2W8FA

Aplysia californica achbp bound to in silico compound 31
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
pubmed doi rcsb
total genus 48
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2w8fA00
5J5GA 3UU8A 5AFHA 3WTKA 3T4MA 2BG9A 2ZJVA 2BG9C 2WNCA 2XQ5A 3TLTA 4ZZBA 5AFLA 2XQ8A 4HFBA 5AFKA 3UU5A 2W8GA 4ZK4A 4BQTA 2Y54A 3UUBA 4HFIA 1I9BA 5HEOA 3SH1A 4UM3A 2YMDA 3U8JA 2WNLA 2XQ7A 3U8MA 3EAMA 5JMEA 3RI5A 4HFCA 3PEOA 2BR7A 2BYNA 2Y58A 4TNWA 4QH5A 4UM1A 4D01A 4ALXA 4ZK1A 3RQWA 2YMEA 4ILCA 4UY2A 2C9TA 4ZR6A 3RQUA 5J5HA 2YOEA 3RIFA 4Z90A 4TWFA 4ILBA 2BYQA 2XNTA 4HFHA 4UM3P 3PMZA 3SIOA 2XZ6A 1UW6A 4EZ1A 3GUAA 4UM3S 4F8HA 1UX2A 3C84A 4QH4A 5IUXA 3JADA 2XQ9A 5HEUA 4ZJSA 5AINA 4TWDA 4WV9A 5J0ZA 5L4EA 4A98A 5L4HA 3JAFA 5KE4A 3SQ9A 5J5FA 3WTIA 5AFNA 2XQAA 4IREA 3TLWA 5KZUA 3JAEA 5LG3A 2W8FA 3RIAA 2Y7YA 3UU4A 2XQ6A 4TNVA 2WZYA 4A97A 2PH9A 4ZZCA 5CO5A 5AFMB 4ILAA 4TWHA 2XNUA 3P50A 4Z91A 5J5IA 3C79A 2Y56A 2XQ4A 3IGQA 4COFA 5AFMA 3U8NA 3EHZA 3WTLA 3TLSA 5L47A 5HEHA 4AFHA 2UZ6A 4NPPA 4NZBA 4XK9A 4QAAA 3WIPA 3EI0A 5HCMA 3SQ6A 3ZDGA 5HCJA 2XZ5A 3ZDHA 2XQ3A 4XHEA 3RHWA 4BFQA 3P4WA 2WNJA 3WTOA 3LSVA 4QABA 2X00A 5BW2A 4HFEA 2VL0A 2BYPA 4DBMA 2XNVA 5AFJA 4QACA 2XYSA 3UQ4A 4QH1A 3WTMA 4LMJA 3UU3A 4AFGA 3WTHA 4X5TA 3WTJA 3U8KA 3WTNA 4LMLA 2Y57A 4IL4A 5BP0A 2ZJUA 4LMKA 4B5DA 2YKSA 2BR8A 2BJ0A 2WN9A 4IL9A 5HEGA 4ZJTA 2PGZA 3UU6A 3U8LA 3TLVA 3TLUA 3UQ7A 4AFTA 5LXBA 4HFDA 5HEJA 4UXUA 2BG9E 2QC1B 4FRRA 2BYSA 5CFBA 4PIRA 2YN6A 4HQPA 5TVCA 1UV6A 4ZRUA 2XYTA 2BYRA 5BRXA 2X00D 5FJVA 5SYOA 2BG9B 3ZKRA
chains in the Genus database with same CATH superfamily
5J5GA 3UU8A 5AFHA 3WTKA 3T4MA 2BG9A 2ZJVA 2BG9C 2WNCA 2XQ5A 3TLTA 4ZZBA 5AFLA 2XQ8A 4HFBA 5AFKA 3UU5A 2W8GA 4ZK4A 4BQTA 2Y54A 3UUBA 4HFIA 1I9BA 5HEOA 3SH1A 4UM3A 2YMDA 3U8JA 2WNLA 2XQ7A 3U8MA 3EAMA 5JMEA 3RI5A 4HFCA 3PEOA 2BR7A 2BYNA 2Y58A 4TNWA 4QH5A 4UM1A 4D01A 4ALXA 4ZK1A 3RQWA 2YMEA 4ILCA 4UY2A 2C9TA 4ZR6A 3RQUA 5J5HA 2YOEA 3RIFA 4Z90A 4TWFA 4ILBA 2BYQA 2XNTA 4HFHA 4UM3P 3PMZA 3SIOA 2XZ6A 1UW6A 4EZ1A 3GUAA 4UM3S 4F8HA 1UX2A 3C84A 4QH4A 5IUXA 3JADA 2XQ9A 5HEUA 4ZJSA 5AINA 4TWDA 4WV9A 5J0ZA 5L4EA 4A98A 5L4HA 3JAFA 5KE4A 3SQ9A 5J5FA 3WTIA 5AFNA 2XQAA 4IREA 3TLWA 5KZUA 3JAEA 5LG3A 2W8FA 3RIAA 2Y7YA 3UU4A 2XQ6A 4TNVA 2WZYA 4A97A 2PH9A 4ZZCA 5CO5A 5AFMB 4ILAA 4TWHA 2XNUA 3P50A 4Z91A 5J5IA 3C79A 2Y56A 2XQ4A 3IGQA 4COFA 5AFMA 3U8NA 3EHZA 3WTLA 3TLSA 5L47A 5HEHA 4AFHA 2UZ6A 4NPPA 4NZBA 4XK9A 4QAAA 3WIPA 3EI0A 5HCMA 3SQ6A 3ZDGA 5HCJA 2XZ5A 3ZDHA 2XQ3A 4XHEA 3RHWA 4BFQA 3P4WA 2WNJA 3WTOA 3LSVA 4QABA 2X00A 5BW2A 4HFEA 2VL0A 2BYPA 4DBMA 2XNVA 5AFJA 4QACA 2XYSA 3UQ4A 4QH1A 3WTMA 4LMJA 3UU3A 4AFGA 3WTHA 4X5TA 3WTJA 3U8KA 3WTNA 4LMLA 2Y57A 4IL4A 5BP0A 2ZJUA 4LMKA 4B5DA 2YKSA 2BR8A 2BJ0A 2WN9A 4IL9A 5HEGA 4ZJTA 2PGZA 3UU6A 3U8LA 3TLVA 3TLUA 3UQ7A 4AFTA 5LXBA 4HFDA 5HEJA 4UXUA 2BG9E 2QC1B 4FRRA 2BYSA 5CFBA 4PIRA 2YN6A 4HQPA 5TVCA 1UV6A 4ZRUA 2XYTA 2BYRA 5BRXA 2X00D 5FJVA 5SYOA 2BG9B 3ZKRA
chains in the Genus database with same CATH topology
5J5GA 3UU8A 5AFHA 3WTKA 3T4MA 2BG9A 2ZJVA 2BG9C 2WNCA 2XQ5A 3TLTA 4ZZBA 5AFLA 2XQ8A 4HFBA 5AFKA 3UU5A 2W8GA 4ZK4A 4BQTA 2Y54A 3UUBA 4HFIA 1I9BA 5HEOA 3SH1A 4UM3A 2YMDA 3U8JA 2WNLA 2XQ7A 3U8MA 3EAMA 5JMEA 3RI5A 4HFCA 3PEOA 2BR7A 2BYNA 2Y58A 4TNWA 4QH5A 4UM1A 4D01A 4ALXA 4ZK1A 3RQWA 2YMEA 4ILCA 4UY2A 2C9TA 4ZR6A 3RQUA 5J5HA 2YOEA 3RIFA 4Z90A 4TWFA 4ILBA 2BYQA 2XNTA 4HFHA 4UM3P 3PMZA 3SIOA 2XZ6A 1UW6A 4EZ1A 3GUAA 4UM3S 4F8HA 1UX2A 3C84A 4QH4A 5IUXA 3JADA 2XQ9A 5HEUA 4ZJSA 5AINA 4TWDA 4WV9A 5J0ZA 5L4EA 4A98A 5L4HA 3JAFA 5KE4A 3SQ9A 5J5FA 3WTIA 5AFNA 2XQAA 4IREA 3TLWA 5KZUA 3JAEA 5LG3A 2W8FA 3RIAA 2Y7YA 3UU4A 2XQ6A 4TNVA 2WZYA 4A97A 2PH9A 4ZZCA 5CO5A 5AFMB 4ILAA 4TWHA 2XNUA 3P50A 4Z91A 5J5IA 3C79A 2Y56A 2XQ4A 3IGQA 4COFA 5AFMA 3U8NA 3EHZA 3WTLA 3TLSA 5L47A 5HEHA 4AFHA 2UZ6A 4NPPA 4NZBA 4XK9A 4QAAA 3WIPA 3EI0A 5HCMA 3SQ6A 3ZDGA 5HCJA 2XZ5A 3ZDHA 2XQ3A 4XHEA 3RHWA 4BFQA 3P4WA 2WNJA 3WTOA 3LSVA 4QABA 2X00A 5BW2A 4HFEA 2VL0A 2BYPA 4DBMA 2XNVA 5AFJA 4QACA 2XYSA 3UQ4A 4QH1A 3WTMA 4LMJA 3UU3A 4AFGA 3WTHA 4X5TA 3WTJA 3U8KA 3WTNA 4LMLA 2Y57A 4IL4A 5BP0A 2ZJUA 4LMKA 4B5DA 2YKSA 2BR8A 2BJ0A 2WN9A 4IL9A 5HEGA 4ZJTA 2PGZA 3UU6A 3U8LA 3TLVA 3TLUA 3UQ7A 4AFTA 5LXBA 4HFDA 5HEJA 4UXUA 2BG9E 2QC1B 4FRRA 2BYSA 5CFBA 4PIRA 2YN6A 4HQPA 5TVCA 1UV6A 4ZRUA 2XYTA 2BYRA 5BRXA 2X00D 5FJVA 5SYOA 2BG9B 3ZKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J5G A;  3UU8 A;  5AFH A;  3WTK A;  3T4M A;  2BG9 A;  2ZJV A;  2BG9 C;  2WNC A;  2XQ5 A;  3TLT A;  4ZZB A;  5AFL A;  2XQ8 A;  4HFB A;  5AFK A;  3UU5 A;  2W8G A;  4ZK4 A;  4BQT A;  2Y54 A;  3UUB A;  4HFI A;  1I9B A;  5HEO A;  3SH1 A;  4UM3 A;  2YMD A;  3U8J A;  2WNL A;  2XQ7 A;  3U8M A;  3EAM A;  5JME A;  3RI5 A;  4HFC A;  3PEO A;  2BR7 A;  2BYN A;  2Y58 A;  4TNW A;  4QH5 A;  4UM1 A;  4D01 A;  4ALX A;  4ZK1 A;  3RQW A;  2YME A;  4ILC A;  4UY2 A;  2C9T A;  4ZR6 A;  3RQU A;  5J5H A;  2YOE A;  3RIF A;  4Z90 A;  4TWF A;  4ILB A;  2BYQ A;  2XNT A;  4HFH A;  4UM3 P;  3PMZ A;  3SIO A;  2XZ6 A;  1UW6 A;  4EZ1 A;  3GUA A;  4UM3 S;  4F8H A;  1UX2 A;  3C84 A;  4QH4 A;  5IUX A;  3JAD A;  2XQ9 A;  5HEU A;  4ZJS A;  5AIN A;  4TWD A;  4WV9 A;  5J0Z A;  5L4E A;  4A98 A;  5L4H A;  3JAF A;  5KE4 A;  3SQ9 A;  5J5F A;  3WTI A;  5AFN A;  2XQA A;  4IRE A;  3TLW A;  5KZU A;  3JAE A;  5LG3 A;  2W8F A;  3RIA A;  2Y7Y A;  3UU4 A;  2XQ6 A;  4TNV A;  2WZY A;  4A97 A;  2PH9 A;  4ZZC A;  5CO5 A;  5AFM B;  4ILA A;  4TWH A;  2XNU A;  3P50 A;  4Z91 A;  5J5I A;  3C79 A;  2Y56 A;  2XQ4 A;  3IGQ A;  4COF A;  5AFM A;  3U8N A;  3EHZ A;  3WTL A;  3TLS A;  5L47 A;  5HEH A;  4AFH A;  2UZ6 A;  4NPP A;  4NZB A;  4XK9 A;  4QAA A;  3WIP A;  3EI0 A;  5HCM A;  3SQ6 A;  3ZDG A;  5HCJ A;  2XZ5 A;  3ZDH A;  2XQ3 A;  4XHE A;  3RHW A;  4BFQ A;  3P4W A;  2WNJ A;  3WTO A;  3LSV A;  4QAB A;  2X00 A;  5BW2 A;  4HFE A;  2VL0 A;  2BYP A;  4DBM A;  2XNV A;  5AFJ A;  4QAC A;  2XYS A;  3UQ4 A;  4QH1 A;  3WTM A;  4LMJ A;  3UU3 A;  4AFG A;  3WTH A;  4X5T A;  3WTJ A;  3U8K A;  3WTN A;  4LML A;  2Y57 A;  4IL4 A;  5BP0 A;  2ZJU A;  4LMK A;  4B5D A;  2YKS A;  2BR8 A;  2BJ0 A;  2WN9 A;  4IL9 A;  5HEG A;  4ZJT A;  2PGZ A;  3UU6 A;  3U8L A;  3TLV A;  3TLU A;  3UQ7 A;  4AFT A;  5LXB A;  4HFD A;  5HEJ A;  4UXU A;  2BG9 E;  2QC1 B;  4FRR A;  2BYS A;  5CFB A;  4PIR A;  2YN6 A;  4HQP A;  5TVC A;  1UV6 A;  4ZRU A;  2XYT A;  2BYR A;  5BRX A;  2X00 D;  5FJV A;  5SYO A;  2BG9 B;  3ZKR A; 
#chains in the Genus database with same CATH topology
 5J5G A;  3UU8 A;  5AFH A;  3WTK A;  3T4M A;  2BG9 A;  2ZJV A;  2BG9 C;  2WNC A;  2XQ5 A;  3TLT A;  4ZZB A;  5AFL A;  2XQ8 A;  4HFB A;  5AFK A;  3UU5 A;  2W8G A;  4ZK4 A;  4BQT A;  2Y54 A;  3UUB A;  4HFI A;  1I9B A;  5HEO A;  3SH1 A;  4UM3 A;  2YMD A;  3U8J A;  2WNL A;  2XQ7 A;  3U8M A;  3EAM A;  5JME A;  3RI5 A;  4HFC A;  3PEO A;  2BR7 A;  2BYN A;  2Y58 A;  4TNW A;  4QH5 A;  4UM1 A;  4D01 A;  4ALX A;  4ZK1 A;  3RQW A;  2YME A;  4ILC A;  4UY2 A;  2C9T A;  4ZR6 A;  3RQU A;  5J5H A;  2YOE A;  3RIF A;  4Z90 A;  4TWF A;  4ILB A;  2BYQ A;  2XNT A;  4HFH A;  4UM3 P;  3PMZ A;  3SIO A;  2XZ6 A;  1UW6 A;  4EZ1 A;  3GUA A;  4UM3 S;  4F8H A;  1UX2 A;  3C84 A;  4QH4 A;  5IUX A;  3JAD A;  2XQ9 A;  5HEU A;  4ZJS A;  5AIN A;  4TWD A;  4WV9 A;  5J0Z A;  5L4E A;  4A98 A;  5L4H A;  3JAF A;  5KE4 A;  3SQ9 A;  5J5F A;  3WTI A;  5AFN A;  2XQA A;  4IRE A;  3TLW A;  5KZU A;  3JAE A;  5LG3 A;  2W8F A;  3RIA A;  2Y7Y A;  3UU4 A;  2XQ6 A;  4TNV A;  2WZY A;  4A97 A;  2PH9 A;  4ZZC A;  5CO5 A;  5AFM B;  4ILA A;  4TWH A;  2XNU A;  3P50 A;  4Z91 A;  5J5I A;  3C79 A;  2Y56 A;  2XQ4 A;  3IGQ A;  4COF A;  5AFM A;  3U8N A;  3EHZ A;  3WTL A;  3TLS A;  5L47 A;  5HEH A;  4AFH A;  2UZ6 A;  4NPP A;  4NZB A;  4XK9 A;  4QAA A;  3WIP A;  3EI0 A;  5HCM A;  3SQ6 A;  3ZDG A;  5HCJ A;  2XZ5 A;  3ZDH A;  2XQ3 A;  4XHE A;  3RHW A;  4BFQ A;  3P4W A;  2WNJ A;  3WTO A;  3LSV A;  4QAB A;  2X00 A;  5BW2 A;  4HFE A;  2VL0 A;  2BYP A;  4DBM A;  2XNV A;  5AFJ A;  4QAC A;  2XYS A;  3UQ4 A;  4QH1 A;  3WTM A;  4LMJ A;  3UU3 A;  4AFG A;  3WTH A;  4X5T A;  3WTJ A;  3U8K A;  3WTN A;  4LML A;  2Y57 A;  4IL4 A;  5BP0 A;  2ZJU A;  4LMK A;  4B5D A;  2YKS A;  2BR8 A;  2BJ0 A;  2WN9 A;  4IL9 A;  5HEG A;  4ZJT A;  2PGZ A;  3UU6 A;  3U8L A;  3TLV A;  3TLU A;  3UQ7 A;  4AFT A;  5LXB A;  4HFD A;  5HEJ A;  4UXU A;  2BG9 E;  2QC1 B;  4FRR A;  2BYS A;  5CFB A;  4PIR A;  2YN6 A;  4HQP A;  5TVC A;  1UV6 A;  4ZRU A;  2XYT A;  2BYR A;  5BRX A;  2X00 D;  5FJV A;  5SYO A;  2BG9 B;  3ZKR A; 
#chains in the Genus database with same CATH homology
 5J5G A;  3UU8 A;  5AFH A;  3WTK A;  3T4M A;  2BG9 A;  2ZJV A;  2BG9 C;  2WNC A;  2XQ5 A;  3TLT A;  4ZZB A;  5AFL A;  2XQ8 A;  4HFB A;  5AFK A;  3UU5 A;  2W8G A;  4ZK4 A;  4BQT A;  2Y54 A;  3UUB A;  4HFI A;  1I9B A;  5HEO A;  3SH1 A;  4UM3 A;  2YMD A;  3U8J A;  2WNL A;  2XQ7 A;  3U8M A;  3EAM A;  5JME A;  3RI5 A;  4HFC A;  3PEO A;  2BR7 A;  2BYN A;  2Y58 A;  4TNW A;  4QH5 A;  4UM1 A;  4D01 A;  4ALX A;  4ZK1 A;  3RQW A;  2YME A;  4ILC A;  4UY2 A;  2C9T A;  4ZR6 A;  3RQU A;  5J5H A;  2YOE A;  3RIF A;  4Z90 A;  4TWF A;  4ILB A;  2BYQ A;  2XNT A;  4HFH A;  4UM3 P;  3PMZ A;  3SIO A;  2XZ6 A;  1UW6 A;  4EZ1 A;  3GUA A;  4UM3 S;  4F8H A;  1UX2 A;  3C84 A;  4QH4 A;  5IUX A;  3JAD A;  2XQ9 A;  5HEU A;  4ZJS A;  5AIN A;  4TWD A;  4WV9 A;  5J0Z A;  5L4E A;  4A98 A;  5L4H A;  3JAF A;  5KE4 A;  3SQ9 A;  5J5F A;  3WTI A;  5AFN A;  2XQA A;  4IRE A;  3TLW A;  5KZU A;  3JAE A;  5LG3 A;  2W8F A;  3RIA A;  2Y7Y A;  3UU4 A;  2XQ6 A;  4TNV A;  2WZY A;  4A97 A;  2PH9 A;  4ZZC A;  5CO5 A;  5AFM B;  4ILA A;  4TWH A;  2XNU A;  3P50 A;  4Z91 A;  5J5I A;  3C79 A;  2Y56 A;  2XQ4 A;  3IGQ A;  4COF A;  5AFM A;  3U8N A;  3EHZ A;  3WTL A;  3TLS A;  5L47 A;  5HEH A;  4AFH A;  2UZ6 A;  4NPP A;  4NZB A;  4XK9 A;  4QAA A;  3WIP A;  3EI0 A;  5HCM A;  3SQ6 A;  3ZDG A;  5HCJ A;  2XZ5 A;  3ZDH A;  2XQ3 A;  4XHE A;  3RHW A;  4BFQ A;  3P4W A;  2WNJ A;  3WTO A;  3LSV A;  4QAB A;  2X00 A;  5BW2 A;  4HFE A;  2VL0 A;  2BYP A;  4DBM A;  2XNV A;  5AFJ A;  4QAC A;  2XYS A;  3UQ4 A;  4QH1 A;  3WTM A;  4LMJ A;  3UU3 A;  4AFG A;  3WTH A;  4X5T A;  3WTJ A;  3U8K A;  3WTN A;  4LML A;  2Y57 A;  4IL4 A;  5BP0 A;  2ZJU A;  4LMK A;  4B5D A;  2YKS A;  2BR8 A;  2BJ0 A;  2WN9 A;  4IL9 A;  5HEG A;  4ZJT A;  2PGZ A;  3UU6 A;  3U8L A;  3TLV A;  3TLU A;  3UQ7 A;  4AFT A;  5LXB A;  4HFD A;  5HEJ A;  4UXU A;  2BG9 E;  2QC1 B;  4FRR A;  2BYS A;  5CFB A;  4PIR A;  2YN6 A;  4HQP A;  5TVC A;  1UV6 A;  4ZRU A;  2XYT A;  2BYR A;  5BRX A;  2X00 D;  5FJV A;  5SYO A;  2BG9 B;  3ZKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...