2W8FA

Aplysia californica achbp bound to in silico compound 31
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
pubmed doi rcsb
molecule tags Receptor
total genus 48
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2w8fA00
2XQ9A 3P4WA 2YMDA 3UQ4A 3WTLA 4HFBA 3WTNA 3SH1A 2X00A 4BQTA 5AFKA 4HFCA 5HEUA 5AFLA 5HEGA 3UU3A 5J5GA 5KE4A 4ALXA 4TWHA 3C79A 5L47A 3TLTA 4UY2A 5CFBA 4ZK1A 4UM1A 5J5IA 4ZZCA 2PGZA 2QC1B 3ZKRA 2UZ6A 1UW6A 2XZ5A 3SIOA 3WIPA 5AFJA 5J5HA 4X5TA 3UU4A 2WNLA 4FRRA 3EI0A 4COFA 4ZRUA 5HEJA 2Y58A 4HFEA 4QH1A 3RQUA 3UU5A 5IUXA 4TNWA 2C9TA 2XNTA 3GUAA 4QH5A 4A97A 4LMJA 3U8JA 5HCMA 2BYPA 3WTKA 2Y54A 5BRXA 5JMEA 4A98A 3C84A 2W8GA 5J5FA 4TNVA 3RHWA 4F8HA 3IGQA 2BR7A 2YOEA 4LMLA 2XYSA 4XK9A 4AFGA 2XQ8A 2XNUA 2BYQA 2WNCA 3LSVA 2BYRA 5AFHA 4NZBA 2WZYA 4IL4A 2XNVA 2Y7YA 4LMKA 5CO5A 4ZK4A 3RIAA 3RI5A 2BYNA 2XQ5A 5FJVA 5AINA 2BG9A 2ZJUA 4EZ1A 4QH4A 4ILAA 5SYOA 5L4HA 5LXBA 3PEOA 4IL9A 3WTOA 5AFMA 3UU6A 3WTHA 3RQWA 2BYSA 3TLUA 4AFTA 2BJ0A 4ZR6A 3SQ6A 5AFNA 2YMEA 4D01A 3UQ7A 4HQPA 1I9BA 2PH9A 2XQ3A 2YKSA 5HEOA 2XQ6A 1UX2A 3JADA 4XHEA 4AFHA 4ZZBA 4HFIA 2XQ7A 4UM3A 4QABA 3TLVA 3U8MA 3U8KA 4B5DA 3EAMA 1UV6A 3U8NA 3WTMA 4QACA 2BG9E 3PMZA 3RIFA 3EHZA 4NPPA 4ZJTA 5LG3A 4UM3S 4DBMA 3ZDGA 4Z91A 3ZDHA 5BW2A 5L4EA 2VL0A 4UXUA 3P50A 4BFQA 2X00D 2XQAA 3JAFA 4IREA 4WV9A 4HFHA 3UU8A 5TVCA 3UUBA 2XZ6A 2YN6A 3JAEA 4HFDA 3TLSA 2Y56A 4TWDA 2XQ4A 3WTIA 3TLWA 4QAAA 4ILCA 5HEHA 3T4MA 2Y57A 5KZUA 2XYTA 5J0ZA 2BG9B 3SQ9A 2W8FA 2BR8A 4ZJSA 2ZJVA 5BP0A 2WNJA 3WTJA 5AFMB 2BG9C 5HCJA 3U8LA 4PIRA 4TWFA 2WN9A 4UM3P 4Z90A 4ILBA
chains in the Genus database with same CATH superfamily
2XQ9A 3P4WA 2YMDA 3UQ4A 3WTLA 4HFBA 3WTNA 3SH1A 2X00A 4BQTA 5AFKA 4HFCA 5HEUA 5AFLA 5HEGA 3UU3A 5J5GA 5KE4A 4ALXA 4TWHA 3C79A 5L47A 3TLTA 4UY2A 5CFBA 4ZK1A 4UM1A 5J5IA 4ZZCA 2PGZA 2QC1B 3ZKRA 2UZ6A 1UW6A 2XZ5A 3SIOA 3WIPA 5AFJA 5J5HA 4X5TA 3UU4A 2WNLA 4FRRA 3EI0A 4COFA 4ZRUA 5HEJA 2Y58A 4HFEA 4QH1A 3RQUA 3UU5A 5IUXA 4TNWA 2C9TA 2XNTA 3GUAA 4QH5A 4A97A 4LMJA 3U8JA 5HCMA 2BYPA 3WTKA 2Y54A 5BRXA 5JMEA 4A98A 3C84A 2W8GA 5J5FA 4TNVA 3RHWA 4F8HA 3IGQA 2BR7A 2YOEA 4LMLA 2XYSA 4XK9A 4AFGA 2XQ8A 2XNUA 2BYQA 2WNCA 3LSVA 2BYRA 5AFHA 4NZBA 2WZYA 4IL4A 2XNVA 2Y7YA 4LMKA 5CO5A 4ZK4A 3RIAA 3RI5A 2BYNA 2XQ5A 5FJVA 5AINA 2BG9A 2ZJUA 4EZ1A 4QH4A 4ILAA 5SYOA 5L4HA 5LXBA 3PEOA 4IL9A 3WTOA 5AFMA 3UU6A 3WTHA 3RQWA 2BYSA 3TLUA 4AFTA 2BJ0A 4ZR6A 3SQ6A 5AFNA 2YMEA 4D01A 3UQ7A 4HQPA 1I9BA 2PH9A 2XQ3A 2YKSA 5HEOA 2XQ6A 1UX2A 3JADA 4XHEA 4AFHA 4ZZBA 4HFIA 2XQ7A 4UM3A 4QABA 3TLVA 3U8MA 3U8KA 4B5DA 3EAMA 1UV6A 3U8NA 3WTMA 4QACA 2BG9E 3PMZA 3RIFA 3EHZA 4NPPA 4ZJTA 5LG3A 4UM3S 4DBMA 3ZDGA 4Z91A 3ZDHA 5BW2A 5L4EA 2VL0A 4UXUA 3P50A 4BFQA 2X00D 2XQAA 3JAFA 4IREA 4WV9A 4HFHA 3UU8A 5TVCA 3UUBA 2XZ6A 2YN6A 3JAEA 4HFDA 3TLSA 2Y56A 4TWDA 2XQ4A 3WTIA 3TLWA 4QAAA 4ILCA 5HEHA 3T4MA 2Y57A 5KZUA 2XYTA 5J0ZA 2BG9B 3SQ9A 2W8FA 2BR8A 4ZJSA 2ZJVA 5BP0A 2WNJA 3WTJA 5AFMB 2BG9C 5HCJA 3U8LA 4PIRA 4TWFA 2WN9A 4UM3P 4Z90A 4ILBA
chains in the Genus database with same CATH topology
2XQ9A 3P4WA 2YMDA 3UQ4A 3WTLA 4HFBA 3WTNA 3SH1A 2X00A 4BQTA 5AFKA 4HFCA 5HEUA 5AFLA 5HEGA 3UU3A 5J5GA 5KE4A 4ALXA 4TWHA 3C79A 5L47A 3TLTA 4UY2A 5CFBA 4ZK1A 4UM1A 5J5IA 4ZZCA 2PGZA 2QC1B 3ZKRA 2UZ6A 1UW6A 2XZ5A 3SIOA 3WIPA 5AFJA 5J5HA 4X5TA 3UU4A 2WNLA 4FRRA 3EI0A 4COFA 4ZRUA 5HEJA 2Y58A 4HFEA 4QH1A 3RQUA 3UU5A 5IUXA 4TNWA 2C9TA 2XNTA 3GUAA 4QH5A 4A97A 4LMJA 3U8JA 5HCMA 2BYPA 3WTKA 2Y54A 5BRXA 5JMEA 4A98A 3C84A 2W8GA 5J5FA 4TNVA 3RHWA 4F8HA 3IGQA 2BR7A 2YOEA 4LMLA 2XYSA 4XK9A 4AFGA 2XQ8A 2XNUA 2BYQA 2WNCA 3LSVA 2BYRA 5AFHA 4NZBA 2WZYA 4IL4A 2XNVA 2Y7YA 4LMKA 5CO5A 4ZK4A 3RIAA 3RI5A 2BYNA 2XQ5A 5FJVA 5AINA 2BG9A 2ZJUA 4EZ1A 4QH4A 4ILAA 5SYOA 5L4HA 5LXBA 3PEOA 4IL9A 3WTOA 5AFMA 3UU6A 3WTHA 3RQWA 2BYSA 3TLUA 4AFTA 2BJ0A 4ZR6A 3SQ6A 5AFNA 2YMEA 4D01A 3UQ7A 4HQPA 1I9BA 2PH9A 2XQ3A 2YKSA 5HEOA 2XQ6A 1UX2A 3JADA 4XHEA 4AFHA 4ZZBA 4HFIA 2XQ7A 4UM3A 4QABA 3TLVA 3U8MA 3U8KA 4B5DA 3EAMA 1UV6A 3U8NA 3WTMA 4QACA 2BG9E 3PMZA 3RIFA 3EHZA 4NPPA 4ZJTA 5LG3A 4UM3S 4DBMA 3ZDGA 4Z91A 3ZDHA 5BW2A 5L4EA 2VL0A 4UXUA 3P50A 4BFQA 2X00D 2XQAA 3JAFA 4IREA 4WV9A 4HFHA 3UU8A 5TVCA 3UUBA 2XZ6A 2YN6A 3JAEA 4HFDA 3TLSA 2Y56A 4TWDA 2XQ4A 3WTIA 3TLWA 4QAAA 4ILCA 5HEHA 3T4MA 2Y57A 5KZUA 2XYTA 5J0ZA 2BG9B 3SQ9A 2W8FA 2BR8A 4ZJSA 2ZJVA 5BP0A 2WNJA 3WTJA 5AFMB 2BG9C 5HCJA 3U8LA 4PIRA 4TWFA 2WN9A 4UM3P 4Z90A 4ILBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ9 A;  3P4W A;  2YMD A;  3UQ4 A;  3WTL A;  4HFB A;  3WTN A;  3SH1 A;  2X00 A;  4BQT A;  5AFK A;  4HFC A;  5HEU A;  5AFL A;  5HEG A;  3UU3 A;  5J5G A;  5KE4 A;  4ALX A;  4TWH A;  3C79 A;  5L47 A;  3TLT A;  4UY2 A;  5CFB A;  4ZK1 A;  4UM1 A;  5J5I A;  4ZZC A;  2PGZ A;  2QC1 B;  3ZKR A;  2UZ6 A;  1UW6 A;  2XZ5 A;  3SIO A;  3WIP A;  5AFJ A;  5J5H A;  4X5T A;  3UU4 A;  2WNL A;  4FRR A;  3EI0 A;  4COF A;  4ZRU A;  5HEJ A;  2Y58 A;  4HFE A;  4QH1 A;  3RQU A;  3UU5 A;  5IUX A;  4TNW A;  2C9T A;  2XNT A;  3GUA A;  4QH5 A;  4A97 A;  4LMJ A;  3U8J A;  5HCM A;  2BYP A;  3WTK A;  2Y54 A;  5BRX A;  5JME A;  4A98 A;  3C84 A;  2W8G A;  5J5F A;  4TNV A;  3RHW A;  4F8H A;  3IGQ A;  2BR7 A;  2YOE A;  4LML A;  2XYS A;  4XK9 A;  4AFG A;  2XQ8 A;  2XNU A;  2BYQ A;  2WNC A;  3LSV A;  2BYR A;  5AFH A;  4NZB A;  2WZY A;  4IL4 A;  2XNV A;  2Y7Y A;  4LMK A;  5CO5 A;  4ZK4 A;  3RIA A;  3RI5 A;  2BYN A;  2XQ5 A;  5FJV A;  5AIN A;  2BG9 A;  2ZJU A;  4EZ1 A;  4QH4 A;  4ILA A;  5SYO A;  5L4H A;  5LXB A;  3PEO A;  4IL9 A;  3WTO A;  5AFM A;  3UU6 A;  3WTH A;  3RQW A;  2BYS A;  3TLU A;  4AFT A;  2BJ0 A;  4ZR6 A;  3SQ6 A;  5AFN A;  2YME A;  4D01 A;  3UQ7 A;  4HQP A;  1I9B A;  2PH9 A;  2XQ3 A;  2YKS A;  5HEO A;  2XQ6 A;  1UX2 A;  3JAD A;  4XHE A;  4AFH A;  4ZZB A;  4HFI A;  2XQ7 A;  4UM3 A;  4QAB A;  3TLV A;  3U8M A;  3U8K A;  4B5D A;  3EAM A;  1UV6 A;  3U8N A;  3WTM A;  4QAC A;  2BG9 E;  3PMZ A;  3RIF A;  3EHZ A;  4NPP A;  4ZJT A;  5LG3 A;  4UM3 S;  4DBM A;  3ZDG A;  4Z91 A;  3ZDH A;  5BW2 A;  5L4E A;  2VL0 A;  4UXU A;  3P50 A;  4BFQ A;  2X00 D;  2XQA A;  3JAF A;  4IRE A;  4WV9 A;  4HFH A;  3UU8 A;  5TVC A;  3UUB A;  2XZ6 A;  2YN6 A;  3JAE A;  4HFD A;  3TLS A;  2Y56 A;  4TWD A;  2XQ4 A;  3WTI A;  3TLW A;  4QAA A;  4ILC A;  5HEH A;  3T4M A;  2Y57 A;  5KZU A;  2XYT A;  5J0Z A;  2BG9 B;  3SQ9 A;  2W8F A;  2BR8 A;  4ZJS A;  2ZJV A;  5BP0 A;  2WNJ A;  3WTJ A;  5AFM B;  2BG9 C;  5HCJ A;  3U8L A;  4PIR A;  4TWF A;  2WN9 A;  4UM3 P;  4Z90 A;  4ILB A; 
#chains in the Genus database with same CATH topology
 2XQ9 A;  3P4W A;  2YMD A;  3UQ4 A;  3WTL A;  4HFB A;  3WTN A;  3SH1 A;  2X00 A;  4BQT A;  5AFK A;  4HFC A;  5HEU A;  5AFL A;  5HEG A;  3UU3 A;  5J5G A;  5KE4 A;  4ALX A;  4TWH A;  3C79 A;  5L47 A;  3TLT A;  4UY2 A;  5CFB A;  4ZK1 A;  4UM1 A;  5J5I A;  4ZZC A;  2PGZ A;  2QC1 B;  3ZKR A;  2UZ6 A;  1UW6 A;  2XZ5 A;  3SIO A;  3WIP A;  5AFJ A;  5J5H A;  4X5T A;  3UU4 A;  2WNL A;  4FRR A;  3EI0 A;  4COF A;  4ZRU A;  5HEJ A;  2Y58 A;  4HFE A;  4QH1 A;  3RQU A;  3UU5 A;  5IUX A;  4TNW A;  2C9T A;  2XNT A;  3GUA A;  4QH5 A;  4A97 A;  4LMJ A;  3U8J A;  5HCM A;  2BYP A;  3WTK A;  2Y54 A;  5BRX A;  5JME A;  4A98 A;  3C84 A;  2W8G A;  5J5F A;  4TNV A;  3RHW A;  4F8H A;  3IGQ A;  2BR7 A;  2YOE A;  4LML A;  2XYS A;  4XK9 A;  4AFG A;  2XQ8 A;  2XNU A;  2BYQ A;  2WNC A;  3LSV A;  2BYR A;  5AFH A;  4NZB A;  2WZY A;  4IL4 A;  2XNV A;  2Y7Y A;  4LMK A;  5CO5 A;  4ZK4 A;  3RIA A;  3RI5 A;  2BYN A;  2XQ5 A;  5FJV A;  5AIN A;  2BG9 A;  2ZJU A;  4EZ1 A;  4QH4 A;  4ILA A;  5SYO A;  5L4H A;  5LXB A;  3PEO A;  4IL9 A;  3WTO A;  5AFM A;  3UU6 A;  3WTH A;  3RQW A;  2BYS A;  3TLU A;  4AFT A;  2BJ0 A;  4ZR6 A;  3SQ6 A;  5AFN A;  2YME A;  4D01 A;  3UQ7 A;  4HQP A;  1I9B A;  2PH9 A;  2XQ3 A;  2YKS A;  5HEO A;  2XQ6 A;  1UX2 A;  3JAD A;  4XHE A;  4AFH A;  4ZZB A;  4HFI A;  2XQ7 A;  4UM3 A;  4QAB A;  3TLV A;  3U8M A;  3U8K A;  4B5D A;  3EAM A;  1UV6 A;  3U8N A;  3WTM A;  4QAC A;  2BG9 E;  3PMZ A;  3RIF A;  3EHZ A;  4NPP A;  4ZJT A;  5LG3 A;  4UM3 S;  4DBM A;  3ZDG A;  4Z91 A;  3ZDH A;  5BW2 A;  5L4E A;  2VL0 A;  4UXU A;  3P50 A;  4BFQ A;  2X00 D;  2XQA A;  3JAF A;  4IRE A;  4WV9 A;  4HFH A;  3UU8 A;  5TVC A;  3UUB A;  2XZ6 A;  2YN6 A;  3JAE A;  4HFD A;  3TLS A;  2Y56 A;  4TWD A;  2XQ4 A;  3WTI A;  3TLW A;  4QAA A;  4ILC A;  5HEH A;  3T4M A;  2Y57 A;  5KZU A;  2XYT A;  5J0Z A;  2BG9 B;  3SQ9 A;  2W8F A;  2BR8 A;  4ZJS A;  2ZJV A;  5BP0 A;  2WNJ A;  3WTJ A;  5AFM B;  2BG9 C;  5HCJ A;  3U8L A;  4PIR A;  4TWF A;  2WN9 A;  4UM3 P;  4Z90 A;  4ILB A; 
#chains in the Genus database with same CATH homology
 2XQ9 A;  3P4W A;  2YMD A;  3UQ4 A;  3WTL A;  4HFB A;  3WTN A;  3SH1 A;  2X00 A;  4BQT A;  5AFK A;  4HFC A;  5HEU A;  5AFL A;  5HEG A;  3UU3 A;  5J5G A;  5KE4 A;  4ALX A;  4TWH A;  3C79 A;  5L47 A;  3TLT A;  4UY2 A;  5CFB A;  4ZK1 A;  4UM1 A;  5J5I A;  4ZZC A;  2PGZ A;  2QC1 B;  3ZKR A;  2UZ6 A;  1UW6 A;  2XZ5 A;  3SIO A;  3WIP A;  5AFJ A;  5J5H A;  4X5T A;  3UU4 A;  2WNL A;  4FRR A;  3EI0 A;  4COF A;  4ZRU A;  5HEJ A;  2Y58 A;  4HFE A;  4QH1 A;  3RQU A;  3UU5 A;  5IUX A;  4TNW A;  2C9T A;  2XNT A;  3GUA A;  4QH5 A;  4A97 A;  4LMJ A;  3U8J A;  5HCM A;  2BYP A;  3WTK A;  2Y54 A;  5BRX A;  5JME A;  4A98 A;  3C84 A;  2W8G A;  5J5F A;  4TNV A;  3RHW A;  4F8H A;  3IGQ A;  2BR7 A;  2YOE A;  4LML A;  2XYS A;  4XK9 A;  4AFG A;  2XQ8 A;  2XNU A;  2BYQ A;  2WNC A;  3LSV A;  2BYR A;  5AFH A;  4NZB A;  2WZY A;  4IL4 A;  2XNV A;  2Y7Y A;  4LMK A;  5CO5 A;  4ZK4 A;  3RIA A;  3RI5 A;  2BYN A;  2XQ5 A;  5FJV A;  5AIN A;  2BG9 A;  2ZJU A;  4EZ1 A;  4QH4 A;  4ILA A;  5SYO A;  5L4H A;  5LXB A;  3PEO A;  4IL9 A;  3WTO A;  5AFM A;  3UU6 A;  3WTH A;  3RQW A;  2BYS A;  3TLU A;  4AFT A;  2BJ0 A;  4ZR6 A;  3SQ6 A;  5AFN A;  2YME A;  4D01 A;  3UQ7 A;  4HQP A;  1I9B A;  2PH9 A;  2XQ3 A;  2YKS A;  5HEO A;  2XQ6 A;  1UX2 A;  3JAD A;  4XHE A;  4AFH A;  4ZZB A;  4HFI A;  2XQ7 A;  4UM3 A;  4QAB A;  3TLV A;  3U8M A;  3U8K A;  4B5D A;  3EAM A;  1UV6 A;  3U8N A;  3WTM A;  4QAC A;  2BG9 E;  3PMZ A;  3RIF A;  3EHZ A;  4NPP A;  4ZJT A;  5LG3 A;  4UM3 S;  4DBM A;  3ZDG A;  4Z91 A;  3ZDH A;  5BW2 A;  5L4E A;  2VL0 A;  4UXU A;  3P50 A;  4BFQ A;  2X00 D;  2XQA A;  3JAF A;  4IRE A;  4WV9 A;  4HFH A;  3UU8 A;  5TVC A;  3UUB A;  2XZ6 A;  2YN6 A;  3JAE A;  4HFD A;  3TLS A;  2Y56 A;  4TWD A;  2XQ4 A;  3WTI A;  3TLW A;  4QAA A;  4ILC A;  5HEH A;  3T4M A;  2Y57 A;  5KZU A;  2XYT A;  5J0Z A;  2BG9 B;  3SQ9 A;  2W8F A;  2BR8 A;  4ZJS A;  2ZJV A;  5BP0 A;  2WNJ A;  3WTJ A;  5AFM B;  2BG9 C;  5HCJ A;  3U8L A;  4PIR A;  4TWF A;  2WN9 A;  4UM3 P;  4Z90 A;  4ILB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...