLWA 2W66A 4U31A 4KBMB 5AQOB 5CB4E 3ZCIA 3N5LA 3ZYLA 4ADZA 2XQ8A 1VCTA 3O1HA 4DR5T 3C98B 2WZYA 5HXHA 2N1GA 1WCRA 3P4WA 2FJAA 4ZI2C 2NP9A 3ZDGA 5LXTE 3HKBE 3VRAA 4TUYE 3I9WA 4CI2B 2Y58A 2Y56A 3K3NA 3T4MA 4LFCT 1U4QA 2H7OA 4QKNA 4H63H 3Q5EA 4X66T 3EI0A 1HX1B 2HN2A 4CN1A 3P4QA 4HFBA 4PIRA 4ZZBA 3H3AA 4MHCA 5ABFB 3A5XA 1J1JA 3N9LA 2W8GA 4X1YE 5J5FA 3LJCA 3TLSA 4ISTA 4LF5T 2W62A 5HXEA 2UXCT 1HX8A 3PUVF 4H9RC 3HKEE 2RA1A 2VL8A 3U8LA 5LHIB 2V26A 4TX5A 2Q9QA 3AE5A 2KNDA 3EABA 5H6RB 2NOXA 3A7MA 2EHOC 2W00A 3RLFF 4ASKA 1HR0T 2UUAT 4FI5A 5KE4A 2LKGA 5J5GA 3VKHA 2X0HA 4X1IE 1YQ4A 3PE0A 4XZCA 3PJAA 4KMCA 1SHZC 2VQET 4QAAA 2FJBA 3AECA 3FZHB 5HYAA 1XDOA 4LF8T 4QHOA 5IYZE 3ZT7A 4MLKA 4BA9A 1WR6A 2PTFA 4H9PC 4YHJA 4L5GA 4WBNE 3HR0A 4ZK1A 4PK4A 4I43B 3SFEA 3ZC1A 5FXVA 2EHOB 3PTRB 5F3JA 1KNPA 5CA0E 2K24A 2XNVA 2WDVA 3WTOA 4QABA 3GUAA 4GK0E 4U72A 5HXRA 4YJ2E 5FXWA 2XY8B 2WMOA 4NIQA 4QH4A 3RIAA 2NTYA 4IDQA 2Y54A 4UV9B 2CRBA 2KINB 4YSXA 4ANJA 4OX9T 2BG9C 1ZP0A 1H7CA 2AXDS 2WU5A 3NZPA 2YKSA 3HKDE 3RHWA 5HEOA 4EZHA 2FJEA 3T8OA 1I94T 2X0YA 3Q5DA 2WN9A 5BRXA 4B6XA 3OYXA 4HFIA 2VWAA 2M67A 4XHEA 2X9HA 3NBXX 4UM3S 4BQTA 3WTMA 3KFWX 1HG2A 5FVLA 3UU4A 3RYHE 2UZ6A 5AFKA 4DR3T 2BG9B 2CXDA 2BBHA 3AXJB 3ZT6A 3UFGA 4XK9A 1OXZA 5FYMA 1JNRA 2WBLA 4O2BE 1WYCA 1ZKEA 3WTNA 2WAUA 2XZ6A 3RIFA 2CXLA 2WDRA 2WU2A 1T98A 2XQ9A 2XQ4A 4YLHA 5AQLB 2KLQA 1HNXT 1CHUA 4F8HA 1MIWA 1YW0A 2XQ3A 4HFDA 1UW6A 2XNUA 4QWNB 1L0VA 3KV9A 4OYKA 3RIUC 3RX6A 2DWGA 5HWXA 3PU8A 3C4XA 5AQVB 2BZBA 4JI1T 2CCQA 3UQ4A 1XWMA 4XAXB 2XPKA 4WV9A 3UQ7A 2IC6A 4BAYB 3F57A 2XQAA 4DV3T 3O9XA 3DJBA 3SWHA 1YKHB 2X00A 3SQ6A 1B7TA 4AXPA 3R84B 2XM2A 3QB5K 5JMEA 4DR1T 2VKHA 3SQ9A 2PH9A 2WP9A 2BR8A 3PEOA 5AQKB 1EZ3A 2WZHA 4UVAB 5L47A 2YEVC 4ZI2D 5BW2A 5AQUB 5CGMA 2NW7A 2LT3A 2XAHB 4IE5A 4KX6A 4B3ST 4GKJT 4DMWA 2D9DA 4DUYT 2WB5A 3ZMUB 3HKCE 5DQVA 2Y7YA 2CEAA 4DV6T 5FVKA 4EZ1A 4YT0A 5AQGB 4TWDA 4IIJE 1HNWT 2IIUA 4ILBA 4ALXA 4JBWF 2LSKA 3ZN0B 5L3DB 4EZ4A 4DR4T 2Y6XA 3C51A 4UY2A 3B13A 2JMHA 3AE8A 2BVLA 4A5XA 3U3IA 2DWKA 2XNTA 1MMGA 4L0RA 5JDHA 1J5WA 5FL0A 1W0AA 1HNZT 3FXEB 2XZ5A 2EHOD 4KI0F 3ONLC 3OVUA 4WBOA 3ZLIA 4NPPA 3B57A 2W2UA 4EYYR 3RGLA 5HWYA 3IEEA 2MTQA 2I6HA 1W0BA 4B3TT 3U78A 3UUXB 2VL0A 2E8IA 2BS4A 5LCYA 2H3RA 5JR9A 4IE6A 2UUCT 2C5JA 3AE4A 3AE9A 4X62T 3NVOA 2P9BA 2YMEA 4X20E 4ZJSA 5JDNA 4GOUA 1SUMB 3ANWB 5AQHB 3W15B 2YK0A 3N2GE 3UU3A 2M6IA 4ZI3C 3AE7A 3RH3A 2V1DB 1NWMX 4IDNA 4UM3P 4UF0A 3ZMZB 2OV9A 2XUEA 1YXRA 4HWCA 3SH1A 2X9XA 4YXDA 2E9XA 2M6BA 5JDQA 3H37A 2ES0A 1UUSA 3O4XE 3WTHA 4DV4T 4P0AA 3RKOA 3ZYMA 2UXNB 3HA4A 2X9YA 4YSZA 3WAKA 1OEDA 2WWVA 3PUYF 4I4TE 2YU2A 5KMGP 1BR1A 3OTOT 4LFBT 4TV8E 4G63A 4I50E 5SYOA 2LSJA 5LYJE 4X64T 3OBVE 2WDQA 2LM9A 4QACA 2DHRA 1D1BA 3VKGA 4O2AE 1IJ5A 4EEBA 5AQSB 4IT4A 4LF6T 2KT9A 4HWHA 4QXCB 2IMLA 5KZUA 4EXTA 3N9MA 4UXNB 3PUGA 4X65T 1KFYA 1DU2A 3CWZB 2YOEA 1FIOA 2CE7A 3L39A 3ZEFB 3P4SA 3AVRA 4AQFA 1ZV4X 2K48A 5FL1A 3ZCJA 3EAMA 2HH7A 1UGOA 4YTMA 4JEHB 3RYIE 2K5BB 4LFAT 3ZC0A 1XMQT 2LKHA 2ZM2A 5JVDE 4DR7T 3C84A 2CM0A 2J47A 2LSYA 1YKEB 4OK0A 5BP0A 4U7IA 3GA8A 2DNXA 3AEEA 4HWFA 3O1JA 4DO0A 2KXPB 1SE7A 4JEUB 3NWIA 2QVAA 5J0ZA 1IBLT 3MZKB 2CHOA 3NKZA 5LHGB 4AKIA 2C9TA 3PUXF 5TAOA 1KNZA 1W09A 4WZXA 3ZYKA 3MACA 4K0UA 3KBUA 4U74A 2YINA 2DL1A 1UX4A 4CI1B 1E2AA 4QX8B 5AFMA 5LB7B 4ILAA 3ZJ1A 4Z8XA 2JQQA 3Q9DA 4U2YA 2ZJVA 3NRXA 2WZIA 4DVDA 5AQPB 4NZBA 3CQGB 2FJDA 2KZ7B 2WNJA 3BQKA 2IUBA 2CPTA 5FXZA 3FZMB 2A3DA 5EK4A 3AEBA 4HFEA 5E0OA 3I0QA 3FBLA 1HTJF 3M3ZB 4IL4A 5HEUA 4QX7B 3QB5A 2BYRA 3SOLA 3PU3A 2UXBT 5AFLA 4H9OC 2XASB 4HWIB 5FY7A 4ZEYA 5JREA 3LK2B 4ZJTA 3F2EA 1N36T 4TN7B 1X79A 4DV0T 3C50A 5ABHA 5ABFA 5LBQB 4JI0T 3IHRA 3EDVA 2ZJUA 1NAFA 2XTLA 2X68A 1WYBA 3I1AA 2BKPA 3WI3A 5LXBA 2NR4A 4GYSA 3FZFB 3U8KA 2X9WA 3PV0F 2DI4A 5JTGA 1US7B 4GKKT 2RP4A 5JDLA 5AFNA 4BJMA 3QK6A 3IBPA 2V7LA 5KXJA 2VVNA 5LG4A 3ZDHA 4KHPT 2F4VT 2WS3A 5IWAT 2PJQA 4EV6A 4YHHT 4BFQA 4X5TA 2LHNA 2W0GA 3SIOA 4JV5T 4ZI3D 4Z91A 5LGUB 5TVCA 4QH5A 3LBXA 5CO5A 2XHEB 3AA7B 4AKGA 3FHNA 4O4IE 4JLEA 4JI6T 2A9UA 4U3CA 1MIVA 4C91A 3WTIA 3AE2A 4PJMA 2BYQA 4ISSA 2XQ7A 2JMKA 2WY2A 3PURA 2BS2A 1S35A 2C0SA 2QRXA 1LKXA 5GONE 2YDRA 4ERRA 1X9BA 3CKDA 1Y64B 2L3LA 1NEKA 4A56A 4DNDA 3LK3B 3UTKA 1I9BA 5AQFB 4HWDA 3V5UA 4IDZA 2YN6A 4IE0A 3WTKA 3LDQB 5AQJB 5AQIB 2BG9E 4N78D 4ZR6A 3HL6A 2BVMA 4BJNA 4HKAA 4LF9T 4V1Av 4IL9A 2K9AA 4AFTA 1VCSA 3SRZA 2C5KT 3U8NA 4IE4A 3UUNA 2CBIA 2YDQA 4TNVA 1VOMA 3E0ZA 1M7KA 1MMDA 1FJGT 2R6GF 3CQXC 2IHR1 3T1YT 2BYPA 4U33A 2VQFT 1S94A 1KF6A 3KBTA 5LOVE 4ZXLA 2HN1A 4ZZCA 2BDEA 4GK5E 2QA7A 1IJ6A 3KV6A 3K1SA 3AE3A 1WLXA 4EGWA 2W63A 2VKJA 4UXUA 3UFEA 4OFZA 3TLUA 4GYRA 3P50A 2OA5A 2PFVA 5FP3A 2DCFA 2YMDA 3FZLB 2MBGA 3PUSA 3QC9A 5HAXA 4K0KT 1BR2A 4P1NA 3P7IA 2XQ5A 5LNKA 2GK9A 4PFPA 1QUUA 3WTLA 5KX5E 4EIWA 4IDPA 2V6YA 4O8SA 3EDUA 2N9DA 2XAQB 4IREA 3KV4A 2LEHA 4MFRA 3CX6B 3UU8A 2PBIA 4PNIA 2H88A 3CMLA 3TLVA 1V9DA 1U5PA 3GN5B 5JR9C 3LK42 4ILCA 1JNZA 4TZ4C 2RPAA 3RIUA 2XJ7A 3BQIA 4JI4T 5DQWA 1UCUA 1UX2A 2L9QA 3UU5A 5BR8T 3ESLA 3RC8A 4IDOA 4AI6A 3G06A 4AISA 5LBMA 4JI2T 2ZM0A 4EYUA 2LSIA 4I0UA 3U8MA 1E7PA 2WQYA 5JR9B 2I59A 5LP6E 2E9XC 4UR9A 3FZKB 4NUVA 3PMZA 1M62A 4F6RC 5DJQC 2LRLA 3MXZA 2CA5A 2KMFA 4E7SA 4CXYA 2UXXB 4AKRB 1IBMT 1OEDC 1UV6A 3J9X1 3L3PA 2YDSA 3KDSE 5C2TA 3CIRA 2D2SA 1LVKA 4UF0B 2XSAA 3OJAA 5LJNA 3AEAA 2LJLA 3ZT5A 4LMKA 3K3QC 2X51A 2ZMAA 2FBWA 1NENA 4CN4A 3UU6A 3UT5E 2VVSA 1UK5A 4UV8B 2IDOB 4QXBB 2V7JA 3Q5XA 3BQLA 1UX5A 1OEDB 3LFMA 3UUBA 3C4ZA 2MPKA 5EK2A 3ZKRA 3BK9A 4HFVA 4H9NC 2JQHA 2JIWA 2WNLA 3FB2A 4AQFC 5CJ5A 1WRDA 1VRBA 2NW8A 3SS1A 4QH1A 4HN9A 3B5MA 2HHHT 5JRCB 2IAKA 2Y8DA 3I9YA 3X1DA 3ANWA 2E5VA 4H63V 4EB6E 3AVSA 2B1EA 5HCMA 3FXDB 2CWYA 3MJXA 3AE6A 4MBQA 4ILUA 4JI7T 3RRCA 2W4XA 5F5WA 2FUPA 4JI8T 2W8FA 3PDYA 3TLTA 3OPCA 2Y57A 2LOSA 4C90A 3JADA 4ZHQE 2V7MA 2X00D 2J4GA 2LRKA 4IHJE 5JDGA 2UU9T 2WNCA 3AE1A 3RF1A 2NW9A 4NXNT 4PFOA 3PUQA 4UIGA 2JRKA 4L9IA 4X1KE 5LGTB 5C3JA 3DTOA 4CXWA 1T8BA 5JH7E 1WFDA 3U8JA 1FMWA 2ZM6T 2NWBA 1YD8G 3AA6B 1D1AA 4LF7T 2CMRA 3JAFA 3AA1B 4XBFB 3K3OA 4WYVA 4CXXA 4HE8A 1XNRT 1G73A 4PJNA 1J5ET 3N9NA 4E7ZA 1T7SA 2LOPA 3PUAA 2Z6EA 5ETWA 2Y48B 3JAEA 2VK9A 1IZNB 3MA9A 4UVBB 2UUBT 3ETUA 1MMNA 3KVBA 5LHHB 4DV5T 4DR2T 3CX7B 1QLBA 3TKLB 5AFMB 2W67A 2KWIB 4UELA 4JI5T 3JC6C 1ZHCA 2Q9QC 3F31A 3C4WA 1Y01A 4KUMB 4A97A 3VR9A 4Z90A 3RKGA 2N2NA 2YU1A 4COFA 4YTPA 4PK6A 4FRRA 4YSYA 2VASA 3AEFA 5AQTB 3H3MA 3ONJA 5L3GB 4NXMT 1LRZA 2LSGA 1N32T 2VKDA 2PG8A 3P4RA 2Q9QB 1MNEA 5L4EA 1HFAA 2LLYA 1HCIA 1SA0E 3KVAA 5FNVE 3QUJA 2B76A 3C79A 5EZYE 3GWHA 1D1CA 2WWUA 5M4YA 3KINB 3E22E 5L2LA 4ZS2A 3UULA 2SPCA 5LA6E 3N9PA 3PUWF 2BKNA 5CA1E 5AQNB 2V7IA 2BBJA 3EHZA 1N34T 4HQPA 2XYSA 2QYWA 4MALA 4O4JE 2E9XD 3Q2MA 5JDFA 4YJ3E 4AFGA 4FJOA 2JJ9A 2JQKA 3WAJA 2IW5B 1HF8A 4D01A 2J62A 3ZSSA
chains in the Genus database with same CATH topology
2X00A 4NPPA 5HEGA 5IUXA 5AFMB 5AFMA 3RHWA 2QC1B 3TLSA 5HEOA 4BFQA 3SQ6A 4UM3A 4X5TA 4ILAA 5J5IA 4LMJA 3SIOA 3RQWA 2VL0A 2XYTA 4UM1A 2BYPA 2BYNA 5JMEA 5HCMA 1OEDE 4Z91A 2ZJVA 5KZUA 3SQ9A 3U8MA 4A97A 3U8LA 2WN9A 2PH9A 5TVCA 5BRXA 4HFIA 2BR8A 4Z90A 4QH5A 3PEOA 5L47A 4XHEA 4COFA 3WIPA 4NZBA 2PGZA 5CO5A 5BW2A 4ZZCA 5CFBA 4LMLA 2YMEA 2BR7A 5L4HA 3TLWA 5LG3A 2W8FA 3PMZA 4FRRA 4HFHA 4UM3S 2YOEA 3TLTA 2Y57A 4BQTA 2WNJA 3WTMA 4AFHA 4ZJSA 3UU4A 2XQ6A 3JADA 2UZ6A 4UXUA 5AFKA 4TWFA 2X00D 2BG9B 5AFJA 2BG9A 4A98A 2XQ8A 1OEDC 2LM2A 2MAWA 3TLUA 4HFEA 3WTIA 5KE4A 3P50A 1UV6A 2LKGA 4XK9A 5J5GA 3EAMA 4IL4A 3UU3A 2Y7YA 2M6IA 5HEUA 2BYQA 5HCJA 2YMDA 2WNCA 2XQ7A 4EZ1A 2BJ0A 2BYRA 2WZYA 4TWDA 3RI5A 3P4WA 4UM3P 4QAAA 5L4EA 5AFLA 3WTNA 4ILBA 2LKHA 2XZ6A 3C84A 3RIFA 3ZDGA 2LLYA 2XQ5A 4ALXA 4ZJTA 5AINA 4LMKA 2KSRA 3SH1A 2M6BA 5BP0A 3U8JA 2XQ9A 3WTLA 2XQ4A 3C79A 4UY2A 3UU6A 4ZK1A 5AFHA 2Y58A 1I9BA 5J5HA 3WTHA 3LSVA 2Y56A 4F8HA 2XQ3A 4HFDA 3JAFA 1UW6A 4IREA 2XNUA 2ZJUA 3T4MA 3UU8A 2YN6A 2XNVA 3WTKA 5J0ZA 1OEDB 2BG9E 4TNWA 1OEDA 3UUBA 3TLVA 2XNTA 4ZRUA 5LXBA 3WTOA 4QABA 2BYSA 4B5DA 4ZR6A 4ZK4A 3GUAA 3EHZA 4ILCA 3ZKRA 2C9TA 3U8KA 4HQPA 5FJVA 2XYSA 3EI0A 5HEHA 3RQUA 4IL9A 3JAEA 3UQ4A 4QH4A 3RIAA 1UX2A 5AFNA 5SYOA 4HFBA 4AFTA 2WNLA 4PIRA 4ZZBA 4WV9A 2Y54A 4AFGA 3UU5A 3UQ7A 2XZ5A 3IGQA 3U8NA 3WTJA 4TNVA 2XQAA 4HFCA 5HEJA 4TWHA 2BG9C 4D01A 4DBMA 3ZDHA 4QACA 2W8GA 4QH1A 5J5FA 2YKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X00 A;  4NPP A;  5HEG A;  5IUX A;  5AFM B;  5AFM A;  3RHW A;  2QC1 B;  3TLS A;  5HEO A;  4BFQ A;  3SQ6 A;  4UM3 A;  4X5T A;  4ILA A;  5J5I A;  4LMJ A;  3SIO A;  3RQW A;  2VL0 A;  2XYT A;  4UM1 A;  2BYP A;  2BYN A;  5JME A;  5HCM A;  1OED E;  4Z91 A;  2ZJV A;  5KZU A;  3SQ9 A;  3U8M A;  4A97 A;  3U8L A;  2WN9 A;  2PH9 A;  5TVC A;  5BRX A;  4HFI A;  2BR8 A;  4Z90 A;  4QH5 A;  3PEO A;  5L47 A;  4XHE A;  4COF A;  3WIP A;  4NZB A;  2PGZ A;  5CO5 A;  5BW2 A;  4ZZC A;  5CFB A;  4LML A;  2YME A;  2BR7 A;  5L4H A;  3TLW A;  5LG3 A;  2W8F A;  3PMZ A;  4FRR A;  4HFH A;  4UM3 S;  2YOE A;  3TLT A;  2Y57 A;  4BQT A;  2WNJ A;  3WTM A;  4AFH A;  4ZJS A;  3UU4 A;  2XQ6 A;  3JAD A;  2UZ6 A;  4UXU A;  5AFK A;  4TWF A;  2X00 D;  2BG9 B;  5AFJ A;  2BG9 A;  4A98 A;  2XQ8 A;  1OED C;  2LM2 A;  2MAW A;  3TLU A;  4HFE A;  3WTI A;  5KE4 A;  3P50 A;  1UV6 A;  2LKG A;  4XK9 A;  5J5G A;  3EAM A;  4IL4 A;  3UU3 A;  2Y7Y A;  2M6I A;  5HEU A;  2BYQ A;  5HCJ A;  2YMD A;  2WNC A;  2XQ7 A;  4EZ1 A;  2BJ0 A;  2BYR A;  2WZY A;  4TWD A;  3RI5 A;  3P4W A;  4UM3 P;  4QAA A;  5L4E A;  5AFL A;  3WTN A;  4ILB A;  2LKH A;  2XZ6 A;  3C84 A;  3RIF A;  3ZDG A;  2LLY A;  2XQ5 A;  4ALX A;  4ZJT A;  5AIN A;  4LMK A;  2KSR A;  3SH1 A;  2M6B A;  5BP0 A;  3U8J A;  2XQ9 A;  3WTL A;  2XQ4 A;  3C79 A;  4UY2 A;  3UU6 A;  4ZK1 A;  5AFH A;  2Y58 A;  1I9B A;  5J5H A;  3WTH A;  3LSV A;  2Y56 A;  4F8H A;  2XQ3 A;  4HFD A;  3JAF A;  1UW6 A;  4IRE A;  2XNU A;  2ZJU A;  3T4M A;  3UU8 A;  2YN6 A;  2XNV A;  3WTK A;  5J0Z A;  1OED B;  2BG9 E;  4TNW A;  1OED A;  3UUB A;  3TLV A;  2XNT A;  4ZRU A;  5LXB A;  3WTO A;  4QAB A;  2BYS A;  4B5D A;  4ZR6 A;  4ZK4 A;  3GUA A;  3EHZ A;  4ILC A;  3ZKR A;  2C9T A;  3U8K A;  4HQP A;  5FJV A;  2XYS A;  3EI0 A;  5HEH A;  3RQU A;  4IL9 A;  3JAE A;  3UQ4 A;  4QH4 A;  3RIA A;  1UX2 A;  5AFN A;  5SYO A;  4HFB A;  4AFT A;  2WNL A;  4PIR A;  4ZZB A;  4WV9 A;  2Y54 A;  4AFG A;  3UU5 A;  3UQ7 A;  2XZ5 A;  3IGQ A;  3U8N A;  3WTJ A;  4TNV A;  2XQA A;  4HFC A;  5HEJ A;  4TWH A;  2BG9 C;  4D01 A;  4DBM A;  3ZDH A;  4QAC A;  2W8G A;  4QH1 A;  5J5F A;  2YKS A; 
#chains in the Genus database with same CATH topology
 5DAB A;  3UUM A;  2QC1 B;  4DBQ A;  5FY1 A;  5AQQ B;  4LMJ A;  1WR0 A;  3DP7 A;  5A1L A;  2HPL A;  3ABV A;  2XAG B;  3LBX B;  1XNQ T;  3WIP A;  2H7V C;  4LML A;  4PJL A;  2ACZ A;  2E5L T;  3AA0 B;  2WMN A;  5AFJ A;  3L8R A;  2G0U A;  3VU7 H;  2HPJ A;  2XM1 A;  3PJA J;  4UEM A;  3CPZ A;  4JUY A;  4M1P A;  5JDM A;  1XDP A;  5ABG A;  3RI5 A;  1MMA A;  1BR0 A;  3V5S A;  2KWH A;  5AIN A;  5IHY A;  2KSR A;  1MND A;  4EOZ B;  3RRW A;  3QOF A;  2EHO A;  2AE9 A;  3MKD A;  2LHR A;  2V6X A;  3AEG A;  3VHL A;  4ZRU A;  5AQM B;  4CZZ B;  2BYS A;  2V7K A;  1XZY A;  5LGN B;  2WSS V;  5FXX A;  2V5C A;  3RQU A;  5LMN T;  4HGA A;  4H9Q C;  4CI3 B;  3I0O A;  5C8Y E;  4O4H E;  3AED A;  2WM9 A;  5L3B B;  5HEJ A;  3AAI A;  2LE8 A;  3L09 A;  4DV7 T;  3RC3 A;  4AIU A;  4P0B A;  3KV5 A;  2D0U A;  3J7Y q;  3N9Q A;  5J5I A;  2XYT A;  2BYN A;  2OLT A;  5EK3 A;  1GQE A;  2ODU A;  3FBZ A;  2PGZ A;  4AQG A;  4HFH A;  3N9O A;  5L3F B;  1O3X A;  5L3E B;  4DBR A;  5AQR B;  1IBK T;  3E08 A;  4ZS3 A;  4B3M T;  4TWF A;  2BG9 A;  2LM2 A;  3QNU A;  3AXJ A;  4GIW A;  4I55 E;  1KK7 A;  2BJ0 A;  2IC9 A;  2D0T A;  1FMV A;  3JCF A;  3AAE B;  3CVR A;  1BR4 A;  5JQG E;  2CLY C;  3R6N A;  3ZMV B;  3O1I A;  4PK5 A;  4WNK A;  2V6Y B;  5J5H A;  2A2F X;  4ZOL E;  2CWO A;  5BMV E;  2X67 A;  2VKO A;  3ZN1 B;  2XQY A;  3P4P A;  1ZEE A;  5LJM A;  1D0Y A;  3AB3 B;  4LF4 T;  2XAF B;  3JC6 D;  2Q9Q D;  3A8Y C;  5HXC A;  3SFD A;  5FJV A;  1XMO T;  2I0M A;  1LVF A;  3OYZ A;  4AKL A;  1IAP A;  2CLY B;  3CX8 B;  3C64 A;  1T72 A;  3IGQ A;  4PJJ A;  1N33 T;  1OWA A;  4TWH A;  4YY3 T;  3VRB A;  4IE7 A;  5J2U E;  2XZE A;  4AQY T;  5F8P A;  1FEW A;  2ZM8 A;  2XAJ B;  4UVC B;  2ZLY A;  2CHN A;  2DLR A;  5LG3 A;  4AKH A;  2K3W A;  3VR8 A;  5H6Q B;  4O4L E;  1MIY A;  3CQC B;  2V5D A;  5KDM C;  5FMN A;  3EVY A;  2XQ6 A;  1I6Z A;  5J2T E;  2X66 A;  1CUN A;  2MAW A;  2X0L B;  4YTN A;  3IA3 A;  5AFU L;  1KEY A;  2VB6 A;  4DID B;  2L8K A;  2W61 A;  5L3C B;  3GN5 A;  3ZST A;  1HS7 A;  3ZPO A;  4JI3 T;  4WW0 A;  4YFS A;  2BKO A;  5FY0 A;  4CN6 A;  4PW8 A;  4OHF A;  3RPU A;  4JYA T;  4TNW A;  1W9R A;  3ZMT B;  2E9X B;  2C5I T;  5ADX L;  3CK6 A;  1ZOY A;  4IGU A;  3WTJ A;  3HI2 A;  4HFC A;  3RYF E;  4HTE A;  3LG7 A;  5HEG A;  4CQI A;  4UM3 A;  3OKQ A;  2ODV A;  3RQW A;  4UM1 A;  1OED E;  5FKY A;  5LMU T;  1Z8U A;  3GMI A;  3AAA B;  2VUR A;  3N2K E;  3ZJ2 A;  4PAG A;  1D0Z A;  5CFB A;  5L4H A;  4ZI7 E;  4U2Z A;  4AFH A;  3ONX A;  4QXH B;  4EED A;  4DV2 T;  4A98 A;  1HG5 A;  1QSD A;  3K8P C;  3ZMS B;  2CBJ A;  2QGS A;  5HCJ A;  2MYS A;  1UUR A;  3MK7 C;  3EUH A;  2A72 A;  2E2A A;  4DMV A;  3RYC E;  1G8X A;  3P8C D;  5J1G A;  5AFH A;  3LSV A;  4DV1 T;  1R8I A;  3ETV A;  3N2O A;  1E1H B;  2BS3 A;  5HXS A;  4DR6 T;  2V8S V;  4KHZ F;  4U7Y A;  2H89 A;  3PUZ F;  4Q25 A;  1YQ3 A;  2NTX A;  4OYJ A;  2CXF A;  5JRC A;  4B5D A;  4ZK4 A;  2JPF A;  4B3R T;  4HEA A;  5ABE A;  5HEH A;  1Z0P A;  4P09 A;  4TV9 E;  4G2A A;  4H9S E;  3Q5W A;  2J1D G;  4DBM A;  3M65 A;  4DUZ T;  3IF8 B;  3T1H T;  2UXD T;  1KNR A;  4KP3 C;  2MOZ A;  3S4U A;  5IUX A;  2JQ9 A;  1D0X A;  2XSB A;  3NZQ A;  4J2C A;  2D5U A;  2WCA A;  3D0T A;  3NRY A;  1AJ3 A;  4NUU A;  4EAH A;  2ACX A;  2BR7 A;  3TLW A;  2W66 A;  4U31 A;  4KBM B;  5AQO B;  5CB4 E;  3ZCI A;  3N5L A;  3ZYL A;  4ADZ A;  2XQ8 A;  1VCT A;  3O1H A;  4DR5 T;  3C98 B;  2WZY A;  5HXH A;  2N1G A;  1WCR A;  3P4W A;  2FJA A;  4ZI2 C;  2NP9 A;  3ZDG A;  5LXT E;  3HKB E;  3VRA A;  4TUY E;  3I9W A;  4CI2 B;  2Y58 A;  2Y56 A;  3K3N A;  3T4M A;  4LFC T;  1U4Q A;  2H7O A;  4QKN A;  4H63 H;  3Q5E A;  4X66 T;  3EI0 A;  1HX1 B;  2HN2 A;  4CN1 A;  3P4Q A;  4HFB A;  4PIR A;  4ZZB A;  3H3A A;  4MHC A;  5ABF B;  3A5X A;  1J1J A;  3N9L A;  2W8G A;  4X1Y E;  5J5F A;  3LJC A;  3TLS A;  4IST A;  4LF5 T;  2W62 A;  5HXE A;  2UXC T;  1HX8 A;  3PUV F;  4H9R C;  3HKE E;  2RA1 A;  2VL8 A;  3U8L A;  5LHI B;  2V26 A;  4TX5 A;  2Q9Q A;  3AE5 A;  2KND A;  3EAB A;  5H6R B;  2NOX A;  3A7M A;  2EHO C;  2W00 A;  3RLF F;  4ASK A;  1HR0 T;  2UUA T;  4FI5 A;  5KE4 A;  2LKG A;  5J5G A;  3VKH A;  2X0H A;  4X1I E;  1YQ4 A;  3PE0 A;  4XZC A;  3PJA A;  4KMC A;  1SHZ C;  2VQE T;  4QAA A;  2FJB A;  3AEC A;  3FZH B;  5HYA A;  1XDO A;  4LF8 T;  4QHO A;  5IYZ E;  3ZT7 A;  4MLK A;  4BA9 A;  1WR6 A;  2PTF A;  4H9P C;  4YHJ A;  4L5G A;  4WBN E;  3HR0 A;  4ZK1 A;  4PK4 A;  4I43 B;  3SFE A;  3ZC1 A;  5FXV A;  2EHO B;  3PTR B;  5F3J A;  1KNP A;  5CA0 E;  2K24 A;  2XNV A;  2WDV A;  3WTO A;  4QAB A;  3GUA A;  4GK0 E;  4U72 A;  5HXR A;  4YJ2 E;  5FXW A;  2XY8 B;  2WMO A;  4NIQ A;  4QH4 A;  3RIA A;  2NTY A;  4IDQ A;  2Y54 A;  4UV9 B;  2CRB A;  2KIN B;  4YSX A;  4ANJ A;  4OX9 T;  2BG9 C;  1ZP0 A;  1H7C A;  2AXD S;  2WU5 A;  3NZP A;  2YKS A;  3HKD E;  3RHW A;  5HEO A;  4EZH A;  2FJE A;  3T8O A;  1I94 T;  2X0Y A;  3Q5D A;  2WN9 A;  5BRX A;  4B6X A;  3OYX A;  4HFI A;  2VWA A;  2M67 A;  4XHE A;  2X9H A;  3NBX X;  4UM3 S;  4BQT A;  3WTM A;  3KFW X;  1HG2 A;  5FVL A;  3UU4 A;  3RYH E;  2UZ6 A;  5AFK A;  4DR3 T;  2BG9 B;  2CXD A;  2BBH A;  3AXJ B;  3ZT6 A;  3UFG A;  4XK9 A;  1OXZ A;  5FYM A;  1JNR A;  2WBL A;  4O2B E;  1WYC A;  1ZKE A;  3WTN A;  2WAU A;  2XZ6 A;  3RIF A;  2CXL A;  2WDR A;  2WU2 A;  1T98 A;  2XQ9 A;  2XQ4 A;  4YLH A;  5AQL B;  2KLQ A;  1HNX T;  1CHU A;  4F8H A;  1MIW A;  1YW0 A;  2XQ3 A;  4HFD A;  1UW6 A;  2XNU A;  4QWN B;  1L0V A;  3KV9 A;  4OYK A;  3RIU C;  3RX6 A;  2DWG A;  5HWX A;  3PU8 A;  3C4X A;  5AQV B;  2BZB A;  4JI1 T;  2CCQ A;  3UQ4 A;  1XWM A;  4XAX B;  2XPK A;  4WV9 A;  3UQ7 A;  2IC6 A;  4BAY B;  3F57 A;  2XQA A;  4DV3 T;  3O9X A;  3DJB A;  3SWH A;  1YKH B;  2X00 A;  3SQ6 A;  1B7T A;  4AXP A;  3R84 B;  2XM2 A;  3QB5 K;  5JME A;  4DR1 T;  2VKH A;  3SQ9 A;  2PH9 A;  2WP9 A;  2BR8 A;  3PEO A;  5AQK B;  1EZ3 A;  2WZH A;  4UVA B;  5L47 A;  2YEV C;  4ZI2 D;  5BW2 A;  5AQU B;  5CGM A;  2NW7 A;  2LT3 A;  2XAH B;  4IE5 A;  4KX6 A;  4B3S T;  4GKJ T;  4DMW A;  2D9D A;  4DUY T;  2WB5 A;  3ZMU B;  3HKC E;  5DQV A;  2Y7Y A;  2CEA A;  4DV6 T;  5FVK A;  4EZ1 A;  4YT0 A;  5AQG B;  4TWD A;  4IIJ E;  1HNW T;  2IIU A;  4ILB A;  4ALX A;  4JBW F;  2LSK A;  3ZN0 B;  5L3D B;  4EZ4 A;  4DR4 T;  2Y6X A;  3C51 A;  4UY2 A;  3B13 A;  2JMH A;  3AE8 A;  2BVL A;  4A5X A;  3U3I A;  2DWK A;  2XNT A;  1MMG A;  4L0R A;  5JDH A;  1J5W A;  5FL0 A;  1W0A A;  1HNZ T;  3FXE B;  2XZ5 A;  2EHO D;  4KI0 F;  3ONL C;  3OVU A;  4WBO A;  3ZLI A;  4NPP A;  3B57 A;  2W2U A;  4EYY R;  3RGL A;  5HWY A;  3IEE A;  2MTQ A;  2I6H A;  1W0B A;  4B3T T;  3U78 A;  3UUX B;  2VL0 A;  2E8I A;  2BS4 A;  5LCY A;  2H3R A;  5JR9 A;  4IE6 A;  2UUC T;  2C5J A;  3AE4 A;  3AE9 A;  4X62 T;  3NVO A;  2P9B A;  2YME A;  4X20 E;  4ZJS A;  5JDN A;  4GOU A;  1SUM B;  3ANW B;  5AQH B;  3W15 B;  2YK0 A;  3N2G E;  3UU3 A;  2M6I A;  4ZI3 C;  3AE7 A;  3RH3 A;  2V1D B;  1NWM X;  4IDN A;  4UM3 P;  4UF0 A;  3ZMZ B;  2OV9 A;  2XUE A;  1YXR A;  4HWC A;  3SH1 A;  2X9X A;  4YXD A;  2E9X A;  2M6B A;  5JDQ A;  3H37 A;  2ES0 A;  1UUS A;  3O4X E;  3WTH A;  4DV4 T;  4P0A A;  3RKO A;  3ZYM A;  2UXN B;  3HA4 A;  2X9Y A;  4YSZ A;  3WAK A;  1OED A;  2WWV A;  3PUY F;  4I4T E;  2YU2 A;  5KMG P;  1BR1 A;  3OTO T;  4LFB T;  4TV8 E;  4G63 A;  4I50 E;  5SYO A;  2LSJ A;  5LYJ E;  4X64 T;  3OBV E;  2WDQ A;  2LM9 A;  4QAC A;  2DHR A;  1D1B A;  3VKG A;  4O2A E;  1IJ5 A;  4EEB A;  5AQS B;  4IT4 A;  4LF6 T;  2KT9 A;  4HWH A;  4QXC B;  2IML A;  5KZU A;  4EXT A;  3N9M A;  4UXN B;  3PUG A;  4X65 T;  1KFY A;  1DU2 A;  3CWZ B;  2YOE A;  1FIO A;  2CE7 A;  3L39 A;  3ZEF B;  3P4S A;  3AVR A;  4AQF A;  1ZV4 X;  2K48 A;  5FL1 A;  3ZCJ A;  3EAM A;  2HH7 A;  1UGO A;  4YTM A;  4JEH B;  3RYI E;  2K5B B;  4LFA T;  3ZC0 A;  1XMQ T;  2LKH A;  2ZM2 A;  5JVD E;  4DR7 T;  3C84 A;  2CM0 A;  2J47 A;  2LSY A;  1YKE B;  4OK0 A;  5BP0 A;  4U7I A;  3GA8 A;  2DNX A;  3AEE A;  4HWF A;  3O1J A;  4DO0 A;  2KXP B;  1SE7 A;  4JEU B;  3NWI A;  2QVA A;  5J0Z A;  1IBL T;  3MZK B;  2CHO A;  3NKZ A;  5LHG B;  4AKI A;  2C9T A;  3PUX F;  5TAO A;  1KNZ A;  1W09 A;  4WZX A;  3ZYK A;  3MAC A;  4K0U A;  3KBU A;  4U74 A;  2YIN A;  2DL1 A;  1UX4 A;  4CI1 B;  1E2A A;  4QX8 B;  5AFM A;  5LB7 B;  4ILA A;  3ZJ1 A;  4Z8X A;  2JQQ A;  3Q9D A;  4U2Y A;  2ZJV A;  3NRX A;  2WZI A;  4DVD A;  5AQP B;  4NZB A;  3CQG B;  2FJD A;  2KZ7 B;  2WNJ A;  3BQK A;  2IUB A;  2CPT A;  5FXZ A;  3FZM B;  2A3D A;  5EK4 A;  3AEB A;  4HFE A;  5E0O A;  3I0Q A;  3FBL A;  1HTJ F;  3M3Z B;  4IL4 A;  5HEU A;  4QX7 B;  3QB5 A;  2BYR A;  3SOL A;  3PU3 A;  2UXB T;  5AFL A;  4H9O C;  2XAS B;  4HWI B;  5FY7 A;  4ZEY A;  5JRE A;  3LK2 B;  4ZJT A;  3F2E A;  1N36 T;  4TN7 B;  1X79 A;  4DV0 T;  3C50 A;  5ABH A;  5ABF A;  5LBQ B;  4JI0 T;  3IHR A;  3EDV A;  2ZJU A;  1NAF A;  2XTL A;  2X68 A;  1WYB A;  3I1A A;  2BKP A;  3WI3 A;  5LXB A;  2NR4 A;  4GYS A;  3FZF B;  3U8K A;  2X9W A;  3PV0 F;  2DI4 A;  5JTG A;  1US7 B;  4GKK T;  2RP4 A;  5JDL A;  5AFN A;  4BJM A;  3QK6 A;  3IBP A;  2V7L A;  5KXJ A;  2VVN A;  5LG4 A;  3ZDH A;  4KHP T;  2F4V T;  2WS3 A;  5IWA T;  2PJQ A;  4EV6 A;  4YHH T;  4BFQ A;  4X5T A;  2LHN A;  2W0G A;  3SIO A;  4JV5 T;  4ZI3 D;  4Z91 A;  5LGU B;  5TVC A;  4QH5 A;  3LBX A;  5CO5 A;  2XHE B;  3AA7 B;  4AKG A;  3FHN A;  4O4I E;  4JLE A;  4JI6 T;  2A9U A;  4U3C A;  1MIV A;  4C91 A;  3WTI A;  3AE2 A;  4PJM A;  2BYQ A;  4ISS A;  2XQ7 A;  2JMK A;  2WY2 A;  3PUR A;  2BS2 A;  1S35 A;  2C0S A;  2QRX A;  1LKX A;  5GON E;  2YDR A;  4ERR A;  1X9B A;  3CKD A;  1Y64 B;  2L3L A;  1NEK A;  4A56 A;  4DND A;  3LK3 B;  3UTK A;  1I9B A;  5AQF B;  4HWD A;  3V5U A;  4IDZ A;  2YN6 A;  4IE0 A;  3WTK A;  3LDQ B;  5AQJ B;  5AQI B;  2BG9 E;  4N78 D;  4ZR6 A;  3HL6 A;  2BVM A;  4BJN A;  4HKA A;  4LF9 T;  4V1A v;  4IL9 A;  2K9A A;  4AFT A;  1VCS A;  3SRZ A;  2C5K T;  3U8N A;  4IE4 A;  3UUN A;  2CBI A;  2YDQ A;  4TNV A;  1VOM A;  3E0Z A;  1M7K A;  1MMD A;  1FJG T;  2R6G F;  3CQX C;  2IHR 1;  3T1Y T;  2BYP A;  4U33 A;  2VQF T;  1S94 A;  1KF6 A;  3KBT A;  5LOV E;  4ZXL A;  2HN1 A;  4ZZC A;  2BDE A;  4GK5 E;  2QA7 A;  1IJ6 A;  3KV6 A;  3K1S A;  3AE3 A;  1WLX A;  4EGW A;  2W63 A;  2VKJ A;  4UXU A;  3UFE A;  4OFZ A;  3TLU A;  4GYR A;  3P50 A;  2OA5 A;  2PFV A;  5FP3 A;  2DCF A;  2YMD A;  3FZL B;  2MBG A;  3PUS A;  3QC9 A;  5HAX A;  4K0K T;  1BR2 A;  4P1N A;  3P7I A;  2XQ5 A;  5LNK A;  2GK9 A;  4PFP A;  1QUU A;  3WTL A;  5KX5 E;  4EIW A;  4IDP A;  2V6Y A;  4O8S A;  3EDU A;  2N9D A;  2XAQ B;  4IRE A;  3KV4 A;  2LEH A;  4MFR A;  3CX6 B;  3UU8 A;  2PBI A;  4PNI A;  2H88 A;  3CML A;  3TLV A;  1V9D A;  1U5P A;  3GN5 B;  5JR9 C;  3LK4 2;  4ILC A;  1JNZ A;  4TZ4 C;  2RPA A;  3RIU A;  2XJ7 A;  3BQI A;  4JI4 T;  5DQW A;  1UCU A;  1UX2 A;  2L9Q A;  3UU5 A;  5BR8 T;  3ESL A;  3RC8 A;  4IDO A;  4AI6 A;  3G06 A;  4AIS A;  5LBM A;  4JI2 T;  2ZM0 A;  4EYU A;  2LSI A;  4I0U A;  3U8M A;  1E7P A;  2WQY A;  5JR9 B;  2I59 A;  5LP6 E;  2E9X C;  4UR9 A;  3FZK B;  4NUV A;  3PMZ A;  1M62 A;  4F6R C;  5DJQ C;  2LRL A;  3MXZ A;  2CA5 A;  2KMF A;  4E7S A;  4CXY A;  2UXX B;  4AKR B;  1IBM T;  1OED C;  1UV6 A;  3J9X 1;  3L3P A;  2YDS A;  3KDS E;  5C2T A;  3CIR A;  2D2S A;  1LVK A;  4UF0 B;  2XSA A;  3OJA A;  5LJN A;  3AEA A;  2LJL A;  3ZT5 A;  4LMK A;  3K3Q C;  2X51 A;  2ZMA A;  2FBW A;  1NEN A;  4CN4 A;  3UU6 A;  3UT5 E;  2VVS A;  1UK5 A;  4UV8 B;  2IDO B;  4QXB B;  2V7J A;  3Q5X A;  3BQL A;  1UX5 A;  1OED B;  3LFM A;  3UUB A;  3C4Z A;  2MPK A;  5EK2 A;  3ZKR A;  3BK9 A;  4HFV A;  4H9N C;  2JQH A;  2JIW A;  2WNL A;  3FB2 A;  4AQF C;  5CJ5 A;  1WRD A;  1VRB A;  2NW8 A;  3SS1 A;  4QH1 A;  4HN9 A;  3B5M A;  2HHH T;  5JRC B;  2IAK A;  2Y8D A;  3I9Y A;  3X1D A;  3ANW A;  2E5V A;  4H63 V;  4EB6 E;  3AVS A;  2B1E A;  5HCM A;  3FXD B;  2CWY A;  3MJX A;  3AE6 A;  4MBQ A;  4ILU A;  4JI7 T;  3RRC A;  2W4X A;  5F5W A;  2FUP A;  4JI8 T;  2W8F A;  3PDY A;  3TLT A;  3OPC A;  2Y57 A;  2LOS A;  4C90 A;  3JAD A;  4ZHQ E;  2V7M A;  2X00 D;  2J4G A;  2LRK A;  4IHJ E;  5JDG A;  2UU9 T;  2WNC A;  3AE1 A;  3RF1 A;  2NW9 A;  4NXN T;  4PFO A;  3PUQ A;  4UIG A;  2JRK A;  4L9I A;  4X1K E;  5LGT B;  5C3J A;  3DTO A;  4CXW A;  1T8B A;  5JH7 E;  1WFD A;  3U8J A;  1FMW A;  2ZM6 T;  2NWB A;  1YD8 G;  3AA6 B;  1D1A A;  4LF7 T;  2CMR A;  3JAF A;  3AA1 B;  4XBF B;  3K3O A;  4WYV A;  4CXX A;  4HE8 A;  1XNR T;  1G73 A;  4PJN A;  1J5E T;  3N9N A;  4E7Z A;  1T7S A;  2LOP A;  3PUA A;  2Z6E A;  5ETW A;  2Y48 B;  3JAE A;  2VK9 A;  1IZN B;  3MA9 A;  4UVB B;  2UUB T;  3ETU A;  1MMN A;  3KVB A;  5LHH B;  4DV5 T;  4DR2 T;  3CX7 B;  1QLB A;  3TKL B;  5AFM B;  2W67 A;  2KWI B;  4UEL A;  4JI5 T;  3JC6 C;  1ZHC A;  2Q9Q C;  3F31 A;  3C4W A;  1Y01 A;  4KUM B;  4A97 A;  3VR9 A;  4Z90 A;  3RKG A;  2N2N A;  2YU1 A;  4COF A;  4YTP A;  4PK6 A;  4FRR A;  4YSY A;  2VAS A;  3AEF A;  5AQT B;  3H3M A;  3ONJ A;  5L3G B;  4NXM T;  1LRZ A;  2LSG A;  1N32 T;  2VKD A;  2PG8 A;  3P4R A;  2Q9Q B;  1MNE A;  5L4E A;  1HFA A;  2LLY A;  1HCI A;  1SA0 E;  3KVA A;  5FNV E;  3QUJ A;  2B76 A;  3C79 A;  5EZY E;  3GWH A;  1D1C A;  2WWU A;  5M4Y A;  3KIN B;  3E22 E;  5L2L A;  4ZS2 A;  3UUL A;  2SPC A;  5LA6 E;  3N9P A;  3PUW F;  2BKN A;  5CA1 E;  5AQN B;  2V7I A;  2BBJ A;  3EHZ A;  1N34 T;  4HQP A;  2XYS A;  2QYW A;  4MAL A;  4O4J E;  2E9X D;  3Q2M A;  5JDF A;  4YJ3 E;  4AFG A;  4FJO A;  2JJ9 A;  2JQK A;  3WAJ A;  2IW5 B;  1HF8 A;  4D01 A;  2J62 A;  3ZSS A; 
#chains in the Genus database with same CATH homology
 2X00 A;  4NPP A;  5HEG A;  5IUX A;  5AFM B;  5AFM A;  3RHW A;  2QC1 B;  3TLS A;  5HEO A;  4BFQ A;  3SQ6 A;  4UM3 A;  4X5T A;  4ILA A;  5J5I A;  4LMJ A;  3SIO A;  3RQW A;  2VL0 A;  2XYT A;  4UM1 A;  2BYP A;  2BYN A;  5JME A;  5HCM A;  1OED E;  4Z91 A;  2ZJV A;  5KZU A;  3SQ9 A;  3U8M A;  4A97 A;  3U8L A;  2WN9 A;  2PH9 A;  5TVC A;  5BRX A;  4HFI A;  2BR8 A;  4Z90 A;  4QH5 A;  3PEO A;  5L47 A;  4XHE A;  4COF A;  3WIP A;  4NZB A;  2PGZ A;  5CO5 A;  5BW2 A;  4ZZC A;  5CFB A;  4LML A;  2YME A;  2BR7 A;  5L4H A;  3TLW A;  5LG3 A;  2W8F A;  3PMZ A;  4FRR A;  4HFH A;  4UM3 S;  2YOE A;  3TLT A;  2Y57 A;  4BQT A;  2WNJ A;  3WTM A;  4AFH A;  4ZJS A;  3UU4 A;  2XQ6 A;  3JAD A;  2UZ6 A;  4UXU A;  5AFK A;  4TWF A;  2X00 D;  2BG9 B;  5AFJ A;  2BG9 A;  4A98 A;  2XQ8 A;  1OED C;  2LM2 A;  2MAW A;  3TLU A;  4HFE A;  3WTI A;  5KE4 A;  3P50 A;  1UV6 A;  2LKG A;  4XK9 A;  5J5G A;  3EAM A;  4IL4 A;  3UU3 A;  2Y7Y A;  2M6I A;  5HEU A;  2BYQ A;  5HCJ A;  2YMD A;  2WNC A;  2XQ7 A;  4EZ1 A;  2BJ0 A;  2BYR A;  2WZY A;  4TWD A;  3RI5 A;  3P4W A;  4UM3 P;  4QAA A;  5L4E A;  5AFL A;  3WTN A;  4ILB A;  2LKH A;  2XZ6 A;  3C84 A;  3RIF A;  3ZDG A;  2LLY A;  2XQ5 A;  4ALX A;  4ZJT A;  5AIN A;  4LMK A;  2KSR A;  3SH1 A;  2M6B A;  5BP0 A;  3U8J A;  2XQ9 A;  3WTL A;  2XQ4 A;  3C79 A;  4UY2 A;  3UU6 A;  4ZK1 A;  5AFH A;  2Y58 A;  1I9B A;  5J5H A;  3WTH A;  3LSV A;  2Y56 A;  4F8H A;  2XQ3 A;  4HFD A;  3JAF A;  1UW6 A;  4IRE A;  2XNU A;  2ZJU A;  3T4M A;  3UU8 A;  2YN6 A;  2XNV A;  3WTK A;  5J0Z A;  1OED B;  2BG9 E;  4TNW A;  1OED A;  3UUB A;  3TLV A;  2XNT A;  4ZRU A;  5LXB A;  3WTO A;  4QAB A;  2BYS A;  4B5D A;  4ZR6 A;  4ZK4 A;  3GUA A;  3EHZ A;  4ILC A;  3ZKR A;  2C9T A;  3U8K A;  4HQP A;  5FJV A;  2XYS A;  3EI0 A;  5HEH A;  3RQU A;  4IL9 A;  3JAE A;  3UQ4 A;  4QH4 A;  3RIA A;  1UX2 A;  5AFN A;  5SYO A;  4HFB A;  4AFT A;  2WNL A;  4PIR A;  4ZZB A;  4WV9 A;  2Y54 A;  4AFG A;  3UU5 A;  3UQ7 A;  2XZ5 A;  3IGQ A;  3U8N A;  3WTJ A;  4TNV A;  2XQA A;  4HFC A;  5HEJ A;  4TWH A;  2BG9 C;  4D01 A;  4DBM A;  3ZDH A;  4QAC A;  2W8G A;  4QH1 A;  5J5F A;  2YKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...