3P50A

Structure of propofol bound to a pentameric ligand-gated ion channel, glic
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title X-ray structures of general anaesthetics bound to a pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3p50A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3p50A01
4NPPA 4TWDA 4QACA 4NZBA 2XQAA 2BR7A 5L4EA 4FRRA 4ZRUA 3SIOA 5HCMA 5HEUA 4HFEA 2Y54A 1I9BA 4XHEA 3WTLA 3SH1A 5AFLA 4D01A 2M6BA 2YMDA 3C84A 3RI5A 2BYPA 4ILAA 3T4MA 5J5FA 5L47A 2ZJUA 4QH1A 2BG9E 3U8NA 3P4WA 5LG3A 2X00A 2XQ3A 3RQWA 4ILCA 4IL9A 4ILBA 2XYSA 3GUAA 1OEDA 5FJVA 5KE4A 4ZK1A 4WV9A 2KSRA 4HFIA 4TWHA 1OEDB 3P50A 3TLVA 2W8GA 3WTJA 4TWFA 4UM3A 3UU8A 5TVCA 1UW6A 1UX2A 5AFMA 4LMKA 1OEDC 3U8LA 3UQ4A 4ZJSA 2BYQA 2WNCA 2X00D 3RIFA 2WNLA 4UY2A 5AINA 4HFHA 2ZJVA 4UM3P 3EI0A 4UM3S 2BYNA 5HEHA 2WN9A 3RHWA 5KZUA 3EHZA 4EZ1A 4B5DA 2PGZA 3C79A 3WTOA 3ZDGA 2XQ6A 3UU5A 3WTMA 2LM2A 5IUXA 5HEGA 1OEDE 2WZYA 3SQ9A 3EAMA 2XNUA 3U8MA 3WTNA 2M6IA 5BRXA 4Z91A 4AFGA 4TNVA 4TNWA 3RIAA 3U8JA 2XNVA 3TLWA 5J0ZA 4BQTA 2WNJA 3UQ7A 3TLTA 5AFMB 2Y56A 2Y7YA 5JMEA 2XQ7A 1UV6A 4QH5A 3UUBA 2YN6A 2XQ4A 4AFHA 3WTHA 5AFKA 4AFTA 4HFCA 2XQ5A 3TLUA 2BYSA 3RQUA 5AFNA 3TLSA 5J5IA 5BP0A 5AFJA 2XYTA 5BW2A 4ALXA 3LSVA 2YMEA 5HCJA 2XZ5A 5J5GA 4ZZCA 2W8FA 2XQ9A 3IGQA 2Y58A 4LMLA 2LLYA 3SQ6A 3ZKRA 4LMJA 4BFQA 4A97A 3UU6A 4ZJTA 4ZZBA 4QABA 4UXUA 4F8HA 2LKGA 5CO5A 3WTKA 2BYRA 2MAWA 3WIPA 2XZ6A 2VL0A 3UU4A 4QAAA 5SYOA 2YKSA 3ZDHA 4COFA 3U8KA 2UZ6A 5CFBA 5J5HA 4DBMA 4IL4A 3PEOA 2BG9A 4HFBA 2Y57A 2XQ8A 3JAFA 2BG9B 4HQPA 4X5TA 4UM1A 4HFDA 4IREA 3JADA 2XNTA 5LXBA 2QC1B 3JAEA 4Z90A 3PMZA 4QH4A 5HEJA 4A98A 2BR8A 2C9TA 2BG9C 4ZR6A 5HEOA 3WTIA 2LKHA 4ZK4A 5AFHA 4XK9A 2YOEA 5L4HA 3UU3A 2PH9A 4PIRA 2BJ0A
chains in the Genus database with same CATH superfamily
5HXEA 2XQAA 4QKNA 4UF0B 3LK42 4IDPA 3OKQA 5FXZA 3S4UA 1KF6A 2JIWA 2VQET 4H63V 2CLYB 2UUBT 1HTJF 5FJVA 3FBZA 4HFIA 1UX4A 4BA9A 1I6ZA 2OA5A 2WP9A 4B3MT 3PUYF 4OYJA 1BR0A 3Q5EA 2X0YA 2JQQA 3KFWX 1FIOA 2Q9QC 2LSIA 4CN6A 3VRAA 4B3ST 4OK0A 2CE7A 3ZN1B 4AKHA 4QXCB 4DIDB 3U3IA 2UU9T 2XM2A 5CA1E 4DR6T 1S35A 4YXDA 4GK0E 4B3TT 1G8XA 4AQGA 2V7MA 2V5DA 4PK6A 3C98B 2C5IT 4WBNE 5JDNA 3B57A 4LMJA 5AQLB 3UU6A 2R6GF 4ZI2C 4O8SA 1IBKT 3RYCE 2YU2A 5FY7A 2BG9A 4IDZA 3CX7B 1U4QA 2BG9B 4UM1A 5ETWA 4HFDA 3ZT5A 3CK6A 3FZFB 1KEYA 2X9YA 4B6XA 4QH4A 3PUXF 3KBTA 2CXDA 3FZLB 2J4GA 5LGTB 4NPPA 3AA0B 5LA6E 3ONJA 4LF6T 2BS3A 5J5FA 4PJLA 3T4MA 2XTLA 1EZ3A 4N78D 4JEHB 2B76A 4UM3A 2DHRA 2UXCT 2PTFA 1XDPA 5AQQB 3B5MA 5HEHA 3EABA 4UV8B 1J5ET 3RH3A 3CX6B 3C4XA 2DI4A 3P8CD 2H3RA 4YHHT 4U74A 3OTOT 3RRWA 3ZYMA 3CVRA 4LFAT 5J0ZA 2WU5A 4BJMA 5CJ5A 2Y56A 3FBLA 1MNEA 4QH5A 2XQ5A 3GN5B 4ZHQE 5J5IA 4I55E 2LSJA 4IE5A 1M7KA 4PJNA 1H7CA 2DLRA 4UXUA 2UUCT 3ZSSA 2YDSA 2CBJA 4GYRA 3ONXA 1QUUA 3GMIA 5CFBA 3PEOA 4HFBA 4IIJE 4AQFA 3K3OA 3ZPOA 3IF8B 1U5PA 2LKHA 1FMVA 1D0XA 4EIWA 3SWHA 2BR7A 2PJQA 4FRRA 5HCMA 1WFDA 5AQSB 4HKAA 1IBMT 3Q2MA 3GUAA 4ILBA 4TWHA 4C90A 1Z8UA 1FJGT 3TLVA 1US7B 3A5XA 4P09A 2NW9A 2KWIB 3HKBE 3UTKA 4ILUA 4UVCB 2X00D 4UVAB 4UM3P 4DV7T 5L3BB 2H88A 2V6YA 2V7KA 3O4XE 5C8YE 5HEGA 5A1LA 4YSXA 5BRXA 1IJ6A 3FXDB 3F57A 2IAKA 3W15B 2VK9A 1ZOYA 2D0TA 2DWGA 3PUAA 4UIGA 5JR9A 2WDRA 3RQUA 5JR9B 4MBQA 3JCFA 4QXHB 3VR8A 3ZT7A 1YD8G 5HXHA 5ABHA 3RRCA 4PJJA 4EOZB 2J1DG 3AAAB 2XY8B 2QGSA 4UVBB 2D2SA 4Q25A 5AQRB 5J5HA 1MNDA 4YTPA 3IA3A 3BQIA 4X1KE 4YFSA 3JAEA 2YOEA 1XMQT 2X51A 2ACZA 3X1DA 1D1AA 5FYMA 3A8YC 5HYAA 3T1YT 3AECA 3AA1B 4KHZF 4JBWF 1UX5A 3HL6A 3N9QA 2XQ3A 3RLFF 1HNXT 4EZHA 3AEFA 3RYFE 3UU8A 3UUXB 1D0YA 2V8SV 2PFVA 4KP3C 5EK4A 1AJ3A 4UXNB 1UK5A 5LOVE 5JDFA 1ZHCA 2Q9QD 1MMAA 3UU5A 2DL1A 2KXPB 1L0VA 4H9SE 2VKHA 3R6NA 4IE7A 1XNQT 3IBPA 1NEKA 3U8JA 2NTYA 4AKGA 4KX6A 5C3JA 3L09A 2E9XC 2YDQA 2WM9A 4AKRB 2CMRA 3QNUA 2LHRA 4AFHA 4AFTA 4HFCA 3ANWB 1WRDA 2F4VT 1IJ5A 5AQVB 3L3PA 4LMLA 1HS7A 2H7OA 4ZI2D 3PV0F 4EEBA 1N32T 2LOPA 2EHOA 4ISTA 3V5SA 4JUYA 2YINA 5HXSA 2E2AA 2FBWA 4XK9A 1XMOT 3SRZA 4X62T 4MALA 4PAGA 3SIOA 2W62A 1YKHB 1SHZC 3AE5A 4JI0T 4G63A 2WU2A 2BDEA 1BR1A 2A72A 4GK5E 3U78A 5LG4A 2X00A 4LFBT 4IL9A 3SS1A 3ZJ1A 4PW8A 3LK3B 2HHHT 3QC9A 1UCUA 2WWVA 5H6RB 5TVCA 2W67A 2EHOC 4LMKA 3RIFA 5JDLA 1VRBA 3ETVA 5LBMA 1HNWT 4B5DA 3FHNA 2L3LA 4TV9E 4NUUA 1X9BA 2JJ9A 2CRBA 2M6IA 2P9BA 4X65T 4ERRA 2MBGA 3I1AA 2VQFT 1E1HB 1NENA 3O9XA 2W4XA 1FEWA 2ZM6T 3QK6A 2JMHA 4YSYA 4NIQA 4DO0A 4EEDA 2K9AA 4IE0A 4JI3T 2ODVA 2KWHA 3AEBA 3H3AA 2WBLA 4CQIA 1YW0A 4F8HA 2C5KT 5FNVE 3AEDA 2KZ7B 2VKOA 1HNZT 2CM0A 2NR4A 3HA4A 5AQIB 4DBMA 2QRXA 5DJQC 4UEMA 2N1GA 3WAJA 4DMWA 2KNDA 2BJ0A 1NAFA 4IE6A 5AQUB 4AI6A 1MMDA 1YQ4A 2DNXA 5FP3A 2BBJA 1OWAA 4EV6A 4JYAT 2KSRA 4PFPA 1WYBA 4YHJA 3D0TA 5ABEA 2UXDT 2C0SA 1W09A 4UELA 4IHJE 4YT0A 1UW6A 3RYHE 3F2EA 1UX2A 5AFMA 2Q9QB 4DV4T 3QUJA 2ZJVA 2JQKA 3AEEA 3ZMUB 5FVKA 4UM3S 2V5CA 4F6RC 3FZHB 3NZPA 4DV2T 4HE8A 1OEDE 2GK9A 4ZI3C 5J1GA 2X0HA 4TNVA 5JDGA 3CX8B 3ZMSB 2WAUA 1YKEB 4UV9B 3PJAA 3N2OA 1UV6A 2YN6A 3F31A 4AKLA 3LSVA 3DJBA 5FL0A 3ZLIA 1WR0A 2MPKA 2XZEA 4U72A 4BFQA 2LKGA 1X79A 3AE6A 5KXJA 3MZKB 4H9PC 5LGUB 3JAFA 2WMOA 1KK7A 4EXTA 2XNTA 3K3NA 3ABVA 2BR8A 3O1JA 5LXTE 2JMKA 5AFHA 4DUZT 4EYYR 3P4SA 3UU3A 4JI4T 1MIWA 1WR6A 5FXXA 1G73A 4U7YA 2I59A 3RI5A 3EUHA 2RPAA 2Y6XA 3BK9A 2VKJA 4A56A 4WV9A 3P4QA 4IDQA 3KVAA 4G2AA 3ZN0B 4H9RC 1LVKA 4YLHA 2KINB 3CIRA 2BKOA 3N9PA 2NTXA 2XAQB 4OYKA 2DWKA 3UT5E 3EDVA 3AE7A 4J2CA 2LM9A 2D5UA 4TNWA 1Y01A 2E5VA 5J2TE 3AAIA 2AXDS 2CA5A 2E9XD 2XQ7A 3I9YA 3ZSTA 2MOZA 5AFKA 5DQVA 4DBRA 2V7IA 3OPCA 1D1CA 2IUBA 1YQ3A 2W00A 1IZNB 1R8IA 5CA0E 4CN1A 5JDQA 3E08A 3ZKRA 4ASKA 2JQHA 4QABA 3VHLA 3WIPA 3NVOA 5LCYA 4L9IA 2YKSA 5SYOA 4HEAA 3ZDHA 5LMNT 3P4PA 2XQ8A 3Q9DA 2D0UA 5AQFB 1J5WA 3LG7A 3Q5DA 2X66A 3HKEE 4HFEA 3P4RA 4DV6T 2XAFB 2BG9E 3CMLA 1W0BA 4ZXLA 3I0OA 3P50A 2W8GA 2XUEA 1ZEEA 3LBXA 1UURA 5IWAT 1UGOA 3JC6C 2EHOD 3G06A 2WMNA 3PU8A 3HKDE 3RIUC 4E7ZA 2LOSA 3EHZA 2XJ7A 3LJCA 4WYVA 4FJOA 4ADZA 4JI7T 3WTNA 5LB7B 5FXVA 4CI3B 5AFUL 2V26A 3IEEA 3TLWA 2PBIA 4U31A 2XSBA 3AXJA 3RPUA 3AXJB 3ZMZB 5AQJB 4DR4T 5LYJE 2BYSA 5CB4E 1HX8A 2BZBA 5LNKA 2L9QA 2V6YB 2WS3A 1BR2A 3RF1A 4OX9T 4MFRA 3RC3A 2QYWA 3PUSA 2UXBT 3FZMB 4O4HE 1T72A 4QAAA 3RKOA 5HAXA 4LF4T 5HXCA 5AQGB 3N9OA 3E0ZA 2VKDA 5IYZE 2UUAT 4HWCA 4ZR6A 4X64T 4YJ2E 4TWDA 4CXWA 3O1IA 4DV5T 3WTLA 4D01A 4MLKA 4ZS3A 2ZMAA 2ZJUA 2LSKA 3KV6A 3N9NA 4PJMA 1QLBA 5FKYA 2C5JA 5JDMA 2ACXA 4KHPT 2E8IA 5ABGA 4UY2A 1W9RA 3GA8A 2IC6A 5LJMA 4EZ1A 2BVMA 3PUZF 5F8PA 5C2TA 2LM2A 2E9XA 3PURA 2QVAA 3AA7B 4ZI3D 4GYSA 3UQ7A 1KNZA 5DQWA 4I43B 2Y7YA 5JMEA 5FMNA 3VKGA 1HG5A 3ZCIA 2LRKA 3E22E 1WYCA 4ZZCA 3KV9A 3R84B 2YEVC 1W0AA 3VKHA 5LHHB 3UULA 1ZV4X 4IDOA 2ES0A 4X66T 4P0BA 4AXPA 4IE4A 1WCRA 3AE8A 3KVBA 5JQGE 3EDUA 4EYUA 3KINB 4O4LE 2N2NA 4Z90A 4NXMT 2XHEB 2C9TA 5FL1A 2H89A 5EK3A 1MIVA 2JQ9A 3PJAJ 3OVUA 4YTNA 4FI5A 2ODUA 5HEUA 2VL8A 5AQTB 1VCTA 1KNPA 2UXXB 2YMDA 4I4TE 3HI2A 3L39A 1T98A 3PTRB 4H9NC 5EZYE 5L3DB 1SA0E 1KNRA 2BKNA 3PUVF 2EHOB 3RYIE 2NW8A 5L3CB 2IIUA 4XAXB 3EI0A 3NWIA 2WY2A 4L5GA 3WTOA 3I0QA 2A9UA 2XQ6A 4DR3T 3C4WA 5LP6E 2WZYA 3EAMA 2XNUA 4XZCA 2HN1A 5BMVE 3IHRA 2X68A 2OV9A 5AQOB 4HWHA 2A2FX 4DR5T 2WDQA 2HPJA 1HG2A 4IDNA 3RKGA 2A3DA 1J1JA 2XYTA 2IHR1 4ZZBA 3AE1A 3UUMA 2JPFA 3UU4A 4C91A 3KV5A 2VVNA 4AQYT 1GQEA 3CQGB 2YDRA 4X5TA 2X9HA 2J47A 2WQYA 4O4JE 5HEJA 4A98A 2CHNA 4DV0T 3ZMTB 3KV4A 4DR2T 4LF9T 3ESLA 2VVSA 4QACA 4ZS2A 2SPCA 4OFZA 2WCAA 4QWNB 2Y54A 2LE8A 3CQXC 5AFLA 3RX6A 4WW0A 1MIYA 3U8NA 5F3JA 3RQWA 4DR1T 3QB5K 5AQHB 3ZC0A 1FMWA 4TZ4C 3SOLA 3M3ZB 2CWYA 4X1IE 4KI0F 1OEDC 5JH7E 3P7IA 2G0UA 3JC6D 4X20E 2WN9A 2K24A 5LHGB 4JV5T 3OJAA 2WB5A 4KMCA 3AE9A 3WTMA 3MA9A 3ZEFB 5M4YA 4PK4A 2ZM2A 1MMGA 3RIAA 4WNKA 5FXWA 5AFMB 4DNDA 2PG8A 1KFYA 3ZC1A 3TLUA 3PU3A 5AFNA 2YK0A 5BP0A 5AFJA 3PE0A 5LMUT 2W8FA 3A7MA 4PFOA 3UFGA 2LLYA 4LF5T 3NZQA 2VURA 4UR9A 3ZYKA 1N33T 4AKIA 4HWDA 4UF0A 3WTKA 2XPKA 2IDOB 5JRCA 2FJDA 2UZ6A 2W2UA 5JRCB 4HTEA 3RC8A 4XBFB 4I50E 2VASA 3CWZB 4O2BE 3JADA 4U33A 4H9OC 2YU1A 2H7VC 5LGNB 3I9WA 5L4HA 2FJBA 4ZI7E 4YTMA 4JI2T 4ZRUA 3AEAA 1I9BA 1HR0T 4KUMB 2M6BA 2NP9A 4HN9A 3H3MA 3UUNA 1BR4A 5KMGP 4HWIB 2HPLA 5JREA 2KLQA 2XSAA 2CLYC 5L3EB 1T7SA 5AQKB 5CGMA 3N9MA 2WZHA 2WNCA 3PUGA 2I0MA 4X1YE 2IW5B 3RHWA 2AE9A 2CPTA 2WDVA 2PGZA 3C79A 2X9WA 3RGLA 4WZXA 3ZDGA 3ZMVB 2IMLA 1CUNA 2MTQA 3SQ9A 3EVYA 4TN7B 3WAKA 3PUQA 3NBXX 3AEGA 1HFAA 3UUBA 3L8RA 4CI1B 3TLSA 3C64A 2LHNA 4ALXA 3K1SA 4EB6E 2XZ5A 5J5GA 1IAPA 4JI6T 3ZT6A 4A97A 5LHIB 1JNRA 5CO5A 3B13A 3K8PC 2XZ6A 3ONLC 3U8KA 1SUMB 4YY3T 2LSGA 5JDHA 1HX1B 4OHFA 5DABA 3K3QC 4BJNA 2BG9C 2ZM8A 4NZBA 1V9DA 3QB5A 2N9DA 1SE7A 2RA1A 3LFMA 3SH1A 4O2AE 3C84A 3Q5WA 1LKXA 4YJ3E 4ILCA 5LJNA 2XYSA 3AA6B 4TWFA 3RIUA 2KMFA 4U7IA 4L0RA 3U8LA 4ZJSA 2XQYA 4PK5A 2WNLA 2L8KA 4HFHA 4DVDA 4A5XA 3GN5A 4GOUA 5TAOA 5AQNB 4YSZA 4DV1T 1UUSA 4ISSA 4P0AA 4K0UA 5FY1A 4DR7T 4NXNT 4DBQA 4CN4A 3BQKA 4AIUA 4WBOA 2XNVA 4P1NA 2WNJA 5EK2A 4JI8T 2X9XA 3LBXB 5JVDE 2XQ4A 3N2KE 4CI2B 2Z6EA 5HCJA 4Z8XA 4IT4A 2XQ9A 2XAHB 3SFEA 4CZZB 2MAWA 4ZOLE 4LFCT 2CXLA 4COFA 2UXNB 3N9LA 3LDQB 4IL4A 2Y57A 4U2YA 4HGAA 4HQPA 2FJAA 3C51A 1O3XA 2LT3A 4IREA 4QX8B 2WWUA 3PMZA 4TV8E 5KX5E 4ZK4A 3VRBA 4PIRA 3QOFA 4AQFC 2VB6A 5L4EA 2X0LB 4BAYB 1T8BA 3C50A 2WZIA 3WI3A 5L47A 4QH1A 2WSSV 5KDMC 2V7LA 4DUYT 3NKZA 3HR0A 1IBLT 4PNIA 2J62A 2LEHA 3AB3B 3UQ4A 4I0UA 2MYSA 4QHOA 2BYQA 5E0OA 2XASB 3MJXA 4TX5A 2KT9A 2W61A 5KZUA 2W63A 3NRYA 2W66A 4H63H 4Z91A 4B3RT 4ZEYA 4JEUB 1E2AA 2IC9A 2CWOA 2E5LT 3ZCJA 3HKCE 4TUYE 5JR9C 4KBMB 2Y58A 2E9XB 4O4IE 4QXBB 3FB2A 2BKPA 3CPZA 5F5WA 4EAHA 4ANJA 5BR8T 1HCIA 1LVFA 4JI1T 1B7TA 3ZJ2A 3AE2A 3AAEB 3N2GE 4GIWA 2X67A 5IHYA 5LXBA 3OBVE 2Y8DA 3BQLA 2OLTA 4CXYA 2K3WA 3MK7C 2QA7A 3CQCB 3GWHA 1Z0PA 1NWMX 4JLEA 1QSDA 2BYPA 3TKLB 3P4WA 5LG3A 5ADXL 3Q5XA 3KDSE 5KE4A 2NWBA 3N5LA 5LBQB 3J9X1 3FXEB 3MACA 2ZM0A 2CEAA 5AINA 2BYNA 1VOMA 3ANWA 5L3FB 3AE4A 2B1EA 5JTGA 5AQPB 1VCSA 1S94A 3V5UA 4AFGA 5AQMB 2BBHA 2D9DA 2LJLA 2ZLYA 2BS2A 3MKDA 4H9QC 1I94T 3TLTA 3ZYLA 1HF8A 5GONE 4HWFA 4DMVA 4MHCA 3C4ZA 3AVSA 2HH7A 3ETUA 2NOXA 4AISA 5BW2A 1DU2A 2YMEA 1ZKEA 3VR9A 5HWXA 3SFDA 5HXRA 2CCQA 3FZKB 3IGQA 4U3CA 5FVLA 5L2LA 2V7JA 3MXZA 3DTOA 1ZP0A 4ZJTA 4LF7T 2CXFA 2RP4A 4GKKT 3O1HA 4DV3T 1LRZA 2BVLA 3H37A 2CHOA 1XDOA 4V1Av 2XAGB 4CXXA 2PH9A 3M65A 3J7Yq 3LK2B 4XHEA 2I6HA 1OXZA 1N36T 3PDYA 2V1DB 4ILAA 3KBUA 2DCFA 1OEDA 4ZK1A 1OEDB 2JRKA 4U2ZA 2LSYA 3WTJA 2BS4A 4E7SA 1M62A 5FY0A 4EZ4A 3AE3A 4EGWA 2FJEA 4M1PA 3DP7A 2FUPA 2K48A 3T8OA 2XAJB 1XNRT 3PUWF 1WLXA 5J2UE 5IUXA 3OYXA 4GKJT 5ABFA 3U8MA 1D0ZA 4NUVA 3AVRA 5ABFB 2XM1A 4HFVA 4LF8T 1JNZA 1MMNA 5H6QB 4BQTA 1D1BA 1CHUA 1N34T 3T1HT 3NRXA 4JI5T 3WTHA 3OYZA 1XZYA 1XWMA 2HN2A 5HWYA 2V6XA 4K0KT 3SQ6A 1YXRA 2K5BB 2NW7A 2BYRA 2W0GA 1E7PA 1Y64B 2VL0A 5L3GB 3CKDA 3UFEA 2M67A 2Y48B 2VWAA 2LRLA 2QC1B 4IGUA 3VU7H 4QX7B 2Q9QA 5HEOA 3WTIA 2CBIA
chains in the Genus database with same CATH topology
4NPPA 4TWDA 4QACA 4NZBA 2XQAA 2BR7A 5L4EA 4FRRA 4ZRUA 3SIOA 5HCMA 5HEUA 4HFEA 2Y54A 1I9BA 4XHEA 3WTLA 3SH1A 5AFLA 4D01A 2M6BA 2YMDA 3C84A 3RI5A 2BYPA 4ILAA 3T4MA 5J5FA 5L47A 2ZJUA 4QH1A 2BG9E 3U8NA 3P4WA 5LG3A 2X00A 2XQ3A 3RQWA 4ILCA 4IL9A 4ILBA 2XYSA 3GUAA 1OEDA 5FJVA 5KE4A 4ZK1A 4WV9A 2KSRA 4HFIA 4TWHA 1OEDB 3P50A 3TLVA 2W8GA 3WTJA 4TWFA 4UM3A 3UU8A 5TVCA 1UW6A 1UX2A 5AFMA 4LMKA 1OEDC 3U8LA 3UQ4A 4ZJSA 2BYQA 2WNCA 2X00D 3RIFA 2WNLA 4UY2A 5AINA 4HFHA 2ZJVA 4UM3P 3EI0A 4UM3S 2BYNA 5HEHA 2WN9A 3RHWA 5KZUA 3EHZA 4EZ1A 4B5DA 2PGZA 3C79A 3WTOA 3ZDGA 2XQ6A 3UU5A 3WTMA 2LM2A 5IUXA 5HEGA 1OEDE 2WZYA 3SQ9A 3EAMA 2XNUA 3U8MA 3WTNA 2M6IA 5BRXA 4Z91A 4AFGA 4TNVA 4TNWA 3RIAA 3U8JA 2XNVA 3TLWA 5J0ZA 4BQTA 2WNJA 3UQ7A 3TLTA 5AFMB 2Y56A 2Y7YA 5JMEA 2XQ7A 1UV6A 4QH5A 3UUBA 2YN6A 2XQ4A 4AFHA 3WTHA 5AFKA 4AFTA 4HFCA 2XQ5A 3TLUA 2BYSA 3RQUA 5AFNA 3TLSA 5J5IA 5BP0A 5AFJA 2XYTA 5BW2A 4ALXA 3LSVA 2YMEA 5HCJA 2XZ5A 5J5GA 4ZZCA 2W8FA 2XQ9A 3IGQA 2Y58A 4LMLA 2LLYA 3SQ6A 3ZKRA 4LMJA 4BFQA 4A97A 3UU6A 4ZJTA 4ZZBA 4QABA 4UXUA 4F8HA 2LKGA 5CO5A 3WTKA 2BYRA 2MAWA 3WIPA 2XZ6A 2VL0A 3UU4A 4QAAA 5SYOA 2YKSA 3ZDHA 4COFA 3U8KA 2UZ6A 5CFBA 5J5HA 4DBMA 4IL4A 3PEOA 2BG9A 4HFBA 2Y57A 2XQ8A 3JAFA 2BG9B 4HQPA 4X5TA 4UM1A 4HFDA 4IREA 3JADA 2XNTA 5LXBA 2QC1B 3JAEA 4Z90A 3PMZA 4QH4A 5HEJA 4A98A 2BR8A 2C9TA 2BG9C 4ZR6A 5HEOA 3WTIA 2LKHA 4ZK4A 5AFHA 4XK9A 2YOEA 5L4HA 3UU3A 2PH9A 4PIRA 2BJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPP A;  4TWD A;  4QAC A;  4NZB A;  2XQA A;  2BR7 A;  5L4E A;  4FRR A;  4ZRU A;  3SIO A;  5HCM A;  5HEU A;  4HFE A;  2Y54 A;  1I9B A;  4XHE A;  3WTL A;  3SH1 A;  5AFL A;  4D01 A;  2M6B A;  2YMD A;  3C84 A;  3RI5 A;  2BYP A;  4ILA A;  3T4M A;  5J5F A;  5L47 A;  2ZJU A;  4QH1 A;  2BG9 E;  3U8N A;  3P4W A;  5LG3 A;  2X00 A;  2XQ3 A;  3RQW A;  4ILC A;  4IL9 A;  4ILB A;  2XYS A;  3GUA A;  1OED A;  5FJV A;  5KE4 A;  4ZK1 A;  4WV9 A;  2KSR A;  4HFI A;  4TWH A;  1OED B;  3P50 A;  3TLV A;  2W8G A;  3WTJ A;  4TWF A;  4UM3 A;  3UU8 A;  5TVC A;  1UW6 A;  1UX2 A;  5AFM A;  4LMK A;  1OED C;  3U8L A;  3UQ4 A;  4ZJS A;  2BYQ A;  2WNC A;  2X00 D;  3RIF A;  2WNL A;  4UY2 A;  5AIN A;  4HFH A;  2ZJV A;  4UM3 P;  3EI0 A;  4UM3 S;  2BYN A;  5HEH A;  2WN9 A;  3RHW A;  5KZU A;  3EHZ A;  4EZ1 A;  4B5D A;  2PGZ A;  3C79 A;  3WTO A;  3ZDG A;  2XQ6 A;  3UU5 A;  3WTM A;  2LM2 A;  5IUX A;  5HEG A;  1OED E;  2WZY A;  3SQ9 A;  3EAM A;  2XNU A;  3U8M A;  3WTN A;  2M6I A;  5BRX A;  4Z91 A;  4AFG A;  4TNV A;  4TNW A;  3RIA A;  3U8J A;  2XNV A;  3TLW A;  5J0Z A;  4BQT A;  2WNJ A;  3UQ7 A;  3TLT A;  5AFM B;  2Y56 A;  2Y7Y A;  5JME A;  2XQ7 A;  1UV6 A;  4QH5 A;  3UUB A;  2YN6 A;  2XQ4 A;  4AFH A;  3WTH A;  5AFK A;  4AFT A;  4HFC A;  2XQ5 A;  3TLU A;  2BYS A;  3RQU A;  5AFN A;  3TLS A;  5J5I A;  5BP0 A;  5AFJ A;  2XYT A;  5BW2 A;  4ALX A;  3LSV A;  2YME A;  5HCJ A;  2XZ5 A;  5J5G A;  4ZZC A;  2W8F A;  2XQ9 A;  3IGQ A;  2Y58 A;  4LML A;  2LLY A;  3SQ6 A;  3ZKR A;  4LMJ A;  4BFQ A;  4A97 A;  3UU6 A;  4ZJT A;  4ZZB A;  4QAB A;  4UXU A;  4F8H A;  2LKG A;  5CO5 A;  3WTK A;  2BYR A;  2MAW A;  3WIP A;  2XZ6 A;  2VL0 A;  3UU4 A;  4QAA A;  5SYO A;  2YKS A;  3ZDH A;  4COF A;  3U8K A;  2UZ6 A;  5CFB A;  5J5H A;  4DBM A;  4IL4 A;  3PEO A;  2BG9 A;  4HFB A;  2Y57 A;  2XQ8 A;  3JAF A;  2BG9 B;  4HQP A;  4X5T A;  4UM1 A;  4HFD A;  4IRE A;  3JAD A;  2XNT A;  5LXB A;  2QC1 B;  3JAE A;  4Z90 A;  3PMZ A;  4QH4 A;  5HEJ A;  4A98 A;  2BR8 A;  2C9T A;  2BG9 C;  4ZR6 A;  5HEO A;  3WTI A;  2LKH A;  4ZK4 A;  5AFH A;  4XK9 A;  2YOE A;  5L4H A;  3UU3 A;  2PH9 A;  4PIR A;  2BJ0 A; 
#chains in the Genus database with same CATH topology
 5HXE A;  2XQA A;  4QKN A;  4UF0 B;  3LK4 2;  4IDP A;  3OKQ A;  5FXZ A;  3S4U A;  1KF6 A;  2JIW A;  2VQE T;  4H63 V;  2CLY B;  2UUB T;  1HTJ F;  5FJV A;  3FBZ A;  4HFI A;  1UX4 A;  4BA9 A;  1I6Z A;  2OA5 A;  2WP9 A;  4B3M T;  3PUY F;  4OYJ A;  1BR0 A;  3Q5E A;  2X0Y A;  2JQQ A;  3KFW X;  1FIO A;  2Q9Q C;  2LSI A;  4CN6 A;  3VRA A;  4B3S T;  4OK0 A;  2CE7 A;  3ZN1 B;  4AKH A;  4QXC B;  4DID B;  3U3I A;  2UU9 T;  2XM2 A;  5CA1 E;  4DR6 T;  1S35 A;  4YXD A;  4GK0 E;  4B3T T;  1G8X A;  4AQG A;  2V7M A;  2V5D A;  4PK6 A;  3C98 B;  2C5I T;  4WBN E;  5JDN A;  3B57 A;  4LMJ A;  5AQL B;  3UU6 A;  2R6G F;  4ZI2 C;  4O8S A;  1IBK T;  3RYC E;  2YU2 A;  5FY7 A;  2BG9 A;  4IDZ A;  3CX7 B;  1U4Q A;  2BG9 B;  4UM1 A;  5ETW A;  4HFD A;  3ZT5 A;  3CK6 A;  3FZF B;  1KEY A;  2X9Y A;  4B6X A;  4QH4 A;  3PUX F;  3KBT A;  2CXD A;  3FZL B;  2J4G A;  5LGT B;  4NPP A;  3AA0 B;  5LA6 E;  3ONJ A;  4LF6 T;  2BS3 A;  5J5F A;  4PJL A;  3T4M A;  2XTL A;  1EZ3 A;  4N78 D;  4JEH B;  2B76 A;  4UM3 A;  2DHR A;  2UXC T;  2PTF A;  1XDP A;  5AQQ B;  3B5M A;  5HEH A;  3EAB A;  4UV8 B;  1J5E T;  3RH3 A;  3CX6 B;  3C4X A;  2DI4 A;  3P8C D;  2H3R A;  4YHH T;  4U74 A;  3OTO T;  3RRW A;  3ZYM A;  3CVR A;  4LFA T;  5J0Z A;  2WU5 A;  4BJM A;  5CJ5 A;  2Y56 A;  3FBL A;  1MNE A;  4QH5 A;  2XQ5 A;  3GN5 B;  4ZHQ E;  5J5I A;  4I55 E;  2LSJ A;  4IE5 A;  1M7K A;  4PJN A;  1H7C A;  2DLR A;  4UXU A;  2UUC T;  3ZSS A;  2YDS A;  2CBJ A;  4GYR A;  3ONX A;  1QUU A;  3GMI A;  5CFB A;  3PEO A;  4HFB A;  4IIJ E;  4AQF A;  3K3O A;  3ZPO A;  3IF8 B;  1U5P A;  2LKH A;  1FMV A;  1D0X A;  4EIW A;  3SWH A;  2BR7 A;  2PJQ A;  4FRR A;  5HCM A;  1WFD A;  5AQS B;  4HKA A;  1IBM T;  3Q2M A;  3GUA A;  4ILB A;  4TWH A;  4C90 A;  1Z8U A;  1FJG T;  3TLV A;  1US7 B;  3A5X A;  4P09 A;  2NW9 A;  2KWI B;  3HKB E;  3UTK A;  4ILU A;  4UVC B;  2X00 D;  4UVA B;  4UM3 P;  4DV7 T;  5L3B B;  2H88 A;  2V6Y A;  2V7K A;  3O4X E;  5C8Y E;  5HEG A;  5A1L A;  4YSX A;  5BRX A;  1IJ6 A;  3FXD B;  3F57 A;  2IAK A;  3W15 B;  2VK9 A;  1ZOY A;  2D0T A;  2DWG A;  3PUA A;  4UIG A;  5JR9 A;  2WDR A;  3RQU A;  5JR9 B;  4MBQ A;  3JCF A;  4QXH B;  3VR8 A;  3ZT7 A;  1YD8 G;  5HXH A;  5ABH A;  3RRC A;  4PJJ A;  4EOZ B;  2J1D G;  3AAA B;  2XY8 B;  2QGS A;  4UVB B;  2D2S A;  4Q25 A;  5AQR B;  5J5H A;  1MND A;  4YTP A;  3IA3 A;  3BQI A;  4X1K E;  4YFS A;  3JAE A;  2YOE A;  1XMQ T;  2X51 A;  2ACZ A;  3X1D A;  1D1A A;  5FYM A;  3A8Y C;  5HYA A;  3T1Y T;  3AEC A;  3AA1 B;  4KHZ F;  4JBW F;  1UX5 A;  3HL6 A;  3N9Q A;  2XQ3 A;  3RLF F;  1HNX T;  4EZH A;  3AEF A;  3RYF E;  3UU8 A;  3UUX B;  1D0Y A;  2V8S V;  2PFV A;  4KP3 C;  5EK4 A;  1AJ3 A;  4UXN B;  1UK5 A;  5LOV E;  5JDF A;  1ZHC A;  2Q9Q D;  1MMA A;  3UU5 A;  2DL1 A;  2KXP B;  1L0V A;  4H9S E;  2VKH A;  3R6N A;  4IE7 A;  1XNQ T;  3IBP A;  1NEK A;  3U8J A;  2NTY A;  4AKG A;  4KX6 A;  5C3J A;  3L09 A;  2E9X C;  2YDQ A;  2WM9 A;  4AKR B;  2CMR A;  3QNU A;  2LHR A;  4AFH A;  4AFT A;  4HFC A;  3ANW B;  1WRD A;  2F4V T;  1IJ5 A;  5AQV B;  3L3P A;  4LML A;  1HS7 A;  2H7O A;  4ZI2 D;  3PV0 F;  4EEB A;  1N32 T;  2LOP A;  2EHO A;  4IST A;  3V5S A;  4JUY A;  2YIN A;  5HXS A;  2E2A A;  2FBW A;  4XK9 A;  1XMO T;  3SRZ A;  4X62 T;  4MAL A;  4PAG A;  3SIO A;  2W62 A;  1YKH B;  1SHZ C;  3AE5 A;  4JI0 T;  4G63 A;  2WU2 A;  2BDE A;  1BR1 A;  2A72 A;  4GK5 E;  3U78 A;  5LG4 A;  2X00 A;  4LFB T;  4IL9 A;  3SS1 A;  3ZJ1 A;  4PW8 A;  3LK3 B;  2HHH T;  3QC9 A;  1UCU A;  2WWV A;  5H6R B;  5TVC A;  2W67 A;  2EHO C;  4LMK A;  3RIF A;  5JDL A;  1VRB A;  3ETV A;  5LBM A;  1HNW T;  4B5D A;  3FHN A;  2L3L A;  4TV9 E;  4NUU A;  1X9B A;  2JJ9 A;  2CRB A;  2M6I A;  2P9B A;  4X65 T;  4ERR A;  2MBG A;  3I1A A;  2VQF T;  1E1H B;  1NEN A;  3O9X A;  2W4X A;  1FEW A;  2ZM6 T;  3QK6 A;  2JMH A;  4YSY A;  4NIQ A;  4DO0 A;  4EED A;  2K9A A;  4IE0 A;  4JI3 T;  2ODV A;  2KWH A;  3AEB A;  3H3A A;  2WBL A;  4CQI A;  1YW0 A;  4F8H A;  2C5K T;  5FNV E;  3AED A;  2KZ7 B;  2VKO A;  1HNZ T;  2CM0 A;  2NR4 A;  3HA4 A;  5AQI B;  4DBM A;  2QRX A;  5DJQ C;  4UEM A;  2N1G A;  3WAJ A;  4DMW A;  2KND A;  2BJ0 A;  1NAF A;  4IE6 A;  5AQU B;  4AI6 A;  1MMD A;  1YQ4 A;  2DNX A;  5FP3 A;  2BBJ A;  1OWA A;  4EV6 A;  4JYA T;  2KSR A;  4PFP A;  1WYB A;  4YHJ A;  3D0T A;  5ABE A;  2UXD T;  2C0S A;  1W09 A;  4UEL A;  4IHJ E;  4YT0 A;  1UW6 A;  3RYH E;  3F2E A;  1UX2 A;  5AFM A;  2Q9Q B;  4DV4 T;  3QUJ A;  2ZJV A;  2JQK A;  3AEE A;  3ZMU B;  5FVK A;  4UM3 S;  2V5C A;  4F6R C;  3FZH B;  3NZP A;  4DV2 T;  4HE8 A;  1OED E;  2GK9 A;  4ZI3 C;  5J1G A;  2X0H A;  4TNV A;  5JDG A;  3CX8 B;  3ZMS B;  2WAU A;  1YKE B;  4UV9 B;  3PJA A;  3N2O A;  1UV6 A;  2YN6 A;  3F31 A;  4AKL A;  3LSV A;  3DJB A;  5FL0 A;  3ZLI A;  1WR0 A;  2MPK A;  2XZE A;  4U72 A;  4BFQ A;  2LKG A;  1X79 A;  3AE6 A;  5KXJ A;  3MZK B;  4H9P C;  5LGU B;  3JAF A;  2WMO A;  1KK7 A;  4EXT A;  2XNT A;  3K3N A;  3ABV A;  2BR8 A;  3O1J A;  5LXT E;  2JMK A;  5AFH A;  4DUZ T;  4EYY R;  3P4S A;  3UU3 A;  4JI4 T;  1MIW A;  1WR6 A;  5FXX A;  1G73 A;  4U7Y A;  2I59 A;  3RI5 A;  3EUH A;  2RPA A;  2Y6X A;  3BK9 A;  2VKJ A;  4A56 A;  4WV9 A;  3P4Q A;  4IDQ A;  3KVA A;  4G2A A;  3ZN0 B;  4H9R C;  1LVK A;  4YLH A;  2KIN B;  3CIR A;  2BKO A;  3N9P A;  2NTX A;  2XAQ B;  4OYK A;  2DWK A;  3UT5 E;  3EDV A;  3AE7 A;  4J2C A;  2LM9 A;  2D5U A;  4TNW A;  1Y01 A;  2E5V A;  5J2T E;  3AAI A;  2AXD S;  2CA5 A;  2E9X D;  2XQ7 A;  3I9Y A;  3ZST A;  2MOZ A;  5AFK A;  5DQV A;  4DBR A;  2V7I A;  3OPC A;  1D1C A;  2IUB A;  1YQ3 A;  2W00 A;  1IZN B;  1R8I A;  5CA0 E;  4CN1 A;  5JDQ A;  3E08 A;  3ZKR A;  4ASK A;  2JQH A;  4QAB A;  3VHL A;  3WIP A;  3NVO A;  5LCY A;  4L9I A;  2YKS A;  5SYO A;  4HEA A;  3ZDH A;  5LMN T;  3P4P A;  2XQ8 A;  3Q9D A;  2D0U A;  5AQF B;  1J5W A;  3LG7 A;  3Q5D A;  2X66 A;  3HKE E;  4HFE A;  3P4R A;  4DV6 T;  2XAF B;  2BG9 E;  3CML A;  1W0B A;  4ZXL A;  3I0O A;  3P50 A;  2W8G A;  2XUE A;  1ZEE A;  3LBX A;  1UUR A;  5IWA T;  1UGO A;  3JC6 C;  2EHO D;  3G06 A;  2WMN A;  3PU8 A;  3HKD E;  3RIU C;  4E7Z A;  2LOS A;  3EHZ A;  2XJ7 A;  3LJC A;  4WYV A;  4FJO A;  4ADZ A;  4JI7 T;  3WTN A;  5LB7 B;  5FXV A;  4CI3 B;  5AFU L;  2V26 A;  3IEE A;  3TLW A;  2PBI A;  4U31 A;  2XSB A;  3AXJ A;  3RPU A;  3AXJ B;  3ZMZ B;  5AQJ B;  4DR4 T;  5LYJ E;  2BYS A;  5CB4 E;  1HX8 A;  2BZB A;  5LNK A;  2L9Q A;  2V6Y B;  2WS3 A;  1BR2 A;  3RF1 A;  4OX9 T;  4MFR A;  3RC3 A;  2QYW A;  3PUS A;  2UXB T;  3FZM B;  4O4H E;  1T72 A;  4QAA A;  3RKO A;  5HAX A;  4LF4 T;  5HXC A;  5AQG B;  3N9O A;  3E0Z A;  2VKD A;  5IYZ E;  2UUA T;  4HWC A;  4ZR6 A;  4X64 T;  4YJ2 E;  4TWD A;  4CXW A;  3O1I A;  4DV5 T;  3WTL A;  4D01 A;  4MLK A;  4ZS3 A;  2ZMA A;  2ZJU A;  2LSK A;  3KV6 A;  3N9N A;  4PJM A;  1QLB A;  5FKY A;  2C5J A;  5JDM A;  2ACX A;  4KHP T;  2E8I A;  5ABG A;  4UY2 A;  1W9R A;  3GA8 A;  2IC6 A;  5LJM A;  4EZ1 A;  2BVM A;  3PUZ F;  5F8P A;  5C2T A;  2LM2 A;  2E9X A;  3PUR A;  2QVA A;  3AA7 B;  4ZI3 D;  4GYS A;  3UQ7 A;  1KNZ A;  5DQW A;  4I43 B;  2Y7Y A;  5JME A;  5FMN A;  3VKG A;  1HG5 A;  3ZCI A;  2LRK A;  3E22 E;  1WYC A;  4ZZC A;  3KV9 A;  3R84 B;  2YEV C;  1W0A A;  3VKH A;  5LHH B;  3UUL A;  1ZV4 X;  4IDO A;  2ES0 A;  4X66 T;  4P0B A;  4AXP A;  4IE4 A;  1WCR A;  3AE8 A;  3KVB A;  5JQG E;  3EDU A;  4EYU A;  3KIN B;  4O4L E;  2N2N A;  4Z90 A;  4NXM T;  2XHE B;  2C9T A;  5FL1 A;  2H89 A;  5EK3 A;  1MIV A;  2JQ9 A;  3PJA J;  3OVU A;  4YTN A;  4FI5 A;  2ODU A;  5HEU A;  2VL8 A;  5AQT B;  1VCT A;  1KNP A;  2UXX B;  2YMD A;  4I4T E;  3HI2 A;  3L39 A;  1T98 A;  3PTR B;  4H9N C;  5EZY E;  5L3D B;  1SA0 E;  1KNR A;  2BKN A;  3PUV F;  2EHO B;  3RYI E;  2NW8 A;  5L3C B;  2IIU A;  4XAX B;  3EI0 A;  3NWI A;  2WY2 A;  4L5G A;  3WTO A;  3I0Q A;  2A9U A;  2XQ6 A;  4DR3 T;  3C4W A;  5LP6 E;  2WZY A;  3EAM A;  2XNU A;  4XZC A;  2HN1 A;  5BMV E;  3IHR A;  2X68 A;  2OV9 A;  5AQO B;  4HWH A;  2A2F X;  4DR5 T;  2WDQ A;  2HPJ A;  1HG2 A;  4IDN A;  3RKG A;  2A3D A;  1J1J A;  2XYT A;  2IHR 1;  4ZZB A;  3AE1 A;  3UUM A;  2JPF A;  3UU4 A;  4C91 A;  3KV5 A;  2VVN A;  4AQY T;  1GQE A;  3CQG B;  2YDR A;  4X5T A;  2X9H A;  2J47 A;  2WQY A;  4O4J E;  5HEJ A;  4A98 A;  2CHN A;  4DV0 T;  3ZMT B;  3KV4 A;  4DR2 T;  4LF9 T;  3ESL A;  2VVS A;  4QAC A;  4ZS2 A;  2SPC A;  4OFZ A;  2WCA A;  4QWN B;  2Y54 A;  2LE8 A;  3CQX C;  5AFL A;  3RX6 A;  4WW0 A;  1MIY A;  3U8N A;  5F3J A;  3RQW A;  4DR1 T;  3QB5 K;  5AQH B;  3ZC0 A;  1FMW A;  4TZ4 C;  3SOL A;  3M3Z B;  2CWY A;  4X1I E;  4KI0 F;  1OED C;  5JH7 E;  3P7I A;  2G0U A;  3JC6 D;  4X20 E;  2WN9 A;  2K24 A;  5LHG B;  4JV5 T;  3OJA A;  2WB5 A;  4KMC A;  3AE9 A;  3WTM A;  3MA9 A;  3ZEF B;  5M4Y A;  4PK4 A;  2ZM2 A;  1MMG A;  3RIA A;  4WNK A;  5FXW A;  5AFM B;  4DND A;  2PG8 A;  1KFY A;  3ZC1 A;  3TLU A;  3PU3 A;  5AFN A;  2YK0 A;  5BP0 A;  5AFJ A;  3PE0 A;  5LMU T;  2W8F A;  3A7M A;  4PFO A;  3UFG A;  2LLY A;  4LF5 T;  3NZQ A;  2VUR A;  4UR9 A;  3ZYK A;  1N33 T;  4AKI A;  4HWD A;  4UF0 A;  3WTK A;  2XPK A;  2IDO B;  5JRC A;  2FJD A;  2UZ6 A;  2W2U A;  5JRC B;  4HTE A;  3RC8 A;  4XBF B;  4I50 E;  2VAS A;  3CWZ B;  4O2B E;  3JAD A;  4U33 A;  4H9O C;  2YU1 A;  2H7V C;  5LGN B;  3I9W A;  5L4H A;  2FJB A;  4ZI7 E;  4YTM A;  4JI2 T;  4ZRU A;  3AEA A;  1I9B A;  1HR0 T;  4KUM B;  2M6B A;  2NP9 A;  4HN9 A;  3H3M A;  3UUN A;  1BR4 A;  5KMG P;  4HWI B;  2HPL A;  5JRE A;  2KLQ A;  2XSA A;  2CLY C;  5L3E B;  1T7S A;  5AQK B;  5CGM A;  3N9M A;  2WZH A;  2WNC A;  3PUG A;  2I0M A;  4X1Y E;  2IW5 B;  3RHW A;  2AE9 A;  2CPT A;  2WDV A;  2PGZ A;  3C79 A;  2X9W A;  3RGL A;  4WZX A;  3ZDG A;  3ZMV B;  2IML A;  1CUN A;  2MTQ A;  3SQ9 A;  3EVY A;  4TN7 B;  3WAK A;  3PUQ A;  3NBX X;  3AEG A;  1HFA A;  3UUB A;  3L8R A;  4CI1 B;  3TLS A;  3C64 A;  2LHN A;  4ALX A;  3K1S A;  4EB6 E;  2XZ5 A;  5J5G A;  1IAP A;  4JI6 T;  3ZT6 A;  4A97 A;  5LHI B;  1JNR A;  5CO5 A;  3B13 A;  3K8P C;  2XZ6 A;  3ONL C;  3U8K A;  1SUM B;  4YY3 T;  2LSG A;  5JDH A;  1HX1 B;  4OHF A;  5DAB A;  3K3Q C;  4BJN A;  2BG9 C;  2ZM8 A;  4NZB A;  1V9D A;  3QB5 A;  2N9D A;  1SE7 A;  2RA1 A;  3LFM A;  3SH1 A;  4O2A E;  3C84 A;  3Q5W A;  1LKX A;  4YJ3 E;  4ILC A;  5LJN A;  2XYS A;  3AA6 B;  4TWF A;  3RIU A;  2KMF A;  4U7I A;  4L0R A;  3U8L A;  4ZJS A;  2XQY A;  4PK5 A;  2WNL A;  2L8K A;  4HFH A;  4DVD A;  4A5X A;  3GN5 A;  4GOU A;  5TAO A;  5AQN B;  4YSZ A;  4DV1 T;  1UUS A;  4ISS A;  4P0A A;  4K0U A;  5FY1 A;  4DR7 T;  4NXN T;  4DBQ A;  4CN4 A;  3BQK A;  4AIU A;  4WBO A;  2XNV A;  4P1N A;  2WNJ A;  5EK2 A;  4JI8 T;  2X9X A;  3LBX B;  5JVD E;  2XQ4 A;  3N2K E;  4CI2 B;  2Z6E A;  5HCJ A;  4Z8X A;  4IT4 A;  2XQ9 A;  2XAH B;  3SFE A;  4CZZ B;  2MAW A;  4ZOL E;  4LFC T;  2CXL A;  4COF A;  2UXN B;  3N9L A;  3LDQ B;  4IL4 A;  2Y57 A;  4U2Y A;  4HGA A;  4HQP A;  2FJA A;  3C51 A;  1O3X A;  2LT3 A;  4IRE A;  4QX8 B;  2WWU A;  3PMZ A;  4TV8 E;  5KX5 E;  4ZK4 A;  3VRB A;  4PIR A;  3QOF A;  4AQF C;  2VB6 A;  5L4E A;  2X0L B;  4BAY B;  1T8B A;  3C50 A;  2WZI A;  3WI3 A;  5L47 A;  4QH1 A;  2WSS V;  5KDM C;  2V7L A;  4DUY T;  3NKZ A;  3HR0 A;  1IBL T;  4PNI A;  2J62 A;  2LEH A;  3AB3 B;  3UQ4 A;  4I0U A;  2MYS A;  4QHO A;  2BYQ A;  5E0O A;  2XAS B;  3MJX A;  4TX5 A;  2KT9 A;  2W61 A;  5KZU A;  2W63 A;  3NRY A;  2W66 A;  4H63 H;  4Z91 A;  4B3R T;  4ZEY A;  4JEU B;  1E2A A;  2IC9 A;  2CWO A;  2E5L T;  3ZCJ A;  3HKC E;  4TUY E;  5JR9 C;  4KBM B;  2Y58 A;  2E9X B;  4O4I E;  4QXB B;  3FB2 A;  2BKP A;  3CPZ A;  5F5W A;  4EAH A;  4ANJ A;  5BR8 T;  1HCI A;  1LVF A;  4JI1 T;  1B7T A;  3ZJ2 A;  3AE2 A;  3AAE B;  3N2G E;  4GIW A;  2X67 A;  5IHY A;  5LXB A;  3OBV E;  2Y8D A;  3BQL A;  2OLT A;  4CXY A;  2K3W A;  3MK7 C;  2QA7 A;  3CQC B;  3GWH A;  1Z0P A;  1NWM X;  4JLE A;  1QSD A;  2BYP A;  3TKL B;  3P4W A;  5LG3 A;  5ADX L;  3Q5X A;  3KDS E;  5KE4 A;  2NWB A;  3N5L A;  5LBQ B;  3J9X 1;  3FXE B;  3MAC A;  2ZM0 A;  2CEA A;  5AIN A;  2BYN A;  1VOM A;  3ANW A;  5L3F B;  3AE4 A;  2B1E A;  5JTG A;  5AQP B;  1VCS A;  1S94 A;  3V5U A;  4AFG A;  5AQM B;  2BBH A;  2D9D A;  2LJL A;  2ZLY A;  2BS2 A;  3MKD A;  4H9Q C;  1I94 T;  3TLT A;  3ZYL A;  1HF8 A;  5GON E;  4HWF A;  4DMV A;  4MHC A;  3C4Z A;  3AVS A;  2HH7 A;  3ETU A;  2NOX A;  4AIS A;  5BW2 A;  1DU2 A;  2YME A;  1ZKE A;  3VR9 A;  5HWX A;  3SFD A;  5HXR A;  2CCQ A;  3FZK B;  3IGQ A;  4U3C A;  5FVL A;  5L2L A;  2V7J A;  3MXZ A;  3DTO A;  1ZP0 A;  4ZJT A;  4LF7 T;  2CXF A;  2RP4 A;  4GKK T;  3O1H A;  4DV3 T;  1LRZ A;  2BVL A;  3H37 A;  2CHO A;  1XDO A;  4V1A v;  2XAG B;  4CXX A;  2PH9 A;  3M65 A;  3J7Y q;  3LK2 B;  4XHE A;  2I6H A;  1OXZ A;  1N36 T;  3PDY A;  2V1D B;  4ILA A;  3KBU A;  2DCF A;  1OED A;  4ZK1 A;  1OED B;  2JRK A;  4U2Z A;  2LSY A;  3WTJ A;  2BS4 A;  4E7S A;  1M62 A;  5FY0 A;  4EZ4 A;  3AE3 A;  4EGW A;  2FJE A;  4M1P A;  3DP7 A;  2FUP A;  2K48 A;  3T8O A;  2XAJ B;  1XNR T;  3PUW F;  1WLX A;  5J2U E;  5IUX A;  3OYX A;  4GKJ T;  5ABF A;  3U8M A;  1D0Z A;  4NUV A;  3AVR A;  5ABF B;  2XM1 A;  4HFV A;  4LF8 T;  1JNZ A;  1MMN A;  5H6Q B;  4BQT A;  1D1B A;  1CHU A;  1N34 T;  3T1H T;  3NRX A;  4JI5 T;  3WTH A;  3OYZ A;  1XZY A;  1XWM A;  2HN2 A;  5HWY A;  2V6X A;  4K0K T;  3SQ6 A;  1YXR A;  2K5B B;  2NW7 A;  2BYR A;  2W0G A;  1E7P A;  1Y64 B;  2VL0 A;  5L3G B;  3CKD A;  3UFE A;  2M67 A;  2Y48 B;  2VWA A;  2LRL A;  2QC1 B;  4IGU A;  3VU7 H;  4QX7 B;  2Q9Q A;  5HEO A;  3WTI A;  2CBI A; 
#chains in the Genus database with same CATH homology
 4NPP A;  4TWD A;  4QAC A;  4NZB A;  2XQA A;  2BR7 A;  5L4E A;  4FRR A;  4ZRU A;  3SIO A;  5HCM A;  5HEU A;  4HFE A;  2Y54 A;  1I9B A;  4XHE A;  3WTL A;  3SH1 A;  5AFL A;  4D01 A;  2M6B A;  2YMD A;  3C84 A;  3RI5 A;  2BYP A;  4ILA A;  3T4M A;  5J5F A;  5L47 A;  2ZJU A;  4QH1 A;  2BG9 E;  3U8N A;  3P4W A;  5LG3 A;  2X00 A;  2XQ3 A;  3RQW A;  4ILC A;  4IL9 A;  4ILB A;  2XYS A;  3GUA A;  1OED A;  5FJV A;  5KE4 A;  4ZK1 A;  4WV9 A;  2KSR A;  4HFI A;  4TWH A;  1OED B;  3P50 A;  3TLV A;  2W8G A;  3WTJ A;  4TWF A;  4UM3 A;  3UU8 A;  5TVC A;  1UW6 A;  1UX2 A;  5AFM A;  4LMK A;  1OED C;  3U8L A;  3UQ4 A;  4ZJS A;  2BYQ A;  2WNC A;  2X00 D;  3RIF A;  2WNL A;  4UY2 A;  5AIN A;  4HFH A;  2ZJV A;  4UM3 P;  3EI0 A;  4UM3 S;  2BYN A;  5HEH A;  2WN9 A;  3RHW A;  5KZU A;  3EHZ A;  4EZ1 A;  4B5D A;  2PGZ A;  3C79 A;  3WTO A;  3ZDG A;  2XQ6 A;  3UU5 A;  3WTM A;  2LM2 A;  5IUX A;  5HEG A;  1OED E;  2WZY A;  3SQ9 A;  3EAM A;  2XNU A;  3U8M A;  3WTN A;  2M6I A;  5BRX A;  4Z91 A;  4AFG A;  4TNV A;  4TNW A;  3RIA A;  3U8J A;  2XNV A;  3TLW A;  5J0Z A;  4BQT A;  2WNJ A;  3UQ7 A;  3TLT A;  5AFM B;  2Y56 A;  2Y7Y A;  5JME A;  2XQ7 A;  1UV6 A;  4QH5 A;  3UUB A;  2YN6 A;  2XQ4 A;  4AFH A;  3WTH A;  5AFK A;  4AFT A;  4HFC A;  2XQ5 A;  3TLU A;  2BYS A;  3RQU A;  5AFN A;  3TLS A;  5J5I A;  5BP0 A;  5AFJ A;  2XYT A;  5BW2 A;  4ALX A;  3LSV A;  2YME A;  5HCJ A;  2XZ5 A;  5J5G A;  4ZZC A;  2W8F A;  2XQ9 A;  3IGQ A;  2Y58 A;  4LML A;  2LLY A;  3SQ6 A;  3ZKR A;  4LMJ A;  4BFQ A;  4A97 A;  3UU6 A;  4ZJT A;  4ZZB A;  4QAB A;  4UXU A;  4F8H A;  2LKG A;  5CO5 A;  3WTK A;  2BYR A;  2MAW A;  3WIP A;  2XZ6 A;  2VL0 A;  3UU4 A;  4QAA A;  5SYO A;  2YKS A;  3ZDH A;  4COF A;  3U8K A;  2UZ6 A;  5CFB A;  5J5H A;  4DBM A;  4IL4 A;  3PEO A;  2BG9 A;  4HFB A;  2Y57 A;  2XQ8 A;  3JAF A;  2BG9 B;  4HQP A;  4X5T A;  4UM1 A;  4HFD A;  4IRE A;  3JAD A;  2XNT A;  5LXB A;  2QC1 B;  3JAE A;  4Z90 A;  3PMZ A;  4QH4 A;  5HEJ A;  4A98 A;  2BR8 A;  2C9T A;  2BG9 C;  4ZR6 A;  5HEO A;  3WTI A;  2LKH A;  4ZK4 A;  5AFH A;  4XK9 A;  2YOE A;  5L4H A;  3UU3 A;  2PH9 A;  4PIR A;  2BJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...