2WZYA

Crystal structure of a-achbp in complex with 13-desmethyl spirolide c
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
211
Chain Sequence
b'DDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHSCCPEPYIDVNLVVKFRERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural Determinants in Phycotoxins and Achbp Conferring High Affinity Binding and Nicotinic Achr Antagonism.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 45
structure length 211
sequence length 212
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2wzyA00
5AFJA 2W8FA 3C79A 4LMJA 5TVCA 4BFQA 4ZZBA 3LSVA 2BYQA 3UU8A 4A97A 2XQ5A 1UX2A 2Y54A 4LMLA 2XZ6A 3GUAA 2BG9C 4UM1A 2PH9A 5HEUA 4ZJSA 2YKSA 5KE4A 5AFMA 2XYSA 4IREA 2W8GA 4ILAA 4TWFA 2Y58A 5J5FA 2XNTA 2Y7YA 2WN9A 4ZJTA 4B5DA 4ZK4A 2BR7A 4XHEA 2YOEA 2YMDA 4UY2A 5L4EA 2Y57A 2YN6A 4UM3S 3UU5A 4HFHA 4DBMA 5BW2A 2UZ6A 3WIPA 2BJ0A 3P4WA 2BG9A 4HFIA 2ZJUA 2XYTA 4IL4A 3UQ4A 5IUXA 5AFNA 3U8LA 3U8NA 3RIFA 3SQ9A 4QACA 3UU4A 3IGQA 3EAMA 4IL9A 4F8HA 3UQ7A 3PMZA 2VL0A 2BYSA 2XQ7A 4TNVA 4PIRA 3JAEA 3UU6A 3RQWA 3SIOA 2X00A 4QAAA 3WTLA 5BRXA 2BR8A 4HFEA 4HQPA 3JADA 2WZYA 2XQ6A 4ZK1A 2X00D 3RIAA 3TLUA 3ZDHA 2BYRA 5CO5A 2XQ8A 4ZR6A 2Y56A 4QH4A 2WNCA 3UUBA 5HEHA 4ALXA 3WTJA 4BQTA 2BYNA 3WTHA 4ZZCA 5HEGA 3ZDGA 4AFHA 3ZKRA 3C84A 4ZRUA 4NZBA 4QABA 3TLVA 4UXUA 5FJVA 4AFTA 3RI5A 2QC1B 5LXBA 4XK9A 4A98A 1UW6A 4Z90A 4NPPA 2WNLA 5JMEA 4HFCA 4X5TA 4D01A 3RQUA 5J0ZA 5BP0A 3P50A 5CFBA 2YMEA 3T4MA 4QH1A 4TWHA 4UM3A 5AFHA 4ILBA 2XNVA 5LG3A 4HFBA 5AINA 4UM3P 5AFMB 4FRRA 5KZUA 2XQ4A 2ZJVA 3EHZA 5HCMA 4TWDA 3UU3A 3U8KA 2XNUA 4Z91A 2XQAA 2BG9E 4TNWA 3TLTA 3WTKA 3PEOA 3WTOA 5HCJA 5L4HA 4COFA 2PGZA 2XZ5A 5HEOA 5J5HA 2BYPA 2C9TA 2XQ9A 2BG9B 4AFGA 2XQ3A 1UV6A 4LMKA 5AFLA 3EI0A 5AFKA 3WTMA 4HFDA 3WTNA 5HEJA 5J5IA 5L47A 3RHWA 1I9BA 3SQ6A 2WNJA 4EZ1A 3TLSA 4QH5A 3JAFA 4ILCA 5J5GA 3WTIA 4WV9A 3U8JA 3SH1A 3U8MA 5SYOA 3TLWA
chains in the Genus database with same CATH superfamily
5AFJA 2W8FA 3C79A 4LMJA 5TVCA 4BFQA 4ZZBA 3LSVA 2BYQA 3UU8A 4A97A 2XQ5A 1UX2A 2Y54A 4LMLA 2XZ6A 3GUAA 2BG9C 4UM1A 2PH9A 5HEUA 4ZJSA 2YKSA 5KE4A 5AFMA 2XYSA 4IREA 2W8GA 4ILAA 4TWFA 2Y58A 5J5FA 2XNTA 2Y7YA 2WN9A 4ZJTA 4B5DA 4ZK4A 2BR7A 4XHEA 2YOEA 2YMDA 4UY2A 5L4EA 2Y57A 2YN6A 4UM3S 3UU5A 4HFHA 4DBMA 5BW2A 2UZ6A 3WIPA 2BJ0A 3P4WA 2BG9A 4HFIA 2ZJUA 2XYTA 4IL4A 3UQ4A 5IUXA 5AFNA 3U8LA 3U8NA 3RIFA 3SQ9A 4QACA 3UU4A 3IGQA 3EAMA 4IL9A 4F8HA 3UQ7A 3PMZA 2VL0A 2BYSA 2XQ7A 4TNVA 4PIRA 3JAEA 3UU6A 3RQWA 3SIOA 2X00A 4QAAA 3WTLA 5BRXA 2BR8A 4HFEA 4HQPA 3JADA 2WZYA 2XQ6A 4ZK1A 2X00D 3RIAA 3TLUA 3ZDHA 2BYRA 5CO5A 2XQ8A 4ZR6A 2Y56A 4QH4A 2WNCA 3UUBA 5HEHA 4ALXA 3WTJA 4BQTA 2BYNA 3WTHA 4ZZCA 5HEGA 3ZDGA 4AFHA 3ZKRA 3C84A 4ZRUA 4NZBA 4QABA 3TLVA 4UXUA 5FJVA 4AFTA 3RI5A 2QC1B 5LXBA 4XK9A 4A98A 1UW6A 4Z90A 4NPPA 2WNLA 5JMEA 4HFCA 4X5TA 4D01A 3RQUA 5J0ZA 5BP0A 3P50A 5CFBA 2YMEA 3T4MA 4QH1A 4TWHA 4UM3A 5AFHA 4ILBA 2XNVA 5LG3A 4HFBA 5AINA 4UM3P 5AFMB 4FRRA 5KZUA 2XQ4A 2ZJVA 3EHZA 5HCMA 4TWDA 3UU3A 3U8KA 2XNUA 4Z91A 2XQAA 2BG9E 4TNWA 3TLTA 3WTKA 3PEOA 3WTOA 5HCJA 5L4HA 4COFA 2PGZA 2XZ5A 5HEOA 5J5HA 2BYPA 2C9TA 2XQ9A 2BG9B 4AFGA 2XQ3A 1UV6A 4LMKA 5AFLA 3EI0A 5AFKA 3WTMA 4HFDA 3WTNA 5HEJA 5J5IA 5L47A 3RHWA 1I9BA 3SQ6A 2WNJA 4EZ1A 3TLSA 4QH5A 3JAFA 4ILCA 5J5GA 3WTIA 4WV9A 3U8JA 3SH1A 3U8MA 5SYOA 3TLWA
chains in the Genus database with same CATH topology
5AFJA 2W8FA 3C79A 4LMJA 5TVCA 4BFQA 4ZZBA 3LSVA 2BYQA 3UU8A 4A97A 2XQ5A 1UX2A 2Y54A 4LMLA 2XZ6A 3GUAA 2BG9C 4UM1A 2PH9A 5HEUA 4ZJSA 2YKSA 5KE4A 5AFMA 2XYSA 4IREA 2W8GA 4ILAA 4TWFA 2Y58A 5J5FA 2XNTA 2Y7YA 2WN9A 4ZJTA 4B5DA 4ZK4A 2BR7A 4XHEA 2YOEA 2YMDA 4UY2A 5L4EA 2Y57A 2YN6A 4UM3S 3UU5A 4HFHA 4DBMA 5BW2A 2UZ6A 3WIPA 2BJ0A 3P4WA 2BG9A 4HFIA 2ZJUA 2XYTA 4IL4A 3UQ4A 5IUXA 5AFNA 3U8LA 3U8NA 3RIFA 3SQ9A 4QACA 3UU4A 3IGQA 3EAMA 4IL9A 4F8HA 3UQ7A 3PMZA 2VL0A 2BYSA 2XQ7A 4TNVA 4PIRA 3JAEA 3UU6A 3RQWA 3SIOA 2X00A 4QAAA 3WTLA 5BRXA 2BR8A 4HFEA 4HQPA 3JADA 2WZYA 2XQ6A 4ZK1A 2X00D 3RIAA 3TLUA 3ZDHA 2BYRA 5CO5A 2XQ8A 4ZR6A 2Y56A 4QH4A 2WNCA 3UUBA 5HEHA 4ALXA 3WTJA 4BQTA 2BYNA 3WTHA 4ZZCA 5HEGA 3ZDGA 4AFHA 3ZKRA 3C84A 4ZRUA 4NZBA 4QABA 3TLVA 4UXUA 5FJVA 4AFTA 3RI5A 2QC1B 5LXBA 4XK9A 4A98A 1UW6A 4Z90A 4NPPA 2WNLA 5JMEA 4HFCA 4X5TA 4D01A 3RQUA 5J0ZA 5BP0A 3P50A 5CFBA 2YMEA 3T4MA 4QH1A 4TWHA 4UM3A 5AFHA 4ILBA 2XNVA 5LG3A 4HFBA 5AINA 4UM3P 5AFMB 4FRRA 5KZUA 2XQ4A 2ZJVA 3EHZA 5HCMA 4TWDA 3UU3A 3U8KA 2XNUA 4Z91A 2XQAA 2BG9E 4TNWA 3TLTA 3WTKA 3PEOA 3WTOA 5HCJA 5L4HA 4COFA 2PGZA 2XZ5A 5HEOA 5J5HA 2BYPA 2C9TA 2XQ9A 2BG9B 4AFGA 2XQ3A 1UV6A 4LMKA 5AFLA 3EI0A 5AFKA 3WTMA 4HFDA 3WTNA 5HEJA 5J5IA 5L47A 3RHWA 1I9BA 3SQ6A 2WNJA 4EZ1A 3TLSA 4QH5A 3JAFA 4ILCA 5J5GA 3WTIA 4WV9A 3U8JA 3SH1A 3U8MA 5SYOA 3TLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFJ A;  2W8F A;  3C79 A;  4LMJ A;  5TVC A;  4BFQ A;  4ZZB A;  3LSV A;  2BYQ A;  3UU8 A;  4A97 A;  2XQ5 A;  1UX2 A;  2Y54 A;  4LML A;  2XZ6 A;  3GUA A;  2BG9 C;  4UM1 A;  2PH9 A;  5HEU A;  4ZJS A;  2YKS A;  5KE4 A;  5AFM A;  2XYS A;  4IRE A;  2W8G A;  4ILA A;  4TWF A;  2Y58 A;  5J5F A;  2XNT A;  2Y7Y A;  2WN9 A;  4ZJT A;  4B5D A;  4ZK4 A;  2BR7 A;  4XHE A;  2YOE A;  2YMD A;  4UY2 A;  5L4E A;  2Y57 A;  2YN6 A;  4UM3 S;  3UU5 A;  4HFH A;  4DBM A;  5BW2 A;  2UZ6 A;  3WIP A;  2BJ0 A;  3P4W A;  2BG9 A;  4HFI A;  2ZJU A;  2XYT A;  4IL4 A;  3UQ4 A;  5IUX A;  5AFN A;  3U8L A;  3U8N A;  3RIF A;  3SQ9 A;  4QAC A;  3UU4 A;  3IGQ A;  3EAM A;  4IL9 A;  4F8H A;  3UQ7 A;  3PMZ A;  2VL0 A;  2BYS A;  2XQ7 A;  4TNV A;  4PIR A;  3JAE A;  3UU6 A;  3RQW A;  3SIO A;  2X00 A;  4QAA A;  3WTL A;  5BRX A;  2BR8 A;  4HFE A;  4HQP A;  3JAD A;  2WZY A;  2XQ6 A;  4ZK1 A;  2X00 D;  3RIA A;  3TLU A;  3ZDH A;  2BYR A;  5CO5 A;  2XQ8 A;  4ZR6 A;  2Y56 A;  4QH4 A;  2WNC A;  3UUB A;  5HEH A;  4ALX A;  3WTJ A;  4BQT A;  2BYN A;  3WTH A;  4ZZC A;  5HEG A;  3ZDG A;  4AFH A;  3ZKR A;  3C84 A;  4ZRU A;  4NZB A;  4QAB A;  3TLV A;  4UXU A;  5FJV A;  4AFT A;  3RI5 A;  2QC1 B;  5LXB A;  4XK9 A;  4A98 A;  1UW6 A;  4Z90 A;  4NPP A;  2WNL A;  5JME A;  4HFC A;  4X5T A;  4D01 A;  3RQU A;  5J0Z A;  5BP0 A;  3P50 A;  5CFB A;  2YME A;  3T4M A;  4QH1 A;  4TWH A;  4UM3 A;  5AFH A;  4ILB A;  2XNV A;  5LG3 A;  4HFB A;  5AIN A;  4UM3 P;  5AFM B;  4FRR A;  5KZU A;  2XQ4 A;  2ZJV A;  3EHZ A;  5HCM A;  4TWD A;  3UU3 A;  3U8K A;  2XNU A;  4Z91 A;  2XQA A;  2BG9 E;  4TNW A;  3TLT A;  3WTK A;  3PEO A;  3WTO A;  5HCJ A;  5L4H A;  4COF A;  2PGZ A;  2XZ5 A;  5HEO A;  5J5H A;  2BYP A;  2C9T A;  2XQ9 A;  2BG9 B;  4AFG A;  2XQ3 A;  1UV6 A;  4LMK A;  5AFL A;  3EI0 A;  5AFK A;  3WTM A;  4HFD A;  3WTN A;  5HEJ A;  5J5I A;  5L47 A;  3RHW A;  1I9B A;  3SQ6 A;  2WNJ A;  4EZ1 A;  3TLS A;  4QH5 A;  3JAF A;  4ILC A;  5J5G A;  3WTI A;  4WV9 A;  3U8J A;  3SH1 A;  3U8M A;  5SYO A;  3TLW A; 
#chains in the Genus database with same CATH topology
 5AFJ A;  2W8F A;  3C79 A;  4LMJ A;  5TVC A;  4BFQ A;  4ZZB A;  3LSV A;  2BYQ A;  3UU8 A;  4A97 A;  2XQ5 A;  1UX2 A;  2Y54 A;  4LML A;  2XZ6 A;  3GUA A;  2BG9 C;  4UM1 A;  2PH9 A;  5HEU A;  4ZJS A;  2YKS A;  5KE4 A;  5AFM A;  2XYS A;  4IRE A;  2W8G A;  4ILA A;  4TWF A;  2Y58 A;  5J5F A;  2XNT A;  2Y7Y A;  2WN9 A;  4ZJT A;  4B5D A;  4ZK4 A;  2BR7 A;  4XHE A;  2YOE A;  2YMD A;  4UY2 A;  5L4E A;  2Y57 A;  2YN6 A;  4UM3 S;  3UU5 A;  4HFH A;  4DBM A;  5BW2 A;  2UZ6 A;  3WIP A;  2BJ0 A;  3P4W A;  2BG9 A;  4HFI A;  2ZJU A;  2XYT A;  4IL4 A;  3UQ4 A;  5IUX A;  5AFN A;  3U8L A;  3U8N A;  3RIF A;  3SQ9 A;  4QAC A;  3UU4 A;  3IGQ A;  3EAM A;  4IL9 A;  4F8H A;  3UQ7 A;  3PMZ A;  2VL0 A;  2BYS A;  2XQ7 A;  4TNV A;  4PIR A;  3JAE A;  3UU6 A;  3RQW A;  3SIO A;  2X00 A;  4QAA A;  3WTL A;  5BRX A;  2BR8 A;  4HFE A;  4HQP A;  3JAD A;  2WZY A;  2XQ6 A;  4ZK1 A;  2X00 D;  3RIA A;  3TLU A;  3ZDH A;  2BYR A;  5CO5 A;  2XQ8 A;  4ZR6 A;  2Y56 A;  4QH4 A;  2WNC A;  3UUB A;  5HEH A;  4ALX A;  3WTJ A;  4BQT A;  2BYN A;  3WTH A;  4ZZC A;  5HEG A;  3ZDG A;  4AFH A;  3ZKR A;  3C84 A;  4ZRU A;  4NZB A;  4QAB A;  3TLV A;  4UXU A;  5FJV A;  4AFT A;  3RI5 A;  2QC1 B;  5LXB A;  4XK9 A;  4A98 A;  1UW6 A;  4Z90 A;  4NPP A;  2WNL A;  5JME A;  4HFC A;  4X5T A;  4D01 A;  3RQU A;  5J0Z A;  5BP0 A;  3P50 A;  5CFB A;  2YME A;  3T4M A;  4QH1 A;  4TWH A;  4UM3 A;  5AFH A;  4ILB A;  2XNV A;  5LG3 A;  4HFB A;  5AIN A;  4UM3 P;  5AFM B;  4FRR A;  5KZU A;  2XQ4 A;  2ZJV A;  3EHZ A;  5HCM A;  4TWD A;  3UU3 A;  3U8K A;  2XNU A;  4Z91 A;  2XQA A;  2BG9 E;  4TNW A;  3TLT A;  3WTK A;  3PEO A;  3WTO A;  5HCJ A;  5L4H A;  4COF A;  2PGZ A;  2XZ5 A;  5HEO A;  5J5H A;  2BYP A;  2C9T A;  2XQ9 A;  2BG9 B;  4AFG A;  2XQ3 A;  1UV6 A;  4LMK A;  5AFL A;  3EI0 A;  5AFK A;  3WTM A;  4HFD A;  3WTN A;  5HEJ A;  5J5I A;  5L47 A;  3RHW A;  1I9B A;  3SQ6 A;  2WNJ A;  4EZ1 A;  3TLS A;  4QH5 A;  3JAF A;  4ILC A;  5J5G A;  3WTI A;  4WV9 A;  3U8J A;  3SH1 A;  3U8M A;  5SYO A;  3TLW A; 
#chains in the Genus database with same CATH homology
 5AFJ A;  2W8F A;  3C79 A;  4LMJ A;  5TVC A;  4BFQ A;  4ZZB A;  3LSV A;  2BYQ A;  3UU8 A;  4A97 A;  2XQ5 A;  1UX2 A;  2Y54 A;  4LML A;  2XZ6 A;  3GUA A;  2BG9 C;  4UM1 A;  2PH9 A;  5HEU A;  4ZJS A;  2YKS A;  5KE4 A;  5AFM A;  2XYS A;  4IRE A;  2W8G A;  4ILA A;  4TWF A;  2Y58 A;  5J5F A;  2XNT A;  2Y7Y A;  2WN9 A;  4ZJT A;  4B5D A;  4ZK4 A;  2BR7 A;  4XHE A;  2YOE A;  2YMD A;  4UY2 A;  5L4E A;  2Y57 A;  2YN6 A;  4UM3 S;  3UU5 A;  4HFH A;  4DBM A;  5BW2 A;  2UZ6 A;  3WIP A;  2BJ0 A;  3P4W A;  2BG9 A;  4HFI A;  2ZJU A;  2XYT A;  4IL4 A;  3UQ4 A;  5IUX A;  5AFN A;  3U8L A;  3U8N A;  3RIF A;  3SQ9 A;  4QAC A;  3UU4 A;  3IGQ A;  3EAM A;  4IL9 A;  4F8H A;  3UQ7 A;  3PMZ A;  2VL0 A;  2BYS A;  2XQ7 A;  4TNV A;  4PIR A;  3JAE A;  3UU6 A;  3RQW A;  3SIO A;  2X00 A;  4QAA A;  3WTL A;  5BRX A;  2BR8 A;  4HFE A;  4HQP A;  3JAD A;  2WZY A;  2XQ6 A;  4ZK1 A;  2X00 D;  3RIA A;  3TLU A;  3ZDH A;  2BYR A;  5CO5 A;  2XQ8 A;  4ZR6 A;  2Y56 A;  4QH4 A;  2WNC A;  3UUB A;  5HEH A;  4ALX A;  3WTJ A;  4BQT A;  2BYN A;  3WTH A;  4ZZC A;  5HEG A;  3ZDG A;  4AFH A;  3ZKR A;  3C84 A;  4ZRU A;  4NZB A;  4QAB A;  3TLV A;  4UXU A;  5FJV A;  4AFT A;  3RI5 A;  2QC1 B;  5LXB A;  4XK9 A;  4A98 A;  1UW6 A;  4Z90 A;  4NPP A;  2WNL A;  5JME A;  4HFC A;  4X5T A;  4D01 A;  3RQU A;  5J0Z A;  5BP0 A;  3P50 A;  5CFB A;  2YME A;  3T4M A;  4QH1 A;  4TWH A;  4UM3 A;  5AFH A;  4ILB A;  2XNV A;  5LG3 A;  4HFB A;  5AIN A;  4UM3 P;  5AFM B;  4FRR A;  5KZU A;  2XQ4 A;  2ZJV A;  3EHZ A;  5HCM A;  4TWD A;  3UU3 A;  3U8K A;  2XNU A;  4Z91 A;  2XQA A;  2BG9 E;  4TNW A;  3TLT A;  3WTK A;  3PEO A;  3WTO A;  5HCJ A;  5L4H A;  4COF A;  2PGZ A;  2XZ5 A;  5HEO A;  5J5H A;  2BYP A;  2C9T A;  2XQ9 A;  2BG9 B;  4AFG A;  2XQ3 A;  1UV6 A;  4LMK A;  5AFL A;  3EI0 A;  5AFK A;  3WTM A;  4HFD A;  3WTN A;  5HEJ A;  5J5I A;  5L47 A;  3RHW A;  1I9B A;  3SQ6 A;  2WNJ A;  4EZ1 A;  3TLS A;  4QH5 A;  3JAF A;  4ILC A;  5J5G A;  3WTI A;  4WV9 A;  3U8J A;  3SH1 A;  3U8M A;  5SYO A;  3TLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...