2WZYA

Crystal structure of a-achbp in complex with 13-desmethyl spirolide c
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
211
Chain Sequence
DDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural Determinants in Phycotoxins and Achbp Conferring High Affinity Binding and Nicotinic Achr Antagonism.
pubmed doi rcsb
source organism Aplysia californica
total genus 45
structure length 211
sequence length 212
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2wzyA00
2WNJA 5LG3A 3UQ7A 2PGZA 2PH9A 4UM1A 3T4MA 4QACA 3SQ9A 5AFLA 2XNVA 3WTOA 2BYQA 2WNLA 4HFCA 4TWHA 4ZK4A 2X00A 2YOEA 5AFKA 3JADA 4LMKA 1UX2A 4LMJA 3WTHA 5HCMA 3TLUA 1I9BA 2XZ6A 2BJ0A 2XYSA 3UU3A 1UW6A 4HFHA 5HEUA 2BR7A 2XQ6A 4F8HA 3UU8A 5J5IA 3PEOA 4TWFA 4IREA 2XYTA 3TLSA 5L4HA 4AFHA 5BP0A 3GUAA 4TNWA 3WTMA 4D01A 3RIFA 4X5TA 4UM3P 4XHEA 3UU6A 3SQ6A 2BYSA 3WIPA 2WNCA 4COFA 5L4EA 4WV9A 2XZ5A 3UQ4A 2Y56A 3UU5A 5J0ZA 5HCJA 3U8LA 3WTIA 3WTJA 5HEJA 2BYNA 3WTKA 4QH1A 3UU4A 4PIRA 2Y57A 4XK9A 3JAEA 2YMEA 4EZ1A 5KE4A 4HFIA 2WN9A 2WZYA 2BG9A 2XQ4A 3RHWA 3RQUA 4QH4A 4AFGA 3EHZA 4Z90A 4AFTA 5KZUA 3LSVA 2VL0A 4ILCA 3SH1A 4UM3S 5L47A 3JAFA 4UY2A 4ZZCA 2Y54A 3ZDGA 5BW2A 4UM3A 2XNUA 4ZJSA 4DBMA 4ILBA 4HFDA 5J5HA 3C79A 2BG9E 2BR8A 3ZKRA 3TLWA 5AFNA 2XQ5A 4Z91A 2QC1B 2XNTA 4ALXA 2Y7YA 4HFBA 2Y58A 5FJVA 2BG9B 5CFBA 3U8KA 2XQ7A 4FRRA 4LMLA 5AINA 4ZRUA 2C9TA 3C84A 3EI0A 5JMEA 3P50A 2YMDA 4IL4A 4ZK1A 2BG9C 2ZJUA 5HEGA 4ZR6A 4NPPA 3RQWA 4A98A 3EAMA 4ZZBA 5AFMA 3U8JA 5LXBA 2YN6A 4TWDA 1UV6A 4BQTA 4IL9A 2ZJVA 2XQ3A 4UXUA 4BFQA 3UUBA 5HEHA 3U8MA 4QH5A 4NZBA 3SIOA 5J5FA 5AFJA 2W8FA 4A97A 4ILAA 4HFEA 5BRXA 3IGQA 5TVCA 4QABA 2W8GA 2BYPA 4TNVA 4QAAA 5J5GA 3TLVA 3WTLA 2XQ9A 3RI5A 3P4WA 5HEOA 3ZDHA 5SYOA 4HQPA 2YKSA 2XQAA 3WTNA 3RIAA 4ZJTA 5IUXA 5AFHA 4B5DA 3U8NA 5AFMB 2BYRA 3PMZA 2XQ8A 2UZ6A 2X00D 5CO5A 3TLTA
chains in the Genus database with same CATH superfamily
2WNJA 5LG3A 3UQ7A 2PGZA 2PH9A 4UM1A 3T4MA 4QACA 3SQ9A 5AFLA 2XNVA 3WTOA 2BYQA 2WNLA 4HFCA 4TWHA 4ZK4A 2X00A 2YOEA 5AFKA 3JADA 4LMKA 1UX2A 4LMJA 3WTHA 5HCMA 3TLUA 1I9BA 2XZ6A 2BJ0A 2XYSA 3UU3A 1UW6A 4HFHA 5HEUA 2BR7A 2XQ6A 4F8HA 3UU8A 5J5IA 3PEOA 4TWFA 4IREA 2XYTA 3TLSA 5L4HA 4AFHA 5BP0A 3GUAA 4TNWA 3WTMA 4D01A 3RIFA 4X5TA 4UM3P 4XHEA 3UU6A 3SQ6A 2BYSA 3WIPA 2WNCA 4COFA 5L4EA 4WV9A 2XZ5A 3UQ4A 2Y56A 3UU5A 5J0ZA 5HCJA 3U8LA 3WTIA 3WTJA 5HEJA 2BYNA 3WTKA 4QH1A 3UU4A 4PIRA 2Y57A 4XK9A 3JAEA 2YMEA 4EZ1A 5KE4A 4HFIA 2WN9A 2WZYA 2BG9A 2XQ4A 3RHWA 3RQUA 4QH4A 4AFGA 3EHZA 4Z90A 4AFTA 5KZUA 3LSVA 2VL0A 4ILCA 3SH1A 4UM3S 5L47A 3JAFA 4UY2A 4ZZCA 2Y54A 3ZDGA 5BW2A 4UM3A 2XNUA 4ZJSA 4DBMA 4ILBA 4HFDA 5J5HA 3C79A 2BG9E 2BR8A 3ZKRA 3TLWA 5AFNA 2XQ5A 4Z91A 2QC1B 2XNTA 4ALXA 2Y7YA 4HFBA 2Y58A 5FJVA 2BG9B 5CFBA 3U8KA 2XQ7A 4FRRA 4LMLA 5AINA 4ZRUA 2C9TA 3C84A 3EI0A 5JMEA 3P50A 2YMDA 4IL4A 4ZK1A 2BG9C 2ZJUA 5HEGA 4ZR6A 4NPPA 3RQWA 4A98A 3EAMA 4ZZBA 5AFMA 3U8JA 5LXBA 2YN6A 4TWDA 1UV6A 4BQTA 4IL9A 2ZJVA 2XQ3A 4UXUA 4BFQA 3UUBA 5HEHA 3U8MA 4QH5A 4NZBA 3SIOA 5J5FA 5AFJA 2W8FA 4A97A 4ILAA 4HFEA 5BRXA 3IGQA 5TVCA 4QABA 2W8GA 2BYPA 4TNVA 4QAAA 5J5GA 3TLVA 3WTLA 2XQ9A 3RI5A 3P4WA 5HEOA 3ZDHA 5SYOA 4HQPA 2YKSA 2XQAA 3WTNA 3RIAA 4ZJTA 5IUXA 5AFHA 4B5DA 3U8NA 5AFMB 2BYRA 3PMZA 2XQ8A 2UZ6A 2X00D 5CO5A 3TLTA
chains in the Genus database with same CATH topology
2WNJA 5LG3A 3UQ7A 2PGZA 2PH9A 4UM1A 3T4MA 4QACA 3SQ9A 5AFLA 2XNVA 3WTOA 2BYQA 2WNLA 4HFCA 4TWHA 4ZK4A 2X00A 2YOEA 5AFKA 3JADA 4LMKA 1UX2A 4LMJA 3WTHA 5HCMA 3TLUA 1I9BA 2XZ6A 2BJ0A 2XYSA 3UU3A 1UW6A 4HFHA 5HEUA 2BR7A 2XQ6A 4F8HA 3UU8A 5J5IA 3PEOA 4TWFA 4IREA 2XYTA 3TLSA 5L4HA 4AFHA 5BP0A 3GUAA 4TNWA 3WTMA 4D01A 3RIFA 4X5TA 4UM3P 4XHEA 3UU6A 3SQ6A 2BYSA 3WIPA 2WNCA 4COFA 5L4EA 4WV9A 2XZ5A 3UQ4A 2Y56A 3UU5A 5J0ZA 5HCJA 3U8LA 3WTIA 3WTJA 5HEJA 2BYNA 3WTKA 4QH1A 3UU4A 4PIRA 2Y57A 4XK9A 3JAEA 2YMEA 4EZ1A 5KE4A 4HFIA 2WN9A 2WZYA 2BG9A 2XQ4A 3RHWA 3RQUA 4QH4A 4AFGA 3EHZA 4Z90A 4AFTA 5KZUA 3LSVA 2VL0A 4ILCA 3SH1A 4UM3S 5L47A 3JAFA 4UY2A 4ZZCA 2Y54A 3ZDGA 5BW2A 4UM3A 2XNUA 4ZJSA 4DBMA 4ILBA 4HFDA 5J5HA 3C79A 2BG9E 2BR8A 3ZKRA 3TLWA 5AFNA 2XQ5A 4Z91A 2QC1B 2XNTA 4ALXA 2Y7YA 4HFBA 2Y58A 5FJVA 2BG9B 5CFBA 3U8KA 2XQ7A 4FRRA 4LMLA 5AINA 4ZRUA 2C9TA 3C84A 3EI0A 5JMEA 3P50A 2YMDA 4IL4A 4ZK1A 2BG9C 2ZJUA 5HEGA 4ZR6A 4NPPA 3RQWA 4A98A 3EAMA 4ZZBA 5AFMA 3U8JA 5LXBA 2YN6A 4TWDA 1UV6A 4BQTA 4IL9A 2ZJVA 2XQ3A 4UXUA 4BFQA 3UUBA 5HEHA 3U8MA 4QH5A 4NZBA 3SIOA 5J5FA 5AFJA 2W8FA 4A97A 4ILAA 4HFEA 5BRXA 3IGQA 5TVCA 4QABA 2W8GA 2BYPA 4TNVA 4QAAA 5J5GA 3TLVA 3WTLA 2XQ9A 3RI5A 3P4WA 5HEOA 3ZDHA 5SYOA 4HQPA 2YKSA 2XQAA 3WTNA 3RIAA 4ZJTA 5IUXA 5AFHA 4B5DA 3U8NA 5AFMB 2BYRA 3PMZA 2XQ8A 2UZ6A 2X00D 5CO5A 3TLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNJ A;  5LG3 A;  3UQ7 A;  2PGZ A;  2PH9 A;  4UM1 A;  3T4M A;  4QAC A;  3SQ9 A;  5AFL A;  2XNV A;  3WTO A;  2BYQ A;  2WNL A;  4HFC A;  4TWH A;  4ZK4 A;  2X00 A;  2YOE A;  5AFK A;  3JAD A;  4LMK A;  1UX2 A;  4LMJ A;  3WTH A;  5HCM A;  3TLU A;  1I9B A;  2XZ6 A;  2BJ0 A;  2XYS A;  3UU3 A;  1UW6 A;  4HFH A;  5HEU A;  2BR7 A;  2XQ6 A;  4F8H A;  3UU8 A;  5J5I A;  3PEO A;  4TWF A;  4IRE A;  2XYT A;  3TLS A;  5L4H A;  4AFH A;  5BP0 A;  3GUA A;  4TNW A;  3WTM A;  4D01 A;  3RIF A;  4X5T A;  4UM3 P;  4XHE A;  3UU6 A;  3SQ6 A;  2BYS A;  3WIP A;  2WNC A;  4COF A;  5L4E A;  4WV9 A;  2XZ5 A;  3UQ4 A;  2Y56 A;  3UU5 A;  5J0Z A;  5HCJ A;  3U8L A;  3WTI A;  3WTJ A;  5HEJ A;  2BYN A;  3WTK A;  4QH1 A;  3UU4 A;  4PIR A;  2Y57 A;  4XK9 A;  3JAE A;  2YME A;  4EZ1 A;  5KE4 A;  4HFI A;  2WN9 A;  2WZY A;  2BG9 A;  2XQ4 A;  3RHW A;  3RQU A;  4QH4 A;  4AFG A;  3EHZ A;  4Z90 A;  4AFT A;  5KZU A;  3LSV A;  2VL0 A;  4ILC A;  3SH1 A;  4UM3 S;  5L47 A;  3JAF A;  4UY2 A;  4ZZC A;  2Y54 A;  3ZDG A;  5BW2 A;  4UM3 A;  2XNU A;  4ZJS A;  4DBM A;  4ILB A;  4HFD A;  5J5H A;  3C79 A;  2BG9 E;  2BR8 A;  3ZKR A;  3TLW A;  5AFN A;  2XQ5 A;  4Z91 A;  2QC1 B;  2XNT A;  4ALX A;  2Y7Y A;  4HFB A;  2Y58 A;  5FJV A;  2BG9 B;  5CFB A;  3U8K A;  2XQ7 A;  4FRR A;  4LML A;  5AIN A;  4ZRU A;  2C9T A;  3C84 A;  3EI0 A;  5JME A;  3P50 A;  2YMD A;  4IL4 A;  4ZK1 A;  2BG9 C;  2ZJU A;  5HEG A;  4ZR6 A;  4NPP A;  3RQW A;  4A98 A;  3EAM A;  4ZZB A;  5AFM A;  3U8J A;  5LXB A;  2YN6 A;  4TWD A;  1UV6 A;  4BQT A;  4IL9 A;  2ZJV A;  2XQ3 A;  4UXU A;  4BFQ A;  3UUB A;  5HEH A;  3U8M A;  4QH5 A;  4NZB A;  3SIO A;  5J5F A;  5AFJ A;  2W8F A;  4A97 A;  4ILA A;  4HFE A;  5BRX A;  3IGQ A;  5TVC A;  4QAB A;  2W8G A;  2BYP A;  4TNV A;  4QAA A;  5J5G A;  3TLV A;  3WTL A;  2XQ9 A;  3RI5 A;  3P4W A;  5HEO A;  3ZDH A;  5SYO A;  4HQP A;  2YKS A;  2XQA A;  3WTN A;  3RIA A;  4ZJT A;  5IUX A;  5AFH A;  4B5D A;  3U8N A;  5AFM B;  2BYR A;  3PMZ A;  2XQ8 A;  2UZ6 A;  2X00 D;  5CO5 A;  3TLT A; 
#chains in the Genus database with same CATH topology
 2WNJ A;  5LG3 A;  3UQ7 A;  2PGZ A;  2PH9 A;  4UM1 A;  3T4M A;  4QAC A;  3SQ9 A;  5AFL A;  2XNV A;  3WTO A;  2BYQ A;  2WNL A;  4HFC A;  4TWH A;  4ZK4 A;  2X00 A;  2YOE A;  5AFK A;  3JAD A;  4LMK A;  1UX2 A;  4LMJ A;  3WTH A;  5HCM A;  3TLU A;  1I9B A;  2XZ6 A;  2BJ0 A;  2XYS A;  3UU3 A;  1UW6 A;  4HFH A;  5HEU A;  2BR7 A;  2XQ6 A;  4F8H A;  3UU8 A;  5J5I A;  3PEO A;  4TWF A;  4IRE A;  2XYT A;  3TLS A;  5L4H A;  4AFH A;  5BP0 A;  3GUA A;  4TNW A;  3WTM A;  4D01 A;  3RIF A;  4X5T A;  4UM3 P;  4XHE A;  3UU6 A;  3SQ6 A;  2BYS A;  3WIP A;  2WNC A;  4COF A;  5L4E A;  4WV9 A;  2XZ5 A;  3UQ4 A;  2Y56 A;  3UU5 A;  5J0Z A;  5HCJ A;  3U8L A;  3WTI A;  3WTJ A;  5HEJ A;  2BYN A;  3WTK A;  4QH1 A;  3UU4 A;  4PIR A;  2Y57 A;  4XK9 A;  3JAE A;  2YME A;  4EZ1 A;  5KE4 A;  4HFI A;  2WN9 A;  2WZY A;  2BG9 A;  2XQ4 A;  3RHW A;  3RQU A;  4QH4 A;  4AFG A;  3EHZ A;  4Z90 A;  4AFT A;  5KZU A;  3LSV A;  2VL0 A;  4ILC A;  3SH1 A;  4UM3 S;  5L47 A;  3JAF A;  4UY2 A;  4ZZC A;  2Y54 A;  3ZDG A;  5BW2 A;  4UM3 A;  2XNU A;  4ZJS A;  4DBM A;  4ILB A;  4HFD A;  5J5H A;  3C79 A;  2BG9 E;  2BR8 A;  3ZKR A;  3TLW A;  5AFN A;  2XQ5 A;  4Z91 A;  2QC1 B;  2XNT A;  4ALX A;  2Y7Y A;  4HFB A;  2Y58 A;  5FJV A;  2BG9 B;  5CFB A;  3U8K A;  2XQ7 A;  4FRR A;  4LML A;  5AIN A;  4ZRU A;  2C9T A;  3C84 A;  3EI0 A;  5JME A;  3P50 A;  2YMD A;  4IL4 A;  4ZK1 A;  2BG9 C;  2ZJU A;  5HEG A;  4ZR6 A;  4NPP A;  3RQW A;  4A98 A;  3EAM A;  4ZZB A;  5AFM A;  3U8J A;  5LXB A;  2YN6 A;  4TWD A;  1UV6 A;  4BQT A;  4IL9 A;  2ZJV A;  2XQ3 A;  4UXU A;  4BFQ A;  3UUB A;  5HEH A;  3U8M A;  4QH5 A;  4NZB A;  3SIO A;  5J5F A;  5AFJ A;  2W8F A;  4A97 A;  4ILA A;  4HFE A;  5BRX A;  3IGQ A;  5TVC A;  4QAB A;  2W8G A;  2BYP A;  4TNV A;  4QAA A;  5J5G A;  3TLV A;  3WTL A;  2XQ9 A;  3RI5 A;  3P4W A;  5HEO A;  3ZDH A;  5SYO A;  4HQP A;  2YKS A;  2XQA A;  3WTN A;  3RIA A;  4ZJT A;  5IUX A;  5AFH A;  4B5D A;  3U8N A;  5AFM B;  2BYR A;  3PMZ A;  2XQ8 A;  2UZ6 A;  2X00 D;  5CO5 A;  3TLT A; 
#chains in the Genus database with same CATH homology
 2WNJ A;  5LG3 A;  3UQ7 A;  2PGZ A;  2PH9 A;  4UM1 A;  3T4M A;  4QAC A;  3SQ9 A;  5AFL A;  2XNV A;  3WTO A;  2BYQ A;  2WNL A;  4HFC A;  4TWH A;  4ZK4 A;  2X00 A;  2YOE A;  5AFK A;  3JAD A;  4LMK A;  1UX2 A;  4LMJ A;  3WTH A;  5HCM A;  3TLU A;  1I9B A;  2XZ6 A;  2BJ0 A;  2XYS A;  3UU3 A;  1UW6 A;  4HFH A;  5HEU A;  2BR7 A;  2XQ6 A;  4F8H A;  3UU8 A;  5J5I A;  3PEO A;  4TWF A;  4IRE A;  2XYT A;  3TLS A;  5L4H A;  4AFH A;  5BP0 A;  3GUA A;  4TNW A;  3WTM A;  4D01 A;  3RIF A;  4X5T A;  4UM3 P;  4XHE A;  3UU6 A;  3SQ6 A;  2BYS A;  3WIP A;  2WNC A;  4COF A;  5L4E A;  4WV9 A;  2XZ5 A;  3UQ4 A;  2Y56 A;  3UU5 A;  5J0Z A;  5HCJ A;  3U8L A;  3WTI A;  3WTJ A;  5HEJ A;  2BYN A;  3WTK A;  4QH1 A;  3UU4 A;  4PIR A;  2Y57 A;  4XK9 A;  3JAE A;  2YME A;  4EZ1 A;  5KE4 A;  4HFI A;  2WN9 A;  2WZY A;  2BG9 A;  2XQ4 A;  3RHW A;  3RQU A;  4QH4 A;  4AFG A;  3EHZ A;  4Z90 A;  4AFT A;  5KZU A;  3LSV A;  2VL0 A;  4ILC A;  3SH1 A;  4UM3 S;  5L47 A;  3JAF A;  4UY2 A;  4ZZC A;  2Y54 A;  3ZDG A;  5BW2 A;  4UM3 A;  2XNU A;  4ZJS A;  4DBM A;  4ILB A;  4HFD A;  5J5H A;  3C79 A;  2BG9 E;  2BR8 A;  3ZKR A;  3TLW A;  5AFN A;  2XQ5 A;  4Z91 A;  2QC1 B;  2XNT A;  4ALX A;  2Y7Y A;  4HFB A;  2Y58 A;  5FJV A;  2BG9 B;  5CFB A;  3U8K A;  2XQ7 A;  4FRR A;  4LML A;  5AIN A;  4ZRU A;  2C9T A;  3C84 A;  3EI0 A;  5JME A;  3P50 A;  2YMD A;  4IL4 A;  4ZK1 A;  2BG9 C;  2ZJU A;  5HEG A;  4ZR6 A;  4NPP A;  3RQW A;  4A98 A;  3EAM A;  4ZZB A;  5AFM A;  3U8J A;  5LXB A;  2YN6 A;  4TWD A;  1UV6 A;  4BQT A;  4IL9 A;  2ZJV A;  2XQ3 A;  4UXU A;  4BFQ A;  3UUB A;  5HEH A;  3U8M A;  4QH5 A;  4NZB A;  3SIO A;  5J5F A;  5AFJ A;  2W8F A;  4A97 A;  4ILA A;  4HFE A;  5BRX A;  3IGQ A;  5TVC A;  4QAB A;  2W8G A;  2BYP A;  4TNV A;  4QAA A;  5J5G A;  3TLV A;  3WTL A;  2XQ9 A;  3RI5 A;  3P4W A;  5HEO A;  3ZDH A;  5SYO A;  4HQP A;  2YKS A;  2XQA A;  3WTN A;  3RIA A;  4ZJT A;  5IUX A;  5AFH A;  4B5D A;  3U8N A;  5AFM B;  2BYR A;  3PMZ A;  2XQ8 A;  2UZ6 A;  2X00 D;  5CO5 A;  3TLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...