3P50A

Structure of propofol bound to a pentameric ligand-gated ion channel, glic
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of general anaesthetics bound to a pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3p50A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3p50A01
2LLYA 2LKHA 4TNWA 3WTLA 3ZDGA 5AFNA 2BG9C 5AFKA 5AINA 4TWHA 5HEHA 5AFJA 2UZ6A 2BG9B 4UM3S 3U8NA 4TNVA 5FJVA 4ILBA 5JMEA 4XHEA 2XQ6A 5LG3A 2WNLA 4IL4A 4AFTA 5J5IA 5HCJA 3TLSA 2XYSA 5AFMB 4AFGA 2X00A 3U8KA 3JAEA 1OEDB 1OEDC 4HFHA 4UXUA 2WZYA 3LSVA 3SIOA 5KE4A 2WNJA 2Y57A 5CO5A 4UM1A 5TVCA 3WTMA 5J5GA 2WN9A 5AFLA 4ZK1A 3GUAA 2C9TA 4QACA 2YN6A 2X00D 2W8GA 4ZR6A 3T4MA 2YOEA 3UUBA 2LM2A 4IL9A 2Y7YA 2BYSA 3P4WA 3PEOA 3RQWA 2BYQA 5CFBA 3TLTA 4QAAA 5L47A 3C79A 3SQ6A 3UU5A 3U8MA 2PH9A 2XNTA 2BR7A 3C84A 3WTKA 4A97A 2Y54A 3ZKRA 2Y58A 4QABA 5J5FA 5HEGA 2M6IA 1UW6A 3SH1A 3WTJA 5KZUA 3RHWA 2MAWA 3ZDHA 2LKGA 3U8JA 4WV9A 4COFA 4ZRUA 4ZJTA 3RQUA 3EI0A 4HFIA 2XQ3A 2XQ8A 3JADA 4UM3P 4BFQA 3UU6A 2XQ5A 3UQ7A 4QH1A 5BRXA 4Z91A 4HFDA 3UU4A 2BYNA 2KSRA 4LMLA 3WIPA 2BR8A 3JAFA 1UX2A 3U8LA 4LMJA 4DBMA 4HFBA 5HCMA 3UQ4A 2Y56A 1I9BA 3SQ9A 3PMZA 4TWFA 2XQAA 3WTOA 4NZBA 1UV6A 3IGQA 4NPPA 4B5DA 2XNUA 2QC1B 5SYOA 5LXBA 2VL0A 5L4EA 4AFHA 4Z90A 4ZZCA 2BYRA 2ZJUA 2M6BA 1OEDA 2YMDA 3RI5A 3TLWA 4ZK4A 4PIRA 5HEOA 2YMEA 4HQPA 5AFHA 5AFMA 4EZ1A 5HEUA 4ZZBA 4UY2A 5IUXA 4ILAA 3WTNA 5HEJA 4IREA 3P50A 3UU3A 5J5HA 1OEDE 4HFCA 4TWDA 4QH5A 5J0ZA 3WTIA 4FRRA 2W8FA 4X5TA 2BG9A 4ILCA 4ZJSA 4F8HA 2PGZA 3TLUA 3UU8A 3WTHA 4D01A 2XQ4A 4UM3A 2BG9E 2ZJVA 4LMKA 3EHZA 3TLVA 2XQ7A 3EAMA 5L4HA 2YKSA 2XZ5A 2XNVA 4BQTA 4QH4A 2BYPA 4HFEA 2XYTA 5BW2A 2XZ6A 4XK9A 3RIAA 2WNCA 4A98A 3RIFA 2XQ9A 5BP0A 2BJ0A 4ALXA
chains in the Genus database with same CATH superfamily
4TNWA 4E7SA 4PK5A 1WLXA 2UXNB 4UVAB 3KVBA 5JR9C 2C5KT 2XQ6A 3DP7A 4X20E 4UV8B 2VURA 5JDGA 4P0AA 3AEBA 3T1YT 1VRBA 1OEDB 5KE4A 1UGOA 4H9SE 1E7PA 3N5LA 5AQLB 3GUAA 4IHJE 4IDQA 3ONJA 2JIWA 3C79A 2HPJA 4O2AE 2A9UA 4HGAA 4BJNA 4FJOA 4DV2T 2LKGA 5JDNA 4KI0F 2XQ5A 5IHYA 3AEFA 3BQLA 4DNDA 4DR1T 3JAFA 1CUNA 5HCMA 4B6XA 3N2KE 2H88A 1XMQT 4TX5A 1YD8G 2YU2A 4PJMA 1SA0E 3NRXA 4AFHA 3AAEB 3Q5DA 3QK6A 5HXEA 3PTRB 3ETVA 1KK7A 2V5DA 4KP3C 3L39A 5JR9A 3P8CD 2BVLA 4IE7A 4J2CA 4QH5A 3PDYA 4JUYA 3N2GE 3ZCJA 3UTKA 2ZJVA 5L4HA 5DQWA 5AQGB 5GONE 2BYPA 2XJ7A 4DR6T 3RIAA 2K3WA 4KX6A 4JI5T 1UURA 2BG9C 2E9XD 2PTFA 5LGNB 3ZMZB 4X65T 2KWIB 5LNKA 1EZ3A 3AE7A 2B76A 3NWIA 2X00A 2UXBT 2QA7A 4UM1A 1KFYA 3MACA 3AAIA 4IL9A 3P4WA 3R6NA 2VB6A 4UVBB 5J2UE 2BR7A 2D2SA 2OA5A 1Z0PA 4DUZT 2JRKA 1X9BA 3N2OA 4JBWF 4ZJTA 4QKNA 2LE8A 5EK2A 3I9YA 3N9PA 1GQEA 4BFQA 4ZOLE 2ZM6T 1D1AA 3AEEA 4PW8A 2IC6A 2V1DB 3L8RA 2RA1A 3U8LA 3Q9DA 1U4QA 4HFBA 4PFPA 5AQTB 2Q9QC 2WZHA 3B5MA 3WTOA 5FXXA 4WBOA 4IIJE 2K5BB 2ZLYA 4TV8E 5AFMA 2H7OA 3MA9A 3AE8A 2A2FX 2XSAA 3TLUA 2XY8B 3OYXA 4EAHA 5F3JA 4AKHA 2VWAA 4EXTA 3FZMB 2EHOD 3KFWX 4WYVA 3KVAA 5AQIB 4TUYE 2VKJA 3CX6B 4ZI7E 4QX7B 1SHZC 3ZJ1A 3JAEA 2HHHT 2LHRA 1WFDA 2X0HA 4ZR6A 3UUBA 3ZPOA 2KWHA 2X66A 3LJCA 4AKGA 2XNTA 4ERRA 4YSYA 3UUMA 2IMLA 5C8YE 1KNRA 4MALA 2X67A 3B13A 2BZBA 4O4LE 3G06A 3H3MA 3MKDA 4WV9A 3O9XA 2Y6XA 3OPCA 3RQUA 3HL6A 5AQJB 2YK0A 1FJGT 4DR5T 2Z6EA 4X1IE 4QH1A 4I43B 4LF4T 3AE9A 2QRXA 3EABA 1MMDA 2BDEA 4KMCA 1UCUA 1W09A 3K1SA 2CCQA 2YDQA 3V5UA 5HEOA 2XQYA 5DABA 2KXPB 5AQVB 5J5HA 1D0XA 4UIGA 3AE4A 3I9WA 3ANWA 3WTHA 2Q9QA 3QB5A 2WMNA 3RC8A 4IGUA 2C5IT 1SE7A 2NTXA 4LMKA 3ETUA 1N36T 2W62A 4JI6T 3F57A 4A98A 4ZHQE 5BP0A 2BJ0A 4YXDA 2UZ6A 2IIUA 4XHEA 4MLKA 5J5IA 5E0OA 2K9AA 2CBJA 1OEDC 4ZI3D 4CI1B 3UT5E 2I6HA 5KXJA 4GIWA 3H37A 4G63A 1LVKA 5BR8T 3ZYLA 3WTKA 1E2AA 3JC6D 2BVMA 5LGTB 4QABA 4MFRA 2Q9QB 2UXXB 1N32T 5JDQA 4Q25A 1M62A 2N9DA 4HFVA 2CXLA 5CGMA 4GYRA 1UX2A 2X9WA 3RF1A 2NTYA 4DV0T 4DV3T 4WNKA 1OXZA 2ZM8A 3ZMTB 2ZJUA 2WY2A 1VCTA 2M6BA 1MIVA 4YLHA 2D9DA 3TLWA 3HI2A 4UY2A 2YEVC 3LFMA 3ZN0B 2W4XA 1IBMT 4IE4A 3BK9A 5AQSB 4KBMB 1G73A 5CJ5A 3ZT7A 2WWVA 2LSIA 3IHRA 1MNDA 2VKDA 2CBIA 3RKOA 2DNXA 3RIFA 3ZT5A 2LLYA 4AIUA 4MHCA 3KBTA 3RX6A 4QXHB 4AISA 3I0OA 3C4XA 3O4XE 5FJVA 4ILBA 5JMEA 2WSSV 3FZKB 5AQKB 1H7CA 2K48A 3QC9A 1R8IA 2OLTA 4EYUA 4YJ2E 5JRCA 4A5XA 4ADZA 2WN9A 2GK9A 4QACA 4EYYR 1YKEB 2YN6A 3AXJB 3NKZA 3RQWA 4X1YE 3SQ6A 4L5GA 2WWUA 2HH7A 3ONLC 5AQHB 5KMGP 3K3NA 4DR7T 2UU9T 4OHFA 5LBMA 3CQGB 4YSZA 3C64A 4Z91A 3UU4A 4OK0A 1L0VA 1MIYA 4ZS2A 2BKNA 1YKHB 3HKCE 5FXWA 4DVDA 1HNZT 3JC6C 4LF7T 4DV1T 2ZMAA 4NPPA 2V6YA 4B5DA 3Q2MA 4OX9T 2W00A 4EEDA 2NW8A 3KBUA 4PAGA 4EZ1A 2UXDT 4G2AA 3ZMUB 3E0ZA 1OEDE 4FRRA 2W8FA 2X9HA 5AQFB 4IDNA 1Y64B 2R6GF 3J9X1 3QB5K 3PUSA 2D5UA 4JLEA 1ZP0A 1NENA 3UFEA 2DI4A 5AINA 2V7IA 4F6RC 1T8BA 4ANJA 4JI2T 4TNVA 2KINB 3BQKA 4AFTA 4E7ZA 4JI1T 3U8KA 4U2ZA 1NAFA 3LSVA 5HXRA 2HN1A 2MYSA 4ISTA 2NOXA 2IAKA 4LF8T 5HWYA 1XDPA 3GWHA 4XBFB 1UK5A 3U8MA 1OWAA 5HXSA 4I50E 3P7IA 3KV9A 3ZKRA 3OTOT 2Y58A 2UUCT 2VK9A 4AXPA 4TV9E 2KLQA 2KNDA 2CEAA 4O4JE 3GN5B 3EI0A 5JVDE 2XQ8A 4HWCA 4NIQA 5KDMC 1XZYA 4DBMA 4EZ4A 2OV9A 1Z8UA 3FBZA 2P9BA 2V26A 5A1LA 2XQAA 5L4EA 3C50A 3ZJ2A 3ZC1A 1G8XA 4ZZBA 4PK6A 3ZCIA 1BR1A 3UU3A 4HFCA 4NXNT 4DO0A 5CA1E 2DLRA 1YQ3A 2PJQA 4JI8T 3RLFF 3UU8A 4X62T 5CB4E 2XYTA 4PJLA 2EHOC 2X9YA 5JDHA 3X1DA 5J2TE 3CPZA 3VKHA 2X9XA 5DQVA 3KV6A 4TWHA 2X51A 4HWHA 2L8KA 3O1IA 4ASKA 1LVFA 3TLSA 2XYSA 4JI7T 1YQ4A 2WZYA 4EGWA 3SIOA 3IA3A 1VCSA 5HWXA 1BR2A 3CX8B 4PFOA 4CXXA 4DUYT 2E5LT 4QAAA 2JQHA 3C84A 2LSYA 3H3AA 2I59A 3PE0A 2LT3A 5FXZA 3WTJA 5KZUA 3E22E 1X79A 4HTEA 4HFIA 2W2UA 2D0UA 2X0YA 2LOPA 2C0SA 4PJNA 5EZYE 3AE2A 4DBQA 1MNEA 3AE3A 3SQ9A 3EVYA 3ZT6A 5SYOA 2XPKA 1ZEEA 3AE1A 4IT4A 4UF0A 1O3XA 1IZNB 3AEAA 3EDVA 3CQXC 5HEJA 4CI3B 1FIOA 4K0UA 3P4PA 4YTMA 4X5TA 2LJLA 5ABEA 2UUAT 1JNZA 3A7MA 3HKEE 3QUJA 5L2LA 3E08A 1D1CA 2XZ5A 2DWKA 3OBVE 2WU5A 2E9XB 3LK3B 3FBLA 5LXTE 2LKHA 5ETWA 3ZDGA 5EK3A 2WS3A 3I0QA 4UEMA 5HEHA 1FMWA 4X64T 2VKHA 2YU1A 4CZZB 1D0ZA 4IDZA 3P4QA 5JRCB 4UXUA 1HCIA 4XAXB 2JMKA 3RGLA 3UULA 3K3QC 3P4RA 4ZI3C 2VVSA 3ZLIA 4GOUA 1SUMB 1WR0A 2CPTA 2Y8DA 3RPUA 2UXCT 3RIUA 2H7VC 3PUVF 1T98A 4A97A 5L3EB 3PUYF 5C3JA 3B57A 3RHWA 2XAHB 4IE0A 2XAJB 1XNQT 1Y01A 2XZEA 3UQ7A 5LYJE 2E8IA 4OFZA 1MMGA 4LMJA 2WP9A 5FYMA 3WAJA 3ZYKA 2D0TA 3VKGA 3AAAB 2CRBA 5ADXL 3FHNA 4YTPA 2WU2A 3ZMVB 3FXEB 2PBIA 3DJBA 2BKPA 4CXYA 5LOVE 2N2NA 4HWFA 2BS4A 5ABHA 5JREA 1NWMX 4U7YA 2FJAA 5J0ZA 3WTIA 3M65A 2EHOB 1QLBA 4B3RT 2XZ6A 3N9OA 2WNCA 2V7JA 4U2YA 4LF6T 4NUUA 3LK42 4DV6T 2J47A 1VOMA 3RRCA 2CLYC 3W15B 3U8NA 2YDRA 3VRAA 2E9XA 5LG3A 5AQMB 2BBJA 4IL4A 3AVRA 4YHJA 4DV5T 3SOLA 1S35A 5L3CB 5LB7B 3I1AA 3PJAA 2G0UA 2FJBA 4ZK1A 2V6YB 3C4WA 3AEDA 1BR4A 2DHRA 2LRLA 4U3CA 5L3BB 2V7LA 2ODUA 4HE8A 3MK7C 5LBQB 3LBXB 4Z8XA 4ZRUA 3NBXX 4EB6E 3JADA 5LHIB 3ABVA 2AE9A 2H3RA 3ZEFB 2BYNA 2KSRA 2BKOA 4ISSA 2NW9A 3PMZA 2XTLA 3ANWB 1FEWA 5L3GB 5LG4A 4V1Av 2W61A 4Z90A 2BS2A 4ZK4A 1MMNA 3SWHA 1US7B 4EV6A 5JQGE 4LFAT 4IREA 1N34T 4QXCB 3NZQA 2XAGB 3IEEA 4ILCA 1WRDA 4F8HA 4D01A 3ZSTA 2L9QA 3UUNA 1UX5A 4TZ4C 4YFSA 2YKSA 1HF8A 3LBXA 5LGUB 1IBLT 3F31A 2ACXA 2AXDS 2M67A 2QGSA 2LM9A 1T7SA 5JDMA 5LMUT 2RP4A 5ABGA 5HAXA 5FKYA 1IAPA 1LRZA 2JJ9A 5HCJA 4AFGA 1UUSA 5EK4A 1N33T 5J5GA 3VR8A 2FJDA 2W8GA 3T4MA 2LM2A 2F4VT 2B1EA 2J4GA 4H9NC 2IC9A 2Y7YA 4GK5E 4HWDA 3TLTA 5L47A 3AE5A 3ESLA 2PH9A 2LHNA 2Q9QD 3Q5XA 3FZFB 2CWYA 2V7KA 4H9OC 4WZXA 2WAUA 4KUMB 1CHUA 4YSXA 4AQFC 2WDRA 2LSKA 3FZLB 2VASA 5DJQC 3UQ4A 1IJ5A 1HX1B 1M7KA 2XAFB 5FP3A 3MZKB 2XAQB 2LSJA 4BAYB 5IWAT 2ZM2A 2YMDA 5FVKA 2CA5A 2YMEA 3AE6A 1J5WA 2N1GA 5IUXA 4ILAA 4HEAA 3NRYA 2DCFA 2PGZA 1YXRA 5LCYA 5FMNA 3HKDE 2WZIA 3RH3A 1S94A 2WQYA 3PUZF 4U7IA 4ZS3A 2CM0A 4XK9A 3RYIE 2JQ9A 3WI3A 3C51A 2YINA 5AFKA 2CWOA 5LJNA 1YW0A 3F2EA 5LJMA 4YY3T 5FY7A 5FY0A 2ODVA 2WNJA 4O8SA 4YTNA 3ZN1B 3WTMA 3GN5A 5LA6E 5LHHB 2CXFA 1ZV4X 3PU3A 4IE6A 1W9RA 2IDOB 5ABFB 3ONXA 1WR6A 4U74A 4WBNE 4UXNB 3EDUA 3Q5WA 2MTQA 4A56A 3RC3A 3CK6A 4C91A 4LMLA 3AA7B 4AKIA 4JEUB 3S4UA 3CX7B 2BS3A 3IGQA 2V8SV 2NR4A 2DL1A 3RYHE 5LXBA 2PFVA 1HG5A 4JV5T 1J5ET 1QUUA 4AI6A 3P50A 5L3DB 4CN6A 1B7TA 4ILUA 4YT0A 3EHZA 3TLVA 1UX4A 1T72A 1WYBA 5L3FB 1FMVA 2JMHA 2XHEB 4K0KT 2V6XA 2XQ9A 1LKXA 1DU2A 4AQFA 2E2AA 4N78D 2BG9B 5H6RB 1HG2A 4H63H 4WW0A 4U33A 1ZKEA 2MOZA 4NXMT 2BBHA 2JQKA 2CE7A 5AFMB 4BJMA 5JH7E 1IBKT 4LFCT 4P09A 4IE5A 2KMFA 2X00D 4U72A 2CLYB 2BYSA 2BYQA 4H9PC 1ZOYA 4GK0E 1XNRT 2KZ7B 4KHPT 5AFUL 3FZHB 2VL8A 2Y54A 2LRKA 4OYJA 4M1PA 5HEGA 1UW6A 5M4YA 2RPAA 4O4IE 3U8JA 3DTOA 2ACZA 4GKJT 3SFDA 2A3DA 1ZHCA 4UM3P 2L3LA 5AQOB 4ZXLA 5BRXA 2XUEA 3AECA 1KNPA 4HKAA 5FNVE 2BR8A 1I9BA 3RYCE 2MPKA 2CMRA 5JDFA 2XNUA 5JDLA 2XM1A 4C90A 4EZHA 3RI5A 4JI3T 3N9LA 4I0UA 5HEUA 2MBGA 5TAOA 2VQFT 3T1HT 4UELA 3L09A 5FVLA 2HN2A 2KT9A 3NZPA 4HFEA 4U31A 1E1HB 2J62A 4ZI2D 2YDSA 3CMLA 5AFNA 2IHR1 3AXJA 3VR9A 1HNWT 4IDPA 4DV4T 4CXWA 3WAKA 3T8OA 2LEHA 2I0MA 2XM2A 4HFHA 4PK4A 3KV4A 5JR9B 1JNRA 2Y57A 5F5WA 5CO5A 2WBLA 5AFLA 4L0RA 4QWNB 1NEKA 3PURA 4UR9A 4AQGA 5CFBA 3PU8A 3QNUA 3UU5A 4LFBT 4DIDB 3AA6B 3QOFA 4XZCA 2E9XC 2M6IA 3SH1A 3AA0B 3PUQA 2W67A 2MAWA 1HX8A 4COFA 4O4HE 1XMOT 4X1KE 3PV0F 4CN4A 5BMVE 5HXCA 5ABFA 5F8PA 4CQIA 5FL1A 1HS7A 2QC1B 1W0BA 4H9QC 3K8PC 4PIRA 1WYCA 2VQET 3UUXB 3HR0A 2DWGA 1U5PA 1AJ3A 2LOSA 4P1NA 4PJJA 3ZYMA 4TWDA 3C4ZA 1KF6A 1MMAA 4I4TE 3LK2B 3AA1B 3NVOA 4PNIA 4O2BE 3FB2A 3C98B 4JI4T 4BQTA 3U3IA 5BW2A 4DV7T 3OYZA 4JYAT 2A72A 5FXVA 5KX5E 3O1JA 3WTLA 2W0GA 4HN9A 3D0TA 4UM3S 4EIWA 4NUVA 1W0AA 3CQCB 3PJAJ 2WNLA 4EEBA 4CN1A 3RIUC 3KDSE 4DMVA 3N9NA 3EUHA 4TN7B 3VU7H 2C9TA 4B3ST 2YOEA 3Q5EA 2H89A 3AEGA 5CA0E 5AQUB 2XSBA 4UV9B 1HNXT 4AQYT 5IYZE 3PUGA 4AKRB 4DR3T 2C5JA 2XQ3A 1KNZA 2WDVA 3N9QA 4EOZB 1D0YA 3TKLB 3HA4A 1I94T 2Y56A 1XWMA 3IF8B 3IBPA 3AB3B 3V5SA 2BYRA 1OEDA 4KHZF 5LMNT 5AQQB 5C2TA 4X66T 3RRWA 2QYWA 2BG9E 2Y48B 2V7MA 3EAMA 4DR4T 2UUBT 3LDQB 3KV5A 3AVSA 5AQNB 2SPCA 5J5FA 3MJXA 3ZDHA 4ALXA 3PUXF 4ZEYA 3A5XA 5J1GA 3GMIA 4B3TT 1KEYA 4UVCB 4B3MT 3OJAA 5JTGA 4DR2T 3CKDA 1D1BA 3FXDB 4P0BA 2WMOA 4JEHB 3RYFE 1V9DA 4LF5T 3P4SA 4QX8B 4DBRA 3L3PA 2ZM0A 3GA8A 3SFEA 3U78A 1WCRA 2FUPA 3N9MA 3ZSSA 5HXHA 5LP6E 4ZI2C 2IUBA 4FI5A 3OVUA 4L9IA 3UU6A 1BR0A 2EHOA 4HWIB 1J1JA 3VRBA 3BQIA 2XASB 4TWFA 3M3ZB 3R84B 2CHOA 2JQQA 4AKLA 4ZZCA 5AQRB 3O1HA 4HQPA 5AFHA 5HYAA 3PUWF 2PG8A 2NP9A 5AQPB 2W66A 2NWBA 1HR0T 1QSDA 1MIWA 2XNVA 4QXBB 2QVAA 2J1DG 2WDQA 3J7Yq 4H63V 3PUAA 2V5CA 4CI2B 2ES0A 1I6ZA 5AFJA 3MXZA 4QHOA 1IJ6A 4UF0B 2HPLA 2K24A 3JCFA 3UFGA 2JPFA 2VVNA 5TVCA 3SS1A 2FBWA 3PEOA 3LG7A 3HKBE 4GYSA 3KINB 4YHHT 4LF9T 3A8YC 4BA9A 2W63A 2FJEA 2CHNA 4HFDA 2IW5B 3WIPA 3ZC0A 2WCAA 4NZBA 1UV6A 2VKOA 5FL0A 2VL0A 2NW7A 3RKGA 3SRZA 1HFAA 3VHLA 2LSGA 2X0LB 4DMWA 2CXDA 3K3OA 4OYKA 1HTJF 3WTNA 3CIRA 3CWZB 4I55E 2BG9A 4YJ3E 4GKKT 4ZJSA 3OKQA 2XQ4A 2E5VA 4UM3A 4MBQA 4JI0T 2XQ7A 5H6QB 4QH4A 2X68A 2WM9A 4IDOA 4H9RC 2WB5A 1XDOA 5FY1A 3ZMSB 3CVRA 5LHGB
chains in the Genus database with same CATH topology
2LLYA 2LKHA 4TNWA 3WTLA 3ZDGA 5AFNA 2BG9C 5AFKA 5AINA 4TWHA 5HEHA 5AFJA 2UZ6A 2BG9B 4UM3S 3U8NA 4TNVA 5FJVA 4ILBA 5JMEA 4XHEA 2XQ6A 5LG3A 2WNLA 4IL4A 4AFTA 5J5IA 5HCJA 3TLSA 2XYSA 5AFMB 4AFGA 2X00A 3U8KA 3JAEA 1OEDB 1OEDC 4HFHA 4UXUA 2WZYA 3LSVA 3SIOA 5KE4A 2WNJA 2Y57A 5CO5A 4UM1A 5TVCA 3WTMA 5J5GA 2WN9A 5AFLA 4ZK1A 3GUAA 2C9TA 4QACA 2YN6A 2X00D 2W8GA 4ZR6A 3T4MA 2YOEA 3UUBA 2LM2A 4IL9A 2Y7YA 2BYSA 3P4WA 3PEOA 3RQWA 2BYQA 5CFBA 3TLTA 4QAAA 5L47A 3C79A 3SQ6A 3UU5A 3U8MA 2PH9A 2XNTA 2BR7A 3C84A 3WTKA 4A97A 2Y54A 3ZKRA 2Y58A 4QABA 5J5FA 5HEGA 2M6IA 1UW6A 3SH1A 3WTJA 5KZUA 3RHWA 2MAWA 3ZDHA 2LKGA 3U8JA 4WV9A 4COFA 4ZRUA 4ZJTA 3RQUA 3EI0A 4HFIA 2XQ3A 2XQ8A 3JADA 4UM3P 4BFQA 3UU6A 2XQ5A 3UQ7A 4QH1A 5BRXA 4Z91A 4HFDA 3UU4A 2BYNA 2KSRA 4LMLA 3WIPA 2BR8A 3JAFA 1UX2A 3U8LA 4LMJA 4DBMA 4HFBA 5HCMA 3UQ4A 2Y56A 1I9BA 3SQ9A 3PMZA 4TWFA 2XQAA 3WTOA 4NZBA 1UV6A 3IGQA 4NPPA 4B5DA 2XNUA 2QC1B 5SYOA 5LXBA 2VL0A 5L4EA 4AFHA 4Z90A 4ZZCA 2BYRA 2ZJUA 2M6BA 1OEDA 2YMDA 3RI5A 3TLWA 4ZK4A 4PIRA 5HEOA 2YMEA 4HQPA 5AFHA 5AFMA 4EZ1A 5HEUA 4ZZBA 4UY2A 5IUXA 4ILAA 3WTNA 5HEJA 4IREA 3P50A 3UU3A 5J5HA 1OEDE 4HFCA 4TWDA 4QH5A 5J0ZA 3WTIA 4FRRA 2W8FA 4X5TA 2BG9A 4ILCA 4ZJSA 4F8HA 2PGZA 3TLUA 3UU8A 3WTHA 4D01A 2XQ4A 4UM3A 2BG9E 2ZJVA 4LMKA 3EHZA 3TLVA 2XQ7A 3EAMA 5L4HA 2YKSA 2XZ5A 2XNVA 4BQTA 4QH4A 2BYPA 4HFEA 2XYTA 5BW2A 2XZ6A 4XK9A 3RIAA 2WNCA 4A98A 3RIFA 2XQ9A 5BP0A 2BJ0A 4ALXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LLY A;  2LKH A;  4TNW A;  3WTL A;  3ZDG A;  5AFN A;  2BG9 C;  5AFK A;  5AIN A;  4TWH A;  5HEH A;  5AFJ A;  2UZ6 A;  2BG9 B;  4UM3 S;  3U8N A;  4TNV A;  5FJV A;  4ILB A;  5JME A;  4XHE A;  2XQ6 A;  5LG3 A;  2WNL A;  4IL4 A;  4AFT A;  5J5I A;  5HCJ A;  3TLS A;  2XYS A;  5AFM B;  4AFG A;  2X00 A;  3U8K A;  3JAE A;  1OED B;  1OED C;  4HFH A;  4UXU A;  2WZY A;  3LSV A;  3SIO A;  5KE4 A;  2WNJ A;  2Y57 A;  5CO5 A;  4UM1 A;  5TVC A;  3WTM A;  5J5G A;  2WN9 A;  5AFL A;  4ZK1 A;  3GUA A;  2C9T A;  4QAC A;  2YN6 A;  2X00 D;  2W8G A;  4ZR6 A;  3T4M A;  2YOE A;  3UUB A;  2LM2 A;  4IL9 A;  2Y7Y A;  2BYS A;  3P4W A;  3PEO A;  3RQW A;  2BYQ A;  5CFB A;  3TLT A;  4QAA A;  5L47 A;  3C79 A;  3SQ6 A;  3UU5 A;  3U8M A;  2PH9 A;  2XNT A;  2BR7 A;  3C84 A;  3WTK A;  4A97 A;  2Y54 A;  3ZKR A;  2Y58 A;  4QAB A;  5J5F A;  5HEG A;  2M6I A;  1UW6 A;  3SH1 A;  3WTJ A;  5KZU A;  3RHW A;  2MAW A;  3ZDH A;  2LKG A;  3U8J A;  4WV9 A;  4COF A;  4ZRU A;  4ZJT A;  3RQU A;  3EI0 A;  4HFI A;  2XQ3 A;  2XQ8 A;  3JAD A;  4UM3 P;  4BFQ A;  3UU6 A;  2XQ5 A;  3UQ7 A;  4QH1 A;  5BRX A;  4Z91 A;  4HFD A;  3UU4 A;  2BYN A;  2KSR A;  4LML A;  3WIP A;  2BR8 A;  3JAF A;  1UX2 A;  3U8L A;  4LMJ A;  4DBM A;  4HFB A;  5HCM A;  3UQ4 A;  2Y56 A;  1I9B A;  3SQ9 A;  3PMZ A;  4TWF A;  2XQA A;  3WTO A;  4NZB A;  1UV6 A;  3IGQ A;  4NPP A;  4B5D A;  2XNU A;  2QC1 B;  5SYO A;  5LXB A;  2VL0 A;  5L4E A;  4AFH A;  4Z90 A;  4ZZC A;  2BYR A;  2ZJU A;  2M6B A;  1OED A;  2YMD A;  3RI5 A;  3TLW A;  4ZK4 A;  4PIR A;  5HEO A;  2YME A;  4HQP A;  5AFH A;  5AFM A;  4EZ1 A;  5HEU A;  4ZZB A;  4UY2 A;  5IUX A;  4ILA A;  3WTN A;  5HEJ A;  4IRE A;  3P50 A;  3UU3 A;  5J5H A;  1OED E;  4HFC A;  4TWD A;  4QH5 A;  5J0Z A;  3WTI A;  4FRR A;  2W8F A;  4X5T A;  2BG9 A;  4ILC A;  4ZJS A;  4F8H A;  2PGZ A;  3TLU A;  3UU8 A;  3WTH A;  4D01 A;  2XQ4 A;  4UM3 A;  2BG9 E;  2ZJV A;  4LMK A;  3EHZ A;  3TLV A;  2XQ7 A;  3EAM A;  5L4H A;  2YKS A;  2XZ5 A;  2XNV A;  4BQT A;  4QH4 A;  2BYP A;  4HFE A;  2XYT A;  5BW2 A;  2XZ6 A;  4XK9 A;  3RIA A;  2WNC A;  4A98 A;  3RIF A;  2XQ9 A;  5BP0 A;  2BJ0 A;  4ALX A; 
#chains in the Genus database with same CATH topology
 4TNW A;  4E7S A;  4PK5 A;  1WLX A;  2UXN B;  4UVA B;  3KVB A;  5JR9 C;  2C5K T;  2XQ6 A;  3DP7 A;  4X20 E;  4UV8 B;  2VUR A;  5JDG A;  4P0A A;  3AEB A;  3T1Y T;  1VRB A;  1OED B;  5KE4 A;  1UGO A;  4H9S E;  1E7P A;  3N5L A;  5AQL B;  3GUA A;  4IHJ E;  4IDQ A;  3ONJ A;  2JIW A;  3C79 A;  2HPJ A;  4O2A E;  2A9U A;  4HGA A;  4BJN A;  4FJO A;  4DV2 T;  2LKG A;  5JDN A;  4KI0 F;  2XQ5 A;  5IHY A;  3AEF A;  3BQL A;  4DND A;  4DR1 T;  3JAF A;  1CUN A;  5HCM A;  4B6X A;  3N2K E;  2H88 A;  1XMQ T;  4TX5 A;  1YD8 G;  2YU2 A;  4PJM A;  1SA0 E;  3NRX A;  4AFH A;  3AAE B;  3Q5D A;  3QK6 A;  5HXE A;  3PTR B;  3ETV A;  1KK7 A;  2V5D A;  4KP3 C;  3L39 A;  5JR9 A;  3P8C D;  2BVL A;  4IE7 A;  4J2C A;  4QH5 A;  3PDY A;  4JUY A;  3N2G E;  3ZCJ A;  3UTK A;  2ZJV A;  5L4H A;  5DQW A;  5AQG B;  5GON E;  2BYP A;  2XJ7 A;  4DR6 T;  3RIA A;  2K3W A;  4KX6 A;  4JI5 T;  1UUR A;  2BG9 C;  2E9X D;  2PTF A;  5LGN B;  3ZMZ B;  4X65 T;  2KWI B;  5LNK A;  1EZ3 A;  3AE7 A;  2B76 A;  3NWI A;  2X00 A;  2UXB T;  2QA7 A;  4UM1 A;  1KFY A;  3MAC A;  3AAI A;  4IL9 A;  3P4W A;  3R6N A;  2VB6 A;  4UVB B;  5J2U E;  2BR7 A;  2D2S A;  2OA5 A;  1Z0P A;  4DUZ T;  2JRK A;  1X9B A;  3N2O A;  4JBW F;  4ZJT A;  4QKN A;  2LE8 A;  5EK2 A;  3I9Y A;  3N9P A;  1GQE A;  4BFQ A;  4ZOL E;  2ZM6 T;  1D1A A;  3AEE A;  4PW8 A;  2IC6 A;  2V1D B;  3L8R A;  2RA1 A;  3U8L A;  3Q9D A;  1U4Q A;  4HFB A;  4PFP A;  5AQT B;  2Q9Q C;  2WZH A;  3B5M A;  3WTO A;  5FXX A;  4WBO A;  4IIJ E;  2K5B B;  2ZLY A;  4TV8 E;  5AFM A;  2H7O A;  3MA9 A;  3AE8 A;  2A2F X;  2XSA A;  3TLU A;  2XY8 B;  3OYX A;  4EAH A;  5F3J A;  4AKH A;  2VWA A;  4EXT A;  3FZM B;  2EHO D;  3KFW X;  4WYV A;  3KVA A;  5AQI B;  4TUY E;  2VKJ A;  3CX6 B;  4ZI7 E;  4QX7 B;  1SHZ C;  3ZJ1 A;  3JAE A;  2HHH T;  2LHR A;  1WFD A;  2X0H A;  4ZR6 A;  3UUB A;  3ZPO A;  2KWH A;  2X66 A;  3LJC A;  4AKG A;  2XNT A;  4ERR A;  4YSY A;  3UUM A;  2IML A;  5C8Y E;  1KNR A;  4MAL A;  2X67 A;  3B13 A;  2BZB A;  4O4L E;  3G06 A;  3H3M A;  3MKD A;  4WV9 A;  3O9X A;  2Y6X A;  3OPC A;  3RQU A;  3HL6 A;  5AQJ B;  2YK0 A;  1FJG T;  4DR5 T;  2Z6E A;  4X1I E;  4QH1 A;  4I43 B;  4LF4 T;  3AE9 A;  2QRX A;  3EAB A;  1MMD A;  2BDE A;  4KMC A;  1UCU A;  1W09 A;  3K1S A;  2CCQ A;  2YDQ A;  3V5U A;  5HEO A;  2XQY A;  5DAB A;  2KXP B;  5AQV B;  5J5H A;  1D0X A;  4UIG A;  3AE4 A;  3I9W A;  3ANW A;  3WTH A;  2Q9Q A;  3QB5 A;  2WMN A;  3RC8 A;  4IGU A;  2C5I T;  1SE7 A;  2NTX A;  4LMK A;  3ETU A;  1N36 T;  2W62 A;  4JI6 T;  3F57 A;  4A98 A;  4ZHQ E;  5BP0 A;  2BJ0 A;  4YXD A;  2UZ6 A;  2IIU A;  4XHE A;  4MLK A;  5J5I A;  5E0O A;  2K9A A;  2CBJ A;  1OED C;  4ZI3 D;  4CI1 B;  3UT5 E;  2I6H A;  5KXJ A;  4GIW A;  3H37 A;  4G63 A;  1LVK A;  5BR8 T;  3ZYL A;  3WTK A;  1E2A A;  3JC6 D;  2BVM A;  5LGT B;  4QAB A;  4MFR A;  2Q9Q B;  2UXX B;  1N32 T;  5JDQ A;  4Q25 A;  1M62 A;  2N9D A;  4HFV A;  2CXL A;  5CGM A;  4GYR A;  1UX2 A;  2X9W A;  3RF1 A;  2NTY A;  4DV0 T;  4DV3 T;  4WNK A;  1OXZ A;  2ZM8 A;  3ZMT B;  2ZJU A;  2WY2 A;  1VCT A;  2M6B A;  1MIV A;  4YLH A;  2D9D A;  3TLW A;  3HI2 A;  4UY2 A;  2YEV C;  3LFM A;  3ZN0 B;  2W4X A;  1IBM T;  4IE4 A;  3BK9 A;  5AQS B;  4KBM B;  1G73 A;  5CJ5 A;  3ZT7 A;  2WWV A;  2LSI A;  3IHR A;  1MND A;  2VKD A;  2CBI A;  3RKO A;  2DNX A;  3RIF A;  3ZT5 A;  2LLY A;  4AIU A;  4MHC A;  3KBT A;  3RX6 A;  4QXH B;  4AIS A;  3I0O A;  3C4X A;  3O4X E;  5FJV A;  4ILB A;  5JME A;  2WSS V;  3FZK B;  5AQK B;  1H7C A;  2K48 A;  3QC9 A;  1R8I A;  2OLT A;  4EYU A;  4YJ2 E;  5JRC A;  4A5X A;  4ADZ A;  2WN9 A;  2GK9 A;  4QAC A;  4EYY R;  1YKE B;  2YN6 A;  3AXJ B;  3NKZ A;  3RQW A;  4X1Y E;  3SQ6 A;  4L5G A;  2WWU A;  2HH7 A;  3ONL C;  5AQH B;  5KMG P;  3K3N A;  4DR7 T;  2UU9 T;  4OHF A;  5LBM A;  3CQG B;  4YSZ A;  3C64 A;  4Z91 A;  3UU4 A;  4OK0 A;  1L0V A;  1MIY A;  4ZS2 A;  2BKN A;  1YKH B;  3HKC E;  5FXW A;  4DVD A;  1HNZ T;  3JC6 C;  4LF7 T;  4DV1 T;  2ZMA A;  4NPP A;  2V6Y A;  4B5D A;  3Q2M A;  4OX9 T;  2W00 A;  4EED A;  2NW8 A;  3KBU A;  4PAG A;  4EZ1 A;  2UXD T;  4G2A A;  3ZMU B;  3E0Z A;  1OED E;  4FRR A;  2W8F A;  2X9H A;  5AQF B;  4IDN A;  1Y64 B;  2R6G F;  3J9X 1;  3QB5 K;  3PUS A;  2D5U A;  4JLE A;  1ZP0 A;  1NEN A;  3UFE A;  2DI4 A;  5AIN A;  2V7I A;  4F6R C;  1T8B A;  4ANJ A;  4JI2 T;  4TNV A;  2KIN B;  3BQK A;  4AFT A;  4E7Z A;  4JI1 T;  3U8K A;  4U2Z A;  1NAF A;  3LSV A;  5HXR A;  2HN1 A;  2MYS A;  4IST A;  2NOX A;  2IAK A;  4LF8 T;  5HWY A;  1XDP A;  3GWH A;  4XBF B;  1UK5 A;  3U8M A;  1OWA A;  5HXS A;  4I50 E;  3P7I A;  3KV9 A;  3ZKR A;  3OTO T;  2Y58 A;  2UUC T;  2VK9 A;  4AXP A;  4TV9 E;  2KLQ A;  2KND A;  2CEA A;  4O4J E;  3GN5 B;  3EI0 A;  5JVD E;  2XQ8 A;  4HWC A;  4NIQ A;  5KDM C;  1XZY A;  4DBM A;  4EZ4 A;  2OV9 A;  1Z8U A;  3FBZ A;  2P9B A;  2V26 A;  5A1L A;  2XQA A;  5L4E A;  3C50 A;  3ZJ2 A;  3ZC1 A;  1G8X A;  4ZZB A;  4PK6 A;  3ZCI A;  1BR1 A;  3UU3 A;  4HFC A;  4NXN T;  4DO0 A;  5CA1 E;  2DLR A;  1YQ3 A;  2PJQ A;  4JI8 T;  3RLF F;  3UU8 A;  4X62 T;  5CB4 E;  2XYT A;  4PJL A;  2EHO C;  2X9Y A;  5JDH A;  3X1D A;  5J2T E;  3CPZ A;  3VKH A;  2X9X A;  5DQV A;  3KV6 A;  4TWH A;  2X51 A;  4HWH A;  2L8K A;  3O1I A;  4ASK A;  1LVF A;  3TLS A;  2XYS A;  4JI7 T;  1YQ4 A;  2WZY A;  4EGW A;  3SIO A;  3IA3 A;  1VCS A;  5HWX A;  1BR2 A;  3CX8 B;  4PFO A;  4CXX A;  4DUY T;  2E5L T;  4QAA A;  2JQH A;  3C84 A;  2LSY A;  3H3A A;  2I59 A;  3PE0 A;  2LT3 A;  5FXZ A;  3WTJ A;  5KZU A;  3E22 E;  1X79 A;  4HTE A;  4HFI A;  2W2U A;  2D0U A;  2X0Y A;  2LOP A;  2C0S A;  4PJN A;  5EZY E;  3AE2 A;  4DBQ A;  1MNE A;  3AE3 A;  3SQ9 A;  3EVY A;  3ZT6 A;  5SYO A;  2XPK A;  1ZEE A;  3AE1 A;  4IT4 A;  4UF0 A;  1O3X A;  1IZN B;  3AEA A;  3EDV A;  3CQX C;  5HEJ A;  4CI3 B;  1FIO A;  4K0U A;  3P4P A;  4YTM A;  4X5T A;  2LJL A;  5ABE A;  2UUA T;  1JNZ A;  3A7M A;  3HKE E;  3QUJ A;  5L2L A;  3E08 A;  1D1C A;  2XZ5 A;  2DWK A;  3OBV E;  2WU5 A;  2E9X B;  3LK3 B;  3FBL A;  5LXT E;  2LKH A;  5ETW A;  3ZDG A;  5EK3 A;  2WS3 A;  3I0Q A;  4UEM A;  5HEH A;  1FMW A;  4X64 T;  2VKH A;  2YU1 A;  4CZZ B;  1D0Z A;  4IDZ A;  3P4Q A;  5JRC B;  4UXU A;  1HCI A;  4XAX B;  2JMK A;  3RGL A;  3UUL A;  3K3Q C;  3P4R A;  4ZI3 C;  2VVS A;  3ZLI A;  4GOU A;  1SUM B;  1WR0 A;  2CPT A;  2Y8D A;  3RPU A;  2UXC T;  3RIU A;  2H7V C;  3PUV F;  1T98 A;  4A97 A;  5L3E B;  3PUY F;  5C3J A;  3B57 A;  3RHW A;  2XAH B;  4IE0 A;  2XAJ B;  1XNQ T;  1Y01 A;  2XZE A;  3UQ7 A;  5LYJ E;  2E8I A;  4OFZ A;  1MMG A;  4LMJ A;  2WP9 A;  5FYM A;  3WAJ A;  3ZYK A;  2D0T A;  3VKG A;  3AAA B;  2CRB A;  5ADX L;  3FHN A;  4YTP A;  2WU2 A;  3ZMV B;  3FXE B;  2PBI A;  3DJB A;  2BKP A;  4CXY A;  5LOV E;  2N2N A;  4HWF A;  2BS4 A;  5ABH A;  5JRE A;  1NWM X;  4U7Y A;  2FJA A;  5J0Z A;  3WTI A;  3M65 A;  2EHO B;  1QLB A;  4B3R T;  2XZ6 A;  3N9O A;  2WNC A;  2V7J A;  4U2Y A;  4LF6 T;  4NUU A;  3LK4 2;  4DV6 T;  2J47 A;  1VOM A;  3RRC A;  2CLY C;  3W15 B;  3U8N A;  2YDR A;  3VRA A;  2E9X A;  5LG3 A;  5AQM B;  2BBJ A;  4IL4 A;  3AVR A;  4YHJ A;  4DV5 T;  3SOL A;  1S35 A;  5L3C B;  5LB7 B;  3I1A A;  3PJA A;  2G0U A;  2FJB A;  4ZK1 A;  2V6Y B;  3C4W A;  3AED A;  1BR4 A;  2DHR A;  2LRL A;  4U3C A;  5L3B B;  2V7L A;  2ODU A;  4HE8 A;  3MK7 C;  5LBQ B;  3LBX B;  4Z8X A;  4ZRU A;  3NBX X;  4EB6 E;  3JAD A;  5LHI B;  3ABV A;  2AE9 A;  2H3R A;  3ZEF B;  2BYN A;  2KSR A;  2BKO A;  4ISS A;  2NW9 A;  3PMZ A;  2XTL A;  3ANW B;  1FEW A;  5L3G B;  5LG4 A;  4V1A v;  2W61 A;  4Z90 A;  2BS2 A;  4ZK4 A;  1MMN A;  3SWH A;  1US7 B;  4EV6 A;  5JQG E;  4LFA T;  4IRE A;  1N34 T;  4QXC B;  3NZQ A;  2XAG B;  3IEE A;  4ILC A;  1WRD A;  4F8H A;  4D01 A;  3ZST A;  2L9Q A;  3UUN A;  1UX5 A;  4TZ4 C;  4YFS A;  2YKS A;  1HF8 A;  3LBX A;  5LGU B;  1IBL T;  3F31 A;  2ACX A;  2AXD S;  2M67 A;  2QGS A;  2LM9 A;  1T7S A;  5JDM A;  5LMU T;  2RP4 A;  5ABG A;  5HAX A;  5FKY A;  1IAP A;  1LRZ A;  2JJ9 A;  5HCJ A;  4AFG A;  1UUS A;  5EK4 A;  1N33 T;  5J5G A;  3VR8 A;  2FJD A;  2W8G A;  3T4M A;  2LM2 A;  2F4V T;  2B1E A;  2J4G A;  4H9N C;  2IC9 A;  2Y7Y A;  4GK5 E;  4HWD A;  3TLT A;  5L47 A;  3AE5 A;  3ESL A;  2PH9 A;  2LHN A;  2Q9Q D;  3Q5X A;  3FZF B;  2CWY A;  2V7K A;  4H9O C;  4WZX A;  2WAU A;  4KUM B;  1CHU A;  4YSX A;  4AQF C;  2WDR A;  2LSK A;  3FZL B;  2VAS A;  5DJQ C;  3UQ4 A;  1IJ5 A;  1HX1 B;  1M7K A;  2XAF B;  5FP3 A;  3MZK B;  2XAQ B;  2LSJ A;  4BAY B;  5IWA T;  2ZM2 A;  2YMD A;  5FVK A;  2CA5 A;  2YME A;  3AE6 A;  1J5W A;  2N1G A;  5IUX A;  4ILA A;  4HEA A;  3NRY A;  2DCF A;  2PGZ A;  1YXR A;  5LCY A;  5FMN A;  3HKD E;  2WZI A;  3RH3 A;  1S94 A;  2WQY A;  3PUZ F;  4U7I A;  4ZS3 A;  2CM0 A;  4XK9 A;  3RYI E;  2JQ9 A;  3WI3 A;  3C51 A;  2YIN A;  5AFK A;  2CWO A;  5LJN A;  1YW0 A;  3F2E A;  5LJM A;  4YY3 T;  5FY7 A;  5FY0 A;  2ODV A;  2WNJ A;  4O8S A;  4YTN A;  3ZN1 B;  3WTM A;  3GN5 A;  5LA6 E;  5LHH B;  2CXF A;  1ZV4 X;  3PU3 A;  4IE6 A;  1W9R A;  2IDO B;  5ABF B;  3ONX A;  1WR6 A;  4U74 A;  4WBN E;  4UXN B;  3EDU A;  3Q5W A;  2MTQ A;  4A56 A;  3RC3 A;  3CK6 A;  4C91 A;  4LML A;  3AA7 B;  4AKI A;  4JEU B;  3S4U A;  3CX7 B;  2BS3 A;  3IGQ A;  2V8S V;  2NR4 A;  2DL1 A;  3RYH E;  5LXB A;  2PFV A;  1HG5 A;  4JV5 T;  1J5E T;  1QUU A;  4AI6 A;  3P50 A;  5L3D B;  4CN6 A;  1B7T A;  4ILU A;  4YT0 A;  3EHZ A;  3TLV A;  1UX4 A;  1T72 A;  1WYB A;  5L3F B;  1FMV A;  2JMH A;  2XHE B;  4K0K T;  2V6X A;  2XQ9 A;  1LKX A;  1DU2 A;  4AQF A;  2E2A A;  4N78 D;  2BG9 B;  5H6R B;  1HG2 A;  4H63 H;  4WW0 A;  4U33 A;  1ZKE A;  2MOZ A;  4NXM T;  2BBH A;  2JQK A;  2CE7 A;  5AFM B;  4BJM A;  5JH7 E;  1IBK T;  4LFC T;  4P09 A;  4IE5 A;  2KMF A;  2X00 D;  4U72 A;  2CLY B;  2BYS A;  2BYQ A;  4H9P C;  1ZOY A;  4GK0 E;  1XNR T;  2KZ7 B;  4KHP T;  5AFU L;  3FZH B;  2VL8 A;  2Y54 A;  2LRK A;  4OYJ A;  4M1P A;  5HEG A;  1UW6 A;  5M4Y A;  2RPA A;  4O4I E;  3U8J A;  3DTO A;  2ACZ A;  4GKJ T;  3SFD A;  2A3D A;  1ZHC A;  4UM3 P;  2L3L A;  5AQO B;  4ZXL A;  5BRX A;  2XUE A;  3AEC A;  1KNP A;  4HKA A;  5FNV E;  2BR8 A;  1I9B A;  3RYC E;  2MPK A;  2CMR A;  5JDF A;  2XNU A;  5JDL A;  2XM1 A;  4C90 A;  4EZH A;  3RI5 A;  4JI3 T;  3N9L A;  4I0U A;  5HEU A;  2MBG A;  5TAO A;  2VQF T;  3T1H T;  4UEL A;  3L09 A;  5FVL A;  2HN2 A;  2KT9 A;  3NZP A;  4HFE A;  4U31 A;  1E1H B;  2J62 A;  4ZI2 D;  2YDS A;  3CML A;  5AFN A;  2IHR 1;  3AXJ A;  3VR9 A;  1HNW T;  4IDP A;  4DV4 T;  4CXW A;  3WAK A;  3T8O A;  2LEH A;  2I0M A;  2XM2 A;  4HFH A;  4PK4 A;  3KV4 A;  5JR9 B;  1JNR A;  2Y57 A;  5F5W A;  5CO5 A;  2WBL A;  5AFL A;  4L0R A;  4QWN B;  1NEK A;  3PUR A;  4UR9 A;  4AQG A;  5CFB A;  3PU8 A;  3QNU A;  3UU5 A;  4LFB T;  4DID B;  3AA6 B;  3QOF A;  4XZC A;  2E9X C;  2M6I A;  3SH1 A;  3AA0 B;  3PUQ A;  2W67 A;  2MAW A;  1HX8 A;  4COF A;  4O4H E;  1XMO T;  4X1K E;  3PV0 F;  4CN4 A;  5BMV E;  5HXC A;  5ABF A;  5F8P A;  4CQI A;  5FL1 A;  1HS7 A;  2QC1 B;  1W0B A;  4H9Q C;  3K8P C;  4PIR A;  1WYC A;  2VQE T;  3UUX B;  3HR0 A;  2DWG A;  1U5P A;  1AJ3 A;  2LOS A;  4P1N A;  4PJJ A;  3ZYM A;  4TWD A;  3C4Z A;  1KF6 A;  1MMA A;  4I4T E;  3LK2 B;  3AA1 B;  3NVO A;  4PNI A;  4O2B E;  3FB2 A;  3C98 B;  4JI4 T;  4BQT A;  3U3I A;  5BW2 A;  4DV7 T;  3OYZ A;  4JYA T;  2A72 A;  5FXV A;  5KX5 E;  3O1J A;  3WTL A;  2W0G A;  4HN9 A;  3D0T A;  4UM3 S;  4EIW A;  4NUV A;  1W0A A;  3CQC B;  3PJA J;  2WNL A;  4EEB A;  4CN1 A;  3RIU C;  3KDS E;  4DMV A;  3N9N A;  3EUH A;  4TN7 B;  3VU7 H;  2C9T A;  4B3S T;  2YOE A;  3Q5E A;  2H89 A;  3AEG A;  5CA0 E;  5AQU B;  2XSB A;  4UV9 B;  1HNX T;  4AQY T;  5IYZ E;  3PUG A;  4AKR B;  4DR3 T;  2C5J A;  2XQ3 A;  1KNZ A;  2WDV A;  3N9Q A;  4EOZ B;  1D0Y A;  3TKL B;  3HA4 A;  1I94 T;  2Y56 A;  1XWM A;  3IF8 B;  3IBP A;  3AB3 B;  3V5S A;  2BYR A;  1OED A;  4KHZ F;  5LMN T;  5AQQ B;  5C2T A;  4X66 T;  3RRW A;  2QYW A;  2BG9 E;  2Y48 B;  2V7M A;  3EAM A;  4DR4 T;  2UUB T;  3LDQ B;  3KV5 A;  3AVS A;  5AQN B;  2SPC A;  5J5F A;  3MJX A;  3ZDH A;  4ALX A;  3PUX F;  4ZEY A;  3A5X A;  5J1G A;  3GMI A;  4B3T T;  1KEY A;  4UVC B;  4B3M T;  3OJA A;  5JTG A;  4DR2 T;  3CKD A;  1D1B A;  3FXD B;  4P0B A;  2WMO A;  4JEH B;  3RYF E;  1V9D A;  4LF5 T;  3P4S A;  4QX8 B;  4DBR A;  3L3P A;  2ZM0 A;  3GA8 A;  3SFE A;  3U78 A;  1WCR A;  2FUP A;  3N9M A;  3ZSS A;  5HXH A;  5LP6 E;  4ZI2 C;  2IUB A;  4FI5 A;  3OVU A;  4L9I A;  3UU6 A;  1BR0 A;  2EHO A;  4HWI B;  1J1J A;  3VRB A;  3BQI A;  2XAS B;  4TWF A;  3M3Z B;  3R84 B;  2CHO A;  2JQQ A;  4AKL A;  4ZZC A;  5AQR B;  3O1H A;  4HQP A;  5AFH A;  5HYA A;  3PUW F;  2PG8 A;  2NP9 A;  5AQP B;  2W66 A;  2NWB A;  1HR0 T;  1QSD A;  1MIW A;  2XNV A;  4QXB B;  2QVA A;  2J1D G;  2WDQ A;  3J7Y q;  4H63 V;  3PUA A;  2V5C A;  4CI2 B;  2ES0 A;  1I6Z A;  5AFJ A;  3MXZ A;  4QHO A;  1IJ6 A;  4UF0 B;  2HPL A;  2K24 A;  3JCF A;  3UFG A;  2JPF A;  2VVN A;  5TVC A;  3SS1 A;  2FBW A;  3PEO A;  3LG7 A;  3HKB E;  4GYS A;  3KIN B;  4YHH T;  4LF9 T;  3A8Y C;  4BA9 A;  2W63 A;  2FJE A;  2CHN A;  4HFD A;  2IW5 B;  3WIP A;  3ZC0 A;  2WCA A;  4NZB A;  1UV6 A;  2VKO A;  5FL0 A;  2VL0 A;  2NW7 A;  3RKG A;  3SRZ A;  1HFA A;  3VHL A;  2LSG A;  2X0L B;  4DMW A;  2CXD A;  3K3O A;  4OYK A;  1HTJ F;  3WTN A;  3CIR A;  3CWZ B;  4I55 E;  2BG9 A;  4YJ3 E;  4GKK T;  4ZJS A;  3OKQ A;  2XQ4 A;  2E5V A;  4UM3 A;  4MBQ A;  4JI0 T;  2XQ7 A;  5H6Q B;  4QH4 A;  2X68 A;  2WM9 A;  4IDO A;  4H9R C;  2WB5 A;  1XDO A;  5FY1 A;  3ZMS B;  3CVR A;  5LHG B; 
#chains in the Genus database with same CATH homology
 2LLY A;  2LKH A;  4TNW A;  3WTL A;  3ZDG A;  5AFN A;  2BG9 C;  5AFK A;  5AIN A;  4TWH A;  5HEH A;  5AFJ A;  2UZ6 A;  2BG9 B;  4UM3 S;  3U8N A;  4TNV A;  5FJV A;  4ILB A;  5JME A;  4XHE A;  2XQ6 A;  5LG3 A;  2WNL A;  4IL4 A;  4AFT A;  5J5I A;  5HCJ A;  3TLS A;  2XYS A;  5AFM B;  4AFG A;  2X00 A;  3U8K A;  3JAE A;  1OED B;  1OED C;  4HFH A;  4UXU A;  2WZY A;  3LSV A;  3SIO A;  5KE4 A;  2WNJ A;  2Y57 A;  5CO5 A;  4UM1 A;  5TVC A;  3WTM A;  5J5G A;  2WN9 A;  5AFL A;  4ZK1 A;  3GUA A;  2C9T A;  4QAC A;  2YN6 A;  2X00 D;  2W8G A;  4ZR6 A;  3T4M A;  2YOE A;  3UUB A;  2LM2 A;  4IL9 A;  2Y7Y A;  2BYS A;  3P4W A;  3PEO A;  3RQW A;  2BYQ A;  5CFB A;  3TLT A;  4QAA A;  5L47 A;  3C79 A;  3SQ6 A;  3UU5 A;  3U8M A;  2PH9 A;  2XNT A;  2BR7 A;  3C84 A;  3WTK A;  4A97 A;  2Y54 A;  3ZKR A;  2Y58 A;  4QAB A;  5J5F A;  5HEG A;  2M6I A;  1UW6 A;  3SH1 A;  3WTJ A;  5KZU A;  3RHW A;  2MAW A;  3ZDH A;  2LKG A;  3U8J A;  4WV9 A;  4COF A;  4ZRU A;  4ZJT A;  3RQU A;  3EI0 A;  4HFI A;  2XQ3 A;  2XQ8 A;  3JAD A;  4UM3 P;  4BFQ A;  3UU6 A;  2XQ5 A;  3UQ7 A;  4QH1 A;  5BRX A;  4Z91 A;  4HFD A;  3UU4 A;  2BYN A;  2KSR A;  4LML A;  3WIP A;  2BR8 A;  3JAF A;  1UX2 A;  3U8L A;  4LMJ A;  4DBM A;  4HFB A;  5HCM A;  3UQ4 A;  2Y56 A;  1I9B A;  3SQ9 A;  3PMZ A;  4TWF A;  2XQA A;  3WTO A;  4NZB A;  1UV6 A;  3IGQ A;  4NPP A;  4B5D A;  2XNU A;  2QC1 B;  5SYO A;  5LXB A;  2VL0 A;  5L4E A;  4AFH A;  4Z90 A;  4ZZC A;  2BYR A;  2ZJU A;  2M6B A;  1OED A;  2YMD A;  3RI5 A;  3TLW A;  4ZK4 A;  4PIR A;  5HEO A;  2YME A;  4HQP A;  5AFH A;  5AFM A;  4EZ1 A;  5HEU A;  4ZZB A;  4UY2 A;  5IUX A;  4ILA A;  3WTN A;  5HEJ A;  4IRE A;  3P50 A;  3UU3 A;  5J5H A;  1OED E;  4HFC A;  4TWD A;  4QH5 A;  5J0Z A;  3WTI A;  4FRR A;  2W8F A;  4X5T A;  2BG9 A;  4ILC A;  4ZJS A;  4F8H A;  2PGZ A;  3TLU A;  3UU8 A;  3WTH A;  4D01 A;  2XQ4 A;  4UM3 A;  2BG9 E;  2ZJV A;  4LMK A;  3EHZ A;  3TLV A;  2XQ7 A;  3EAM A;  5L4H A;  2YKS A;  2XZ5 A;  2XNV A;  4BQT A;  4QH4 A;  2BYP A;  4HFE A;  2XYT A;  5BW2 A;  2XZ6 A;  4XK9 A;  3RIA A;  2WNC A;  4A98 A;  3RIF A;  2XQ9 A;  5BP0 A;  2BJ0 A;  4ALX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...