2Y57A

Fragment growing induces conformational changes in acetylcholine- binding protein: a structural and thermodynamic analysis - (compound 4)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Fragment Growing Induces Conformational Changes in Acetylcholine-Binding Protein: A Structural and Thermodynamic Analysis.
pubmed doi rcsb
source organism Aplysia californica
total genus 44
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2y57A00
2UZ6A 4UM3A 3WTOA 4AFHA 2BG9A 4ZZCA 5HCJA 3ZDHA 3GUAA 4XHEA 4ILBA 2Y54A 2Y7YA 5HEHA 3PEOA 4QH5A 2XNUA 4QACA 3RQWA 5AFMA 2BYPA 5J5GA 2WNJA 2XQ4A 2WNLA 5AFKA 4ZRUA 3TLUA 5KZUA 2XYTA 1UV6A 3WIPA 2VL0A 3JAFA 2BG9E 3PMZA 2BJ0A 2XQ8A 4ZR6A 4QH1A 4HFEA 5FJVA 5JMEA 4ILCA 4HFCA 3U8NA 4Z91A 2YN6A 5KE4A 3LSVA 5IUXA 3EI0A 4AFTA 2XQ7A 4TWFA 4XK9A 3UQ4A 3WTLA 4ALXA 4ZK4A 2XNVA 2C9TA 4TNVA 3T4MA 4HFBA 4A97A 4BQTA 3SH1A 4X5TA 3TLWA 2YMDA 4WV9A 2YKSA 4HFHA 3WTKA 5BRXA 3UUBA 3EAMA 4IREA 2WNCA 3SIOA 2BG9C 2XZ6A 4FRRA 2XQ6A 4UXUA 2XQAA 4IL4A 2XQ9A 4AFGA 3UQ7A 4Z90A 2XYSA 4QABA 4DBMA 5LXBA 4B5DA 3RIFA 2PGZA 2BR8A 4TWHA 2W8GA 5SYOA 3WTJA 2BYRA 3WTIA 4ZJSA 5AFNA 3JADA 4LMLA 3UU5A 5BW2A 5TVCA 4QH4A 5HCMA 5HEUA 3RI5A 4ILAA 4ZZBA 3WTHA 2BYQA 2Y58A 5AFLA 3SQ6A 5J5HA 2ZJVA 3SQ9A 4UM3P 5L4HA 5BP0A 4LMKA 4EZ1A 5LG3A 1I9BA 5HEGA 4D01A 3C84A 2XQ3A 4TWDA 5HEOA 3UU8A 1UW6A 2BG9B 3U8JA 2Y57A 4HQPA 2BYNA 4COFA 5CO5A 2QC1B 2PH9A 3ZKRA 5L4EA 4LMJA 4TNWA 3IGQA 4NZBA 5AINA 4HFDA 1UX2A 3P50A 4UM1A 2ZJUA 5J0ZA 3U8LA 3WTMA 5AFMB 3TLVA 3WTNA 5J5IA 4BFQA 2XZ5A 4ZK1A 5HEJA 2XQ5A 3RHWA 3RQUA 4PIRA 3TLSA 3U8MA 4A98A 2Y56A 3UU4A 3C79A 2W8FA 5J5FA 3UU3A 2WZYA 4UM3S 2YOEA 5AFJA 2XNTA 3TLTA 2WN9A 4QAAA 3ZDGA 3UU6A 3P4WA 2X00D 5CFBA 5L47A 4F8HA 4UY2A 4HFIA 4IL9A 4NPPA 3RIAA 2BYSA 2YMEA 3U8KA 4ZJTA 3EHZA 3JAEA 5AFHA 2X00A 2BR7A
chains in the Genus database with same CATH superfamily
2UZ6A 4UM3A 3WTOA 4AFHA 2BG9A 4ZZCA 5HCJA 3ZDHA 3GUAA 4XHEA 4ILBA 2Y54A 2Y7YA 5HEHA 3PEOA 4QH5A 2XNUA 4QACA 3RQWA 5AFMA 2BYPA 5J5GA 2WNJA 2XQ4A 2WNLA 5AFKA 4ZRUA 3TLUA 5KZUA 2XYTA 1UV6A 3WIPA 2VL0A 3JAFA 2BG9E 3PMZA 2BJ0A 2XQ8A 4ZR6A 4QH1A 4HFEA 5FJVA 5JMEA 4ILCA 4HFCA 3U8NA 4Z91A 2YN6A 5KE4A 3LSVA 5IUXA 3EI0A 4AFTA 2XQ7A 4TWFA 4XK9A 3UQ4A 3WTLA 4ALXA 4ZK4A 2XNVA 2C9TA 4TNVA 3T4MA 4HFBA 4A97A 4BQTA 3SH1A 4X5TA 3TLWA 2YMDA 4WV9A 2YKSA 4HFHA 3WTKA 5BRXA 3UUBA 3EAMA 4IREA 2WNCA 3SIOA 2BG9C 2XZ6A 4FRRA 2XQ6A 4UXUA 2XQAA 4IL4A 2XQ9A 4AFGA 3UQ7A 4Z90A 2XYSA 4QABA 4DBMA 5LXBA 4B5DA 3RIFA 2PGZA 2BR8A 4TWHA 2W8GA 5SYOA 3WTJA 2BYRA 3WTIA 4ZJSA 5AFNA 3JADA 4LMLA 3UU5A 5BW2A 5TVCA 4QH4A 5HCMA 5HEUA 3RI5A 4ILAA 4ZZBA 3WTHA 2BYQA 2Y58A 5AFLA 3SQ6A 5J5HA 2ZJVA 3SQ9A 4UM3P 5L4HA 5BP0A 4LMKA 4EZ1A 5LG3A 1I9BA 5HEGA 4D01A 3C84A 2XQ3A 4TWDA 5HEOA 3UU8A 1UW6A 2BG9B 3U8JA 2Y57A 4HQPA 2BYNA 4COFA 5CO5A 2QC1B 2PH9A 3ZKRA 5L4EA 4LMJA 4TNWA 3IGQA 4NZBA 5AINA 4HFDA 1UX2A 3P50A 4UM1A 2ZJUA 5J0ZA 3U8LA 3WTMA 5AFMB 3TLVA 3WTNA 5J5IA 4BFQA 2XZ5A 4ZK1A 5HEJA 2XQ5A 3RHWA 3RQUA 4PIRA 3TLSA 3U8MA 4A98A 2Y56A 3UU4A 3C79A 2W8FA 5J5FA 3UU3A 2WZYA 4UM3S 2YOEA 5AFJA 2XNTA 3TLTA 2WN9A 4QAAA 3ZDGA 3UU6A 3P4WA 2X00D 5CFBA 5L47A 4F8HA 4UY2A 4HFIA 4IL9A 4NPPA 3RIAA 2BYSA 2YMEA 3U8KA 4ZJTA 3EHZA 3JAEA 5AFHA 2X00A 2BR7A
chains in the Genus database with same CATH topology
2UZ6A 4UM3A 3WTOA 4AFHA 2BG9A 4ZZCA 5HCJA 3ZDHA 3GUAA 4XHEA 4ILBA 2Y54A 2Y7YA 5HEHA 3PEOA 4QH5A 2XNUA 4QACA 3RQWA 5AFMA 2BYPA 5J5GA 2WNJA 2XQ4A 2WNLA 5AFKA 4ZRUA 3TLUA 5KZUA 2XYTA 1UV6A 3WIPA 2VL0A 3JAFA 2BG9E 3PMZA 2BJ0A 2XQ8A 4ZR6A 4QH1A 4HFEA 5FJVA 5JMEA 4ILCA 4HFCA 3U8NA 4Z91A 2YN6A 5KE4A 3LSVA 5IUXA 3EI0A 4AFTA 2XQ7A 4TWFA 4XK9A 3UQ4A 3WTLA 4ALXA 4ZK4A 2XNVA 2C9TA 4TNVA 3T4MA 4HFBA 4A97A 4BQTA 3SH1A 4X5TA 3TLWA 2YMDA 4WV9A 2YKSA 4HFHA 3WTKA 5BRXA 3UUBA 3EAMA 4IREA 2WNCA 3SIOA 2BG9C 2XZ6A 4FRRA 2XQ6A 4UXUA 2XQAA 4IL4A 2XQ9A 4AFGA 3UQ7A 4Z90A 2XYSA 4QABA 4DBMA 5LXBA 4B5DA 3RIFA 2PGZA 2BR8A 4TWHA 2W8GA 5SYOA 3WTJA 2BYRA 3WTIA 4ZJSA 5AFNA 3JADA 4LMLA 3UU5A 5BW2A 5TVCA 4QH4A 5HCMA 5HEUA 3RI5A 4ILAA 4ZZBA 3WTHA 2BYQA 2Y58A 5AFLA 3SQ6A 5J5HA 2ZJVA 3SQ9A 4UM3P 5L4HA 5BP0A 4LMKA 4EZ1A 5LG3A 1I9BA 5HEGA 4D01A 3C84A 2XQ3A 4TWDA 5HEOA 3UU8A 1UW6A 2BG9B 3U8JA 2Y57A 4HQPA 2BYNA 4COFA 5CO5A 2QC1B 2PH9A 3ZKRA 5L4EA 4LMJA 4TNWA 3IGQA 4NZBA 5AINA 4HFDA 1UX2A 3P50A 4UM1A 2ZJUA 5J0ZA 3U8LA 3WTMA 5AFMB 3TLVA 3WTNA 5J5IA 4BFQA 2XZ5A 4ZK1A 5HEJA 2XQ5A 3RHWA 3RQUA 4PIRA 3TLSA 3U8MA 4A98A 2Y56A 3UU4A 3C79A 2W8FA 5J5FA 3UU3A 2WZYA 4UM3S 2YOEA 5AFJA 2XNTA 3TLTA 2WN9A 4QAAA 3ZDGA 3UU6A 3P4WA 2X00D 5CFBA 5L47A 4F8HA 4UY2A 4HFIA 4IL9A 4NPPA 3RIAA 2BYSA 2YMEA 3U8KA 4ZJTA 3EHZA 3JAEA 5AFHA 2X00A 2BR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZ6 A;  4UM3 A;  3WTO A;  4AFH A;  2BG9 A;  4ZZC A;  5HCJ A;  3ZDH A;  3GUA A;  4XHE A;  4ILB A;  2Y54 A;  2Y7Y A;  5HEH A;  3PEO A;  4QH5 A;  2XNU A;  4QAC A;  3RQW A;  5AFM A;  2BYP A;  5J5G A;  2WNJ A;  2XQ4 A;  2WNL A;  5AFK A;  4ZRU A;  3TLU A;  5KZU A;  2XYT A;  1UV6 A;  3WIP A;  2VL0 A;  3JAF A;  2BG9 E;  3PMZ A;  2BJ0 A;  2XQ8 A;  4ZR6 A;  4QH1 A;  4HFE A;  5FJV A;  5JME A;  4ILC A;  4HFC A;  3U8N A;  4Z91 A;  2YN6 A;  5KE4 A;  3LSV A;  5IUX A;  3EI0 A;  4AFT A;  2XQ7 A;  4TWF A;  4XK9 A;  3UQ4 A;  3WTL A;  4ALX A;  4ZK4 A;  2XNV A;  2C9T A;  4TNV A;  3T4M A;  4HFB A;  4A97 A;  4BQT A;  3SH1 A;  4X5T A;  3TLW A;  2YMD A;  4WV9 A;  2YKS A;  4HFH A;  3WTK A;  5BRX A;  3UUB A;  3EAM A;  4IRE A;  2WNC A;  3SIO A;  2BG9 C;  2XZ6 A;  4FRR A;  2XQ6 A;  4UXU A;  2XQA A;  4IL4 A;  2XQ9 A;  4AFG A;  3UQ7 A;  4Z90 A;  2XYS A;  4QAB A;  4DBM A;  5LXB A;  4B5D A;  3RIF A;  2PGZ A;  2BR8 A;  4TWH A;  2W8G A;  5SYO A;  3WTJ A;  2BYR A;  3WTI A;  4ZJS A;  5AFN A;  3JAD A;  4LML A;  3UU5 A;  5BW2 A;  5TVC A;  4QH4 A;  5HCM A;  5HEU A;  3RI5 A;  4ILA A;  4ZZB A;  3WTH A;  2BYQ A;  2Y58 A;  5AFL A;  3SQ6 A;  5J5H A;  2ZJV A;  3SQ9 A;  4UM3 P;  5L4H A;  5BP0 A;  4LMK A;  4EZ1 A;  5LG3 A;  1I9B A;  5HEG A;  4D01 A;  3C84 A;  2XQ3 A;  4TWD A;  5HEO A;  3UU8 A;  1UW6 A;  2BG9 B;  3U8J A;  2Y57 A;  4HQP A;  2BYN A;  4COF A;  5CO5 A;  2QC1 B;  2PH9 A;  3ZKR A;  5L4E A;  4LMJ A;  4TNW A;  3IGQ A;  4NZB A;  5AIN A;  4HFD A;  1UX2 A;  3P50 A;  4UM1 A;  2ZJU A;  5J0Z A;  3U8L A;  3WTM A;  5AFM B;  3TLV A;  3WTN A;  5J5I A;  4BFQ A;  2XZ5 A;  4ZK1 A;  5HEJ A;  2XQ5 A;  3RHW A;  3RQU A;  4PIR A;  3TLS A;  3U8M A;  4A98 A;  2Y56 A;  3UU4 A;  3C79 A;  2W8F A;  5J5F A;  3UU3 A;  2WZY A;  4UM3 S;  2YOE A;  5AFJ A;  2XNT A;  3TLT A;  2WN9 A;  4QAA A;  3ZDG A;  3UU6 A;  3P4W A;  2X00 D;  5CFB A;  5L47 A;  4F8H A;  4UY2 A;  4HFI A;  4IL9 A;  4NPP A;  3RIA A;  2BYS A;  2YME A;  3U8K A;  4ZJT A;  3EHZ A;  3JAE A;  5AFH A;  2X00 A;  2BR7 A; 
#chains in the Genus database with same CATH topology
 2UZ6 A;  4UM3 A;  3WTO A;  4AFH A;  2BG9 A;  4ZZC A;  5HCJ A;  3ZDH A;  3GUA A;  4XHE A;  4ILB A;  2Y54 A;  2Y7Y A;  5HEH A;  3PEO A;  4QH5 A;  2XNU A;  4QAC A;  3RQW A;  5AFM A;  2BYP A;  5J5G A;  2WNJ A;  2XQ4 A;  2WNL A;  5AFK A;  4ZRU A;  3TLU A;  5KZU A;  2XYT A;  1UV6 A;  3WIP A;  2VL0 A;  3JAF A;  2BG9 E;  3PMZ A;  2BJ0 A;  2XQ8 A;  4ZR6 A;  4QH1 A;  4HFE A;  5FJV A;  5JME A;  4ILC A;  4HFC A;  3U8N A;  4Z91 A;  2YN6 A;  5KE4 A;  3LSV A;  5IUX A;  3EI0 A;  4AFT A;  2XQ7 A;  4TWF A;  4XK9 A;  3UQ4 A;  3WTL A;  4ALX A;  4ZK4 A;  2XNV A;  2C9T A;  4TNV A;  3T4M A;  4HFB A;  4A97 A;  4BQT A;  3SH1 A;  4X5T A;  3TLW A;  2YMD A;  4WV9 A;  2YKS A;  4HFH A;  3WTK A;  5BRX A;  3UUB A;  3EAM A;  4IRE A;  2WNC A;  3SIO A;  2BG9 C;  2XZ6 A;  4FRR A;  2XQ6 A;  4UXU A;  2XQA A;  4IL4 A;  2XQ9 A;  4AFG A;  3UQ7 A;  4Z90 A;  2XYS A;  4QAB A;  4DBM A;  5LXB A;  4B5D A;  3RIF A;  2PGZ A;  2BR8 A;  4TWH A;  2W8G A;  5SYO A;  3WTJ A;  2BYR A;  3WTI A;  4ZJS A;  5AFN A;  3JAD A;  4LML A;  3UU5 A;  5BW2 A;  5TVC A;  4QH4 A;  5HCM A;  5HEU A;  3RI5 A;  4ILA A;  4ZZB A;  3WTH A;  2BYQ A;  2Y58 A;  5AFL A;  3SQ6 A;  5J5H A;  2ZJV A;  3SQ9 A;  4UM3 P;  5L4H A;  5BP0 A;  4LMK A;  4EZ1 A;  5LG3 A;  1I9B A;  5HEG A;  4D01 A;  3C84 A;  2XQ3 A;  4TWD A;  5HEO A;  3UU8 A;  1UW6 A;  2BG9 B;  3U8J A;  2Y57 A;  4HQP A;  2BYN A;  4COF A;  5CO5 A;  2QC1 B;  2PH9 A;  3ZKR A;  5L4E A;  4LMJ A;  4TNW A;  3IGQ A;  4NZB A;  5AIN A;  4HFD A;  1UX2 A;  3P50 A;  4UM1 A;  2ZJU A;  5J0Z A;  3U8L A;  3WTM A;  5AFM B;  3TLV A;  3WTN A;  5J5I A;  4BFQ A;  2XZ5 A;  4ZK1 A;  5HEJ A;  2XQ5 A;  3RHW A;  3RQU A;  4PIR A;  3TLS A;  3U8M A;  4A98 A;  2Y56 A;  3UU4 A;  3C79 A;  2W8F A;  5J5F A;  3UU3 A;  2WZY A;  4UM3 S;  2YOE A;  5AFJ A;  2XNT A;  3TLT A;  2WN9 A;  4QAA A;  3ZDG A;  3UU6 A;  3P4W A;  2X00 D;  5CFB A;  5L47 A;  4F8H A;  4UY2 A;  4HFI A;  4IL9 A;  4NPP A;  3RIA A;  2BYS A;  2YME A;  3U8K A;  4ZJT A;  3EHZ A;  3JAE A;  5AFH A;  2X00 A;  2BR7 A; 
#chains in the Genus database with same CATH homology
 2UZ6 A;  4UM3 A;  3WTO A;  4AFH A;  2BG9 A;  4ZZC A;  5HCJ A;  3ZDH A;  3GUA A;  4XHE A;  4ILB A;  2Y54 A;  2Y7Y A;  5HEH A;  3PEO A;  4QH5 A;  2XNU A;  4QAC A;  3RQW A;  5AFM A;  2BYP A;  5J5G A;  2WNJ A;  2XQ4 A;  2WNL A;  5AFK A;  4ZRU A;  3TLU A;  5KZU A;  2XYT A;  1UV6 A;  3WIP A;  2VL0 A;  3JAF A;  2BG9 E;  3PMZ A;  2BJ0 A;  2XQ8 A;  4ZR6 A;  4QH1 A;  4HFE A;  5FJV A;  5JME A;  4ILC A;  4HFC A;  3U8N A;  4Z91 A;  2YN6 A;  5KE4 A;  3LSV A;  5IUX A;  3EI0 A;  4AFT A;  2XQ7 A;  4TWF A;  4XK9 A;  3UQ4 A;  3WTL A;  4ALX A;  4ZK4 A;  2XNV A;  2C9T A;  4TNV A;  3T4M A;  4HFB A;  4A97 A;  4BQT A;  3SH1 A;  4X5T A;  3TLW A;  2YMD A;  4WV9 A;  2YKS A;  4HFH A;  3WTK A;  5BRX A;  3UUB A;  3EAM A;  4IRE A;  2WNC A;  3SIO A;  2BG9 C;  2XZ6 A;  4FRR A;  2XQ6 A;  4UXU A;  2XQA A;  4IL4 A;  2XQ9 A;  4AFG A;  3UQ7 A;  4Z90 A;  2XYS A;  4QAB A;  4DBM A;  5LXB A;  4B5D A;  3RIF A;  2PGZ A;  2BR8 A;  4TWH A;  2W8G A;  5SYO A;  3WTJ A;  2BYR A;  3WTI A;  4ZJS A;  5AFN A;  3JAD A;  4LML A;  3UU5 A;  5BW2 A;  5TVC A;  4QH4 A;  5HCM A;  5HEU A;  3RI5 A;  4ILA A;  4ZZB A;  3WTH A;  2BYQ A;  2Y58 A;  5AFL A;  3SQ6 A;  5J5H A;  2ZJV A;  3SQ9 A;  4UM3 P;  5L4H A;  5BP0 A;  4LMK A;  4EZ1 A;  5LG3 A;  1I9B A;  5HEG A;  4D01 A;  3C84 A;  2XQ3 A;  4TWD A;  5HEO A;  3UU8 A;  1UW6 A;  2BG9 B;  3U8J A;  2Y57 A;  4HQP A;  2BYN A;  4COF A;  5CO5 A;  2QC1 B;  2PH9 A;  3ZKR A;  5L4E A;  4LMJ A;  4TNW A;  3IGQ A;  4NZB A;  5AIN A;  4HFD A;  1UX2 A;  3P50 A;  4UM1 A;  2ZJU A;  5J0Z A;  3U8L A;  3WTM A;  5AFM B;  3TLV A;  3WTN A;  5J5I A;  4BFQ A;  2XZ5 A;  4ZK1 A;  5HEJ A;  2XQ5 A;  3RHW A;  3RQU A;  4PIR A;  3TLS A;  3U8M A;  4A98 A;  2Y56 A;  3UU4 A;  3C79 A;  2W8F A;  5J5F A;  3UU3 A;  2WZY A;  4UM3 S;  2YOE A;  5AFJ A;  2XNT A;  3TLT A;  2WN9 A;  4QAA A;  3ZDG A;  3UU6 A;  3P4W A;  2X00 D;  5CFB A;  5L47 A;  4F8H A;  4UY2 A;  4HFI A;  4IL9 A;  4NPP A;  3RIA A;  2BYS A;  2YME A;  3U8K A;  4ZJT A;  3EHZ A;  3JAE A;  5AFH A;  2X00 A;  2BR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...