2WZYA

Crystal structure of a-achbp in complex with 13-desmethyl spirolide c
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
211
Chain Sequence
DDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural Determinants in Phycotoxins and Achbp Conferring High Affinity Binding and Nicotinic Achr Antagonism.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 45
structure length 211
sequence length 212
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2wzyA00
2XNUA 3EAMA 3ZKRA 5AFMA 2Y57A 3SQ9A 5L4EA 2WZYA 5FJVA 4TWFA 2XZ6A 5KE4A 2WN9A 4Z91A 4WV9A 3SQ6A 5L47A 4TWHA 3EHZA 3WTKA 3WTLA 4TWDA 4XHEA 3U8MA 4Z90A 3ZDGA 5HEGA 5CO5A 5J5GA 5HEUA 4ZK4A 5AFJA 1UX2A 4EZ1A 5CFBA 4ZR6A 2BYRA 2BG9B 4NZBA 4HFEA 2BYPA 4IL9A 4D01A 3GUAA 3U8NA 4AFGA 3PMZA 4HFBA 2PGZA 2XQAA 2YKSA 5HEOA 3WTMA 5AFMB 3WIPA 5BW2A 5AFLA 4TNVA 3RIAA 4BFQA 4PIRA 3JAEA 4ZJSA 2XYTA 3UU5A 2XNTA 3U8JA 4QACA 2XQ4A 2Y7YA 4UM3P 5J5HA 4LMKA 2BYQA 5L4HA 3C84A 4HQPA 4ALXA 3WTIA 4B5DA 3TLSA 5JMEA 4UM3S 3UUBA 3C79A 4DBMA 4ZZCA 5AFKA 4QH4A 5J0ZA 4HFIA 5KZUA 5LG3A 4A98A 2Y54A 3RIFA 3TLWA 4QAAA 2WNJA 2UZ6A 5HCMA 1UW6A 3RI5A 3UQ4A 2VL0A 2Y56A 2YMDA 3JADA 5AINA 3RQUA 4UY2A 4ZK1A 2WNLA 2YOEA 3U8LA 5BRXA 3WTJA 5J5FA 3UU4A 3TLVA 4UM1A 3EI0A 4COFA 1I9BA 2BG9E 2XQ6A 3T4MA 2XQ5A 4ZJTA 3P50A 4HFHA 3UU6A 2BG9C 4QH1A 2X00D 4ZRUA 4F8HA 4QH5A 3UU3A 4ILCA 5TVCA 3SH1A 4ZZBA 2XNVA 3LSVA 4BQTA 3P4WA 2QC1B 3WTOA 2BYSA 3SIOA 2BR7A 2W8GA 2YMEA 3RHWA 4QABA 4AFHA 4ILBA 4TNWA 2XQ7A 5HCJA 2XQ3A 5J5IA 4A97A 3UU8A 3RQWA 5LXBA 2XQ8A 2ZJVA 4ILAA 4IREA 5HEHA 1UV6A 4HFCA 3IGQA 4UXUA 3TLTA 4LMLA 5SYOA 5BP0A 3WTHA 4AFTA 3UQ7A 4FRRA 4HFDA 5HEJA 2XYSA 2BYNA 2W8FA 2XQ9A 4UM3A 3JAFA 2PH9A 2BG9A 3TLUA 5AFHA 3U8KA 3WTNA 4LMJA 4IL4A 5IUXA 2X00A 2Y58A 2C9TA 2ZJUA 2YN6A 2BJ0A 2WNCA 4X5TA 5AFNA 2BR8A 4NPPA 4XK9A 3ZDHA 2XZ5A 3PEOA
chains in the Genus database with same CATH superfamily
2XNUA 3EAMA 3ZKRA 5AFMA 2Y57A 3SQ9A 5L4EA 2WZYA 5FJVA 4TWFA 2XZ6A 5KE4A 2WN9A 4Z91A 4WV9A 3SQ6A 5L47A 4TWHA 3EHZA 3WTKA 3WTLA 4TWDA 4XHEA 3U8MA 4Z90A 3ZDGA 5HEGA 5CO5A 5J5GA 5HEUA 4ZK4A 5AFJA 1UX2A 4EZ1A 5CFBA 4ZR6A 2BYRA 2BG9B 4NZBA 4HFEA 2BYPA 4IL9A 4D01A 3GUAA 3U8NA 4AFGA 3PMZA 4HFBA 2PGZA 2XQAA 2YKSA 5HEOA 3WTMA 5AFMB 3WIPA 5BW2A 5AFLA 4TNVA 3RIAA 4BFQA 4PIRA 3JAEA 4ZJSA 2XYTA 3UU5A 2XNTA 3U8JA 4QACA 2XQ4A 2Y7YA 4UM3P 5J5HA 4LMKA 2BYQA 5L4HA 3C84A 4HQPA 4ALXA 3WTIA 4B5DA 3TLSA 5JMEA 4UM3S 3UUBA 3C79A 4DBMA 4ZZCA 5AFKA 4QH4A 5J0ZA 4HFIA 5KZUA 5LG3A 4A98A 2Y54A 3RIFA 3TLWA 4QAAA 2WNJA 2UZ6A 5HCMA 1UW6A 3RI5A 3UQ4A 2VL0A 2Y56A 2YMDA 3JADA 5AINA 3RQUA 4UY2A 4ZK1A 2WNLA 2YOEA 3U8LA 5BRXA 3WTJA 5J5FA 3UU4A 3TLVA 4UM1A 3EI0A 4COFA 1I9BA 2BG9E 2XQ6A 3T4MA 2XQ5A 4ZJTA 3P50A 4HFHA 3UU6A 2BG9C 4QH1A 2X00D 4ZRUA 4F8HA 4QH5A 3UU3A 4ILCA 5TVCA 3SH1A 4ZZBA 2XNVA 3LSVA 4BQTA 3P4WA 2QC1B 3WTOA 2BYSA 3SIOA 2BR7A 2W8GA 2YMEA 3RHWA 4QABA 4AFHA 4ILBA 4TNWA 2XQ7A 5HCJA 2XQ3A 5J5IA 4A97A 3UU8A 3RQWA 5LXBA 2XQ8A 2ZJVA 4ILAA 4IREA 5HEHA 1UV6A 4HFCA 3IGQA 4UXUA 3TLTA 4LMLA 5SYOA 5BP0A 3WTHA 4AFTA 3UQ7A 4FRRA 4HFDA 5HEJA 2XYSA 2BYNA 2W8FA 2XQ9A 4UM3A 3JAFA 2PH9A 2BG9A 3TLUA 5AFHA 3U8KA 3WTNA 4LMJA 4IL4A 5IUXA 2X00A 2Y58A 2C9TA 2ZJUA 2YN6A 2BJ0A 2WNCA 4X5TA 5AFNA 2BR8A 4NPPA 4XK9A 3ZDHA 2XZ5A 3PEOA
chains in the Genus database with same CATH topology
2XNUA 3EAMA 3ZKRA 5AFMA 2Y57A 3SQ9A 5L4EA 2WZYA 5FJVA 4TWFA 2XZ6A 5KE4A 2WN9A 4Z91A 4WV9A 3SQ6A 5L47A 4TWHA 3EHZA 3WTKA 3WTLA 4TWDA 4XHEA 3U8MA 4Z90A 3ZDGA 5HEGA 5CO5A 5J5GA 5HEUA 4ZK4A 5AFJA 1UX2A 4EZ1A 5CFBA 4ZR6A 2BYRA 2BG9B 4NZBA 4HFEA 2BYPA 4IL9A 4D01A 3GUAA 3U8NA 4AFGA 3PMZA 4HFBA 2PGZA 2XQAA 2YKSA 5HEOA 3WTMA 5AFMB 3WIPA 5BW2A 5AFLA 4TNVA 3RIAA 4BFQA 4PIRA 3JAEA 4ZJSA 2XYTA 3UU5A 2XNTA 3U8JA 4QACA 2XQ4A 2Y7YA 4UM3P 5J5HA 4LMKA 2BYQA 5L4HA 3C84A 4HQPA 4ALXA 3WTIA 4B5DA 3TLSA 5JMEA 4UM3S 3UUBA 3C79A 4DBMA 4ZZCA 5AFKA 4QH4A 5J0ZA 4HFIA 5KZUA 5LG3A 4A98A 2Y54A 3RIFA 3TLWA 4QAAA 2WNJA 2UZ6A 5HCMA 1UW6A 3RI5A 3UQ4A 2VL0A 2Y56A 2YMDA 3JADA 5AINA 3RQUA 4UY2A 4ZK1A 2WNLA 2YOEA 3U8LA 5BRXA 3WTJA 5J5FA 3UU4A 3TLVA 4UM1A 3EI0A 4COFA 1I9BA 2BG9E 2XQ6A 3T4MA 2XQ5A 4ZJTA 3P50A 4HFHA 3UU6A 2BG9C 4QH1A 2X00D 4ZRUA 4F8HA 4QH5A 3UU3A 4ILCA 5TVCA 3SH1A 4ZZBA 2XNVA 3LSVA 4BQTA 3P4WA 2QC1B 3WTOA 2BYSA 3SIOA 2BR7A 2W8GA 2YMEA 3RHWA 4QABA 4AFHA 4ILBA 4TNWA 2XQ7A 5HCJA 2XQ3A 5J5IA 4A97A 3UU8A 3RQWA 5LXBA 2XQ8A 2ZJVA 4ILAA 4IREA 5HEHA 1UV6A 4HFCA 3IGQA 4UXUA 3TLTA 4LMLA 5SYOA 5BP0A 3WTHA 4AFTA 3UQ7A 4FRRA 4HFDA 5HEJA 2XYSA 2BYNA 2W8FA 2XQ9A 4UM3A 3JAFA 2PH9A 2BG9A 3TLUA 5AFHA 3U8KA 3WTNA 4LMJA 4IL4A 5IUXA 2X00A 2Y58A 2C9TA 2ZJUA 2YN6A 2BJ0A 2WNCA 4X5TA 5AFNA 2BR8A 4NPPA 4XK9A 3ZDHA 2XZ5A 3PEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XNU A;  3EAM A;  3ZKR A;  5AFM A;  2Y57 A;  3SQ9 A;  5L4E A;  2WZY A;  5FJV A;  4TWF A;  2XZ6 A;  5KE4 A;  2WN9 A;  4Z91 A;  4WV9 A;  3SQ6 A;  5L47 A;  4TWH A;  3EHZ A;  3WTK A;  3WTL A;  4TWD A;  4XHE A;  3U8M A;  4Z90 A;  3ZDG A;  5HEG A;  5CO5 A;  5J5G A;  5HEU A;  4ZK4 A;  5AFJ A;  1UX2 A;  4EZ1 A;  5CFB A;  4ZR6 A;  2BYR A;  2BG9 B;  4NZB A;  4HFE A;  2BYP A;  4IL9 A;  4D01 A;  3GUA A;  3U8N A;  4AFG A;  3PMZ A;  4HFB A;  2PGZ A;  2XQA A;  2YKS A;  5HEO A;  3WTM A;  5AFM B;  3WIP A;  5BW2 A;  5AFL A;  4TNV A;  3RIA A;  4BFQ A;  4PIR A;  3JAE A;  4ZJS A;  2XYT A;  3UU5 A;  2XNT A;  3U8J A;  4QAC A;  2XQ4 A;  2Y7Y A;  4UM3 P;  5J5H A;  4LMK A;  2BYQ A;  5L4H A;  3C84 A;  4HQP A;  4ALX A;  3WTI A;  4B5D A;  3TLS A;  5JME A;  4UM3 S;  3UUB A;  3C79 A;  4DBM A;  4ZZC A;  5AFK A;  4QH4 A;  5J0Z A;  4HFI A;  5KZU A;  5LG3 A;  4A98 A;  2Y54 A;  3RIF A;  3TLW A;  4QAA A;  2WNJ A;  2UZ6 A;  5HCM A;  1UW6 A;  3RI5 A;  3UQ4 A;  2VL0 A;  2Y56 A;  2YMD A;  3JAD A;  5AIN A;  3RQU A;  4UY2 A;  4ZK1 A;  2WNL A;  2YOE A;  3U8L A;  5BRX A;  3WTJ A;  5J5F A;  3UU4 A;  3TLV A;  4UM1 A;  3EI0 A;  4COF A;  1I9B A;  2BG9 E;  2XQ6 A;  3T4M A;  2XQ5 A;  4ZJT A;  3P50 A;  4HFH A;  3UU6 A;  2BG9 C;  4QH1 A;  2X00 D;  4ZRU A;  4F8H A;  4QH5 A;  3UU3 A;  4ILC A;  5TVC A;  3SH1 A;  4ZZB A;  2XNV A;  3LSV A;  4BQT A;  3P4W A;  2QC1 B;  3WTO A;  2BYS A;  3SIO A;  2BR7 A;  2W8G A;  2YME A;  3RHW A;  4QAB A;  4AFH A;  4ILB A;  4TNW A;  2XQ7 A;  5HCJ A;  2XQ3 A;  5J5I A;  4A97 A;  3UU8 A;  3RQW A;  5LXB A;  2XQ8 A;  2ZJV A;  4ILA A;  4IRE A;  5HEH A;  1UV6 A;  4HFC A;  3IGQ A;  4UXU A;  3TLT A;  4LML A;  5SYO A;  5BP0 A;  3WTH A;  4AFT A;  3UQ7 A;  4FRR A;  4HFD A;  5HEJ A;  2XYS A;  2BYN A;  2W8F A;  2XQ9 A;  4UM3 A;  3JAF A;  2PH9 A;  2BG9 A;  3TLU A;  5AFH A;  3U8K A;  3WTN A;  4LMJ A;  4IL4 A;  5IUX A;  2X00 A;  2Y58 A;  2C9T A;  2ZJU A;  2YN6 A;  2BJ0 A;  2WNC A;  4X5T A;  5AFN A;  2BR8 A;  4NPP A;  4XK9 A;  3ZDH A;  2XZ5 A;  3PEO A; 
#chains in the Genus database with same CATH topology
 2XNU A;  3EAM A;  3ZKR A;  5AFM A;  2Y57 A;  3SQ9 A;  5L4E A;  2WZY A;  5FJV A;  4TWF A;  2XZ6 A;  5KE4 A;  2WN9 A;  4Z91 A;  4WV9 A;  3SQ6 A;  5L47 A;  4TWH A;  3EHZ A;  3WTK A;  3WTL A;  4TWD A;  4XHE A;  3U8M A;  4Z90 A;  3ZDG A;  5HEG A;  5CO5 A;  5J5G A;  5HEU A;  4ZK4 A;  5AFJ A;  1UX2 A;  4EZ1 A;  5CFB A;  4ZR6 A;  2BYR A;  2BG9 B;  4NZB A;  4HFE A;  2BYP A;  4IL9 A;  4D01 A;  3GUA A;  3U8N A;  4AFG A;  3PMZ A;  4HFB A;  2PGZ A;  2XQA A;  2YKS A;  5HEO A;  3WTM A;  5AFM B;  3WIP A;  5BW2 A;  5AFL A;  4TNV A;  3RIA A;  4BFQ A;  4PIR A;  3JAE A;  4ZJS A;  2XYT A;  3UU5 A;  2XNT A;  3U8J A;  4QAC A;  2XQ4 A;  2Y7Y A;  4UM3 P;  5J5H A;  4LMK A;  2BYQ A;  5L4H A;  3C84 A;  4HQP A;  4ALX A;  3WTI A;  4B5D A;  3TLS A;  5JME A;  4UM3 S;  3UUB A;  3C79 A;  4DBM A;  4ZZC A;  5AFK A;  4QH4 A;  5J0Z A;  4HFI A;  5KZU A;  5LG3 A;  4A98 A;  2Y54 A;  3RIF A;  3TLW A;  4QAA A;  2WNJ A;  2UZ6 A;  5HCM A;  1UW6 A;  3RI5 A;  3UQ4 A;  2VL0 A;  2Y56 A;  2YMD A;  3JAD A;  5AIN A;  3RQU A;  4UY2 A;  4ZK1 A;  2WNL A;  2YOE A;  3U8L A;  5BRX A;  3WTJ A;  5J5F A;  3UU4 A;  3TLV A;  4UM1 A;  3EI0 A;  4COF A;  1I9B A;  2BG9 E;  2XQ6 A;  3T4M A;  2XQ5 A;  4ZJT A;  3P50 A;  4HFH A;  3UU6 A;  2BG9 C;  4QH1 A;  2X00 D;  4ZRU A;  4F8H A;  4QH5 A;  3UU3 A;  4ILC A;  5TVC A;  3SH1 A;  4ZZB A;  2XNV A;  3LSV A;  4BQT A;  3P4W A;  2QC1 B;  3WTO A;  2BYS A;  3SIO A;  2BR7 A;  2W8G A;  2YME A;  3RHW A;  4QAB A;  4AFH A;  4ILB A;  4TNW A;  2XQ7 A;  5HCJ A;  2XQ3 A;  5J5I A;  4A97 A;  3UU8 A;  3RQW A;  5LXB A;  2XQ8 A;  2ZJV A;  4ILA A;  4IRE A;  5HEH A;  1UV6 A;  4HFC A;  3IGQ A;  4UXU A;  3TLT A;  4LML A;  5SYO A;  5BP0 A;  3WTH A;  4AFT A;  3UQ7 A;  4FRR A;  4HFD A;  5HEJ A;  2XYS A;  2BYN A;  2W8F A;  2XQ9 A;  4UM3 A;  3JAF A;  2PH9 A;  2BG9 A;  3TLU A;  5AFH A;  3U8K A;  3WTN A;  4LMJ A;  4IL4 A;  5IUX A;  2X00 A;  2Y58 A;  2C9T A;  2ZJU A;  2YN6 A;  2BJ0 A;  2WNC A;  4X5T A;  5AFN A;  2BR8 A;  4NPP A;  4XK9 A;  3ZDH A;  2XZ5 A;  3PEO A; 
#chains in the Genus database with same CATH homology
 2XNU A;  3EAM A;  3ZKR A;  5AFM A;  2Y57 A;  3SQ9 A;  5L4E A;  2WZY A;  5FJV A;  4TWF A;  2XZ6 A;  5KE4 A;  2WN9 A;  4Z91 A;  4WV9 A;  3SQ6 A;  5L47 A;  4TWH A;  3EHZ A;  3WTK A;  3WTL A;  4TWD A;  4XHE A;  3U8M A;  4Z90 A;  3ZDG A;  5HEG A;  5CO5 A;  5J5G A;  5HEU A;  4ZK4 A;  5AFJ A;  1UX2 A;  4EZ1 A;  5CFB A;  4ZR6 A;  2BYR A;  2BG9 B;  4NZB A;  4HFE A;  2BYP A;  4IL9 A;  4D01 A;  3GUA A;  3U8N A;  4AFG A;  3PMZ A;  4HFB A;  2PGZ A;  2XQA A;  2YKS A;  5HEO A;  3WTM A;  5AFM B;  3WIP A;  5BW2 A;  5AFL A;  4TNV A;  3RIA A;  4BFQ A;  4PIR A;  3JAE A;  4ZJS A;  2XYT A;  3UU5 A;  2XNT A;  3U8J A;  4QAC A;  2XQ4 A;  2Y7Y A;  4UM3 P;  5J5H A;  4LMK A;  2BYQ A;  5L4H A;  3C84 A;  4HQP A;  4ALX A;  3WTI A;  4B5D A;  3TLS A;  5JME A;  4UM3 S;  3UUB A;  3C79 A;  4DBM A;  4ZZC A;  5AFK A;  4QH4 A;  5J0Z A;  4HFI A;  5KZU A;  5LG3 A;  4A98 A;  2Y54 A;  3RIF A;  3TLW A;  4QAA A;  2WNJ A;  2UZ6 A;  5HCM A;  1UW6 A;  3RI5 A;  3UQ4 A;  2VL0 A;  2Y56 A;  2YMD A;  3JAD A;  5AIN A;  3RQU A;  4UY2 A;  4ZK1 A;  2WNL A;  2YOE A;  3U8L A;  5BRX A;  3WTJ A;  5J5F A;  3UU4 A;  3TLV A;  4UM1 A;  3EI0 A;  4COF A;  1I9B A;  2BG9 E;  2XQ6 A;  3T4M A;  2XQ5 A;  4ZJT A;  3P50 A;  4HFH A;  3UU6 A;  2BG9 C;  4QH1 A;  2X00 D;  4ZRU A;  4F8H A;  4QH5 A;  3UU3 A;  4ILC A;  5TVC A;  3SH1 A;  4ZZB A;  2XNV A;  3LSV A;  4BQT A;  3P4W A;  2QC1 B;  3WTO A;  2BYS A;  3SIO A;  2BR7 A;  2W8G A;  2YME A;  3RHW A;  4QAB A;  4AFH A;  4ILB A;  4TNW A;  2XQ7 A;  5HCJ A;  2XQ3 A;  5J5I A;  4A97 A;  3UU8 A;  3RQW A;  5LXB A;  2XQ8 A;  2ZJV A;  4ILA A;  4IRE A;  5HEH A;  1UV6 A;  4HFC A;  3IGQ A;  4UXU A;  3TLT A;  4LML A;  5SYO A;  5BP0 A;  3WTH A;  4AFT A;  3UQ7 A;  4FRR A;  4HFD A;  5HEJ A;  2XYS A;  2BYN A;  2W8F A;  2XQ9 A;  4UM3 A;  3JAF A;  2PH9 A;  2BG9 A;  3TLU A;  5AFH A;  3U8K A;  3WTN A;  4LMJ A;  4IL4 A;  5IUX A;  2X00 A;  2Y58 A;  2C9T A;  2ZJU A;  2YN6 A;  2BJ0 A;  2WNC A;  4X5T A;  5AFN A;  2BR8 A;  4NPP A;  4XK9 A;  3ZDH A;  2XZ5 A;  3PEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...