3UU5A

The glic pentameric ligand-gated ion channel loop2-20' mutant reduced in solution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVECNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu5A01
2X00A 4NZBA 3RI5A 4XK9A 3U8NA 2XNVA 3WTOA 4ILCA 3EI0A 2Y58A 3UQ4A 2YMEA 4QH1A 4HFCA 3JAEA 5KE4A 4UM3A 3SQ6A 4HQPA 4ZK1A 4ZZBA 3WIPA 5HEHA 4Z90A 4TNVA 4TWFA 3EAMA 3SH1A 5J5IA 5HEUA 2WNLA 3SQ9A 3C84A 3WTKA 3SIOA 1OEDB 4NPPA 3U8LA 3P50A 4HFDA 3UU8A 5AFMB 4ZZCA 4AFTA 5AFNA 5J5HA 3UUBA 1OEDC 2XQAA 2BG9E 2MAWA 2PH9A 4DBMA 2YMDA 2Y56A 2LKGA 1UV6A 5AFMA 3RIAA 2XQ6A 4HFIA 4IL9A 2YOEA 2LM2A 5HEJA 5L4EA 3TLWA 2XZ5A 4LMLA 2XZ6A 2ZJUA 4UY2A 4QAAA 3P4WA 2XQ3A 2BYPA 3U8MA 5IUXA 5FJVA 4B5DA 2QC1B 2BYQA 5JMEA 3JADA 2PGZA 3RHWA 2BG9B 5LXBA 5J0ZA 2BR7A 2UZ6A 4ZR6A 4IL4A 4HFBA 2C9TA 3WTHA 2BYNA 3GUAA 5J5FA 3C79A 1UX2A 2XYSA 5LG3A 3PEOA 2LLYA 4TWDA 4LMKA 4ZJSA 1OEDA 4COFA 4IREA 5L4HA 5HCJA 3ZDHA 3RQWA 4A98A 2WN9A 4ZJTA 2XQ8A 5AINA 5BP0A 4Z91A 4F8HA 2BG9A 1OEDE 3UQ7A 2WZYA 4QACA 2XQ4A 4PIRA 2Y7YA 4LMJA 5CO5A 2WNCA 4ZK4A 2M6IA 4XHEA 4ZRUA 2XQ7A 4BFQA 5KZUA 1I9BA 2YN6A 3LSVA 4D01A 2VL0A 2W8FA 3EHZA 4TNWA 3UU3A 4UXUA 5SYOA 4A97A 4UM3S 5AFKA 2Y57A 3WTJA 3U8KA 5L47A 3RIFA 5J5GA 3TLSA 4QH5A 5BRXA 5BW2A 4QH4A 2M6BA 3IGQA 3UU4A 2XNUA 4FRRA 2KSRA 4ILAA 3TLTA 2X00D 3WTMA 2W8GA 2YKSA 2BYRA 2XYTA 3T4MA 4UM1A 4AFHA 3UU6A 4AFGA 4BQTA 3ZKRA 4WV9A 3WTNA 2ZJVA 5CFBA 3U8JA 2BG9C 3RQUA 4X5TA 4HFHA 3JAFA 3TLUA 5AFJA 3WTIA 3TLVA 2XQ5A 3ZDGA 5AFLA 4ALXA 4TWHA 5HEOA 5HCMA 4UM3P 2BJ0A 2BYSA 2LKHA 2XNTA 5HEGA 5TVCA 2Y54A 3UU5A 4EZ1A 5AFHA 2XQ9A 3WTLA 4QABA 2BR8A 2WNJA 3PMZA 4ILBA 1UW6A 4HFEA
chains in the Genus database with same CATH superfamily
5HYAA 1O3XA 4ZI2D 3C51A 2C5KT 4ZS3A 2CHOA 4ZK1A 2IDOB 3FBLA 4L0RA 2BKNA 3ZN1B 3RIUC 4B3RT 4NUUA 2AE9A 4CI2B 3OBVE 3J7Yq 3R84B 2BS2A 4O4HE 3P4PA 1Z0PA 4WBNE 2CA5A 5FY0A 2NW9A 2XHEB 2W66A 5FYMA 3ZT6A 1ZHCA 3SFEA 3LBXB 2BG9B 4YJ2E 3RRCA 3CMLA 3AEFA 5LG3A 4JI7T 1MMDA 4P1NA 2XQ7A 3ZJ2A 1I9BA 4K0KT 4ASKA 4ZI7E 4UXUA 5LJNA 2YU2A 5J5GA 1WCRA 3UU4A 3U78A 4GKJT 5AQVB 3UU6A 1HNWT 1IZNB 2BS3A 3RPUA 3RYCE 4BA9A 2BG9C 1S35A 3RQUA 2FJAA 3AE7A 3AA7B 2YDRA 1E7PA 4XAXB 2JQQA 3Q5WA 3RKOA 2W0GA 5F5WA 2KNDA 4QABA 2WWVA 4YJ3E 3QC9A 2C0SA 2XNVA 2VASA 3JAEA 4GK0E 4AQFC 3KBUA 5AQPB 4UV8B 4X1YE 3SQ9A 2UXNB 4JEUB 4AFTA 2GK9A 2JQ9A 3RH3A 2BG9E 3MA9A 2YMDA 2Q9QC 4EEDA 3RYFE 2IC9A 1FMVA 5DQWA 4YHHT 1YXRA 3CQXC 2V8SV 2AXDS 4YFSA 1OXZA 2KXPB 1R8IA 2YEVC 5LHIB 2BR7A 4P0BA 5FKYA 2C9TA 5JR9C 5J1GA 3WAKA 5F8PA 2UXCT 5AINA 2XY8B 2ACZA 2LRLA 5HXEA 5ABFB 4HEAA 3PU8A 1QLBA 5AQTB 4MALA 3JC6C 4EXTA 2I0MA 3ANWA 4YHJA 4F6RC 2W8GA 4AFHA 3ESLA 2HHHT 5CA1E 2ZJVA 2IW5B 4N78D 2YINA 4DV4T 3SWHA 5FY1A 4H9OC 4TV8E 2H88A 4UR9A 2D0UA 5AQNB 1NAFA 3RRWA 3QK6A 2XQ9A 4PJNA 3KDSE 2X9HA 5M4YA 3G06A 4U72A 1D1AA 1VOMA 4JI5T 3HKCE 1B7TA 2VWAA 1KFYA 4YTMA 4ISTA 4KI0F 1FMWA 2X51A 1OEDC 4I50E 2IC6A 2Y56A 5AFMA 4U2ZA 2JQKA 3IHRA 4LMLA 4HFVA 4ZOLE 2CM0A 4OYJA 2NP9A 4NXMT 4QXBB 3LG7A 1VCTA 1MIYA 3UFEA 3LK3B 2BS4A 2SPCA 4ZJTA 1FEWA 5EK3A 5GONE 2X9WA 5FXXA 5LGNB 2YN6A 4PW8A 1YQ4A 3RC3A 3EHZA 3T1YT 3UU3A 5SYOA 5HXCA 1UCUA 3AE4A 2X9YA 3NRYA 5JDMA 3RC8A 4DBQA 5JREA 4Z8XA 5JDGA 1HF8A 3E0ZA 4HFHA 3UTKA 2X67A 3C50A 4ALXA 4TWHA 2A3DA 2L8KA 3HA4A 2LOPA 3AE5A 3P4SA 3OTOT 1U4QA 2LM9A 5TVCA 4JI4T 3K3OA 2NWBA 4IDQA 2L3LA 3AXJB 4JEHB 3SOLA 4O4JE 4HFEA 1Y64B 1W0BA 3LK2B 4ZXLA 1N32T 3ETVA 3LBXA 2NTYA 4TZ4C 3GN5B 5HWYA 4TWFA 5IHYA 3HI2A 1Y01A 3N9PA 3SIOA 4IHJE 4ZZCA 2CMRA 3V5UA 3N9LA 2XQAA 3AEGA 2IAKA 3C64A 1WR6A 4IT4A 1XDOA 4EOZB 4UY2A 3KV6A 3GMIA 1D1CA 3CX6B 4KHZF 4ZI2C 3ZYLA 2PG8A 4AKHA 2IMLA 1YD8G 4HFBA 5FXWA 4LFAT 3OPCA 1UX2A 2XYSA 4PNIA 3VRAA 2XM1A 2CXFA 2KT9A 4Z91A 4UF0A 3KVBA 4UELA 2V5CA 3LFMA 3P4RA 3CWZB 2DWKA 4ILUA 2BBJA 4CN1A 4NXNT 4LF8T 3TLSA 5BW2A 3IGQA 2M6BA 4IDZA 2WAUA 4H9SE 2KSRA 5J2TE 3ZKRA 4KP3C 5JR9B 3WTNA 3VKGA 5JQGE 5AQFB 4X5TA 3TLUA 3PUVF 3ZYKA 2H7VC 2WBLA 5HEOA 4UM3P 4AIUA 3Q2MA 3SRZA 3PUSA 3AA0B 3U8NA 5LHHB 4GKKT 2RP4A 3NWIA 1QUUA 4UF0B 5EK2A 3EAMA 3C84A 2N9DA 4QWNB 5AFMB 2MAWA 2UUBT 4U7YA 2EHOD 3ONJA 3WI3A 2VKJA 4YXDA 1HX1B 2CEAA 3P8CD 3OYXA 3C98B 4H63V 1IJ5A 4O4LE 3FZHB 4FI5A 5BR8T 3NRXA 3N9QA 3RQWA 2FJDA 4UIGA 1M7KA 4F8HA 3NBXX 4GOUA 4DIDB 3LSVA 4UM3S 4A97A 3CQGB 2E5VA 5EZYE 3PJAJ 2X00D 2WDRA 2BYRA 2WZIA 4EB6E 3U8JA 2X68A 2XTLA 4DR7T 3NZQA 3ZSSA 1KNRA 4KHPT 4EEBA 2Y54A 3ZYMA 2E5LT 2V7LA 3PMZA 2V26A 4V1Av 5CB4E 3MKDA 2Y48B 5BMVE 4HFCA 3QNUA 2HN1A 4QX7B 2WB5A 3RF1A 1EZ3A 2LE8A 2W2UA 2E9XD 5KDMC 4IDNA 4YTNA 2W62A 4NPPA 3UU8A 2OV9A 2ACXA 2CHNA 5HXHA 4X64T 3P7IA 2K3WA 4OFZA 4DR3T 4HFIA 2W61A 2X9XA 3L3PA 5AQJB 4AKLA 1SA0E 1WYCA 4I55E 3O1JA 4AQFA 5J5FA 5LGUB 3AAIA 4ZJSA 2J4GA 2LSKA 3RYHE 2BG9A 4ZI3C 5AQMB 2PTFA 2LHNA 1N36T 4BFQA 5KZUA 3MACA 1MIWA 1D0ZA 3M3ZB 2Y57A 4A56A 3U8KA 3AE8A 3VHLA 4JI1T 3IA3A 2VL8A 2Y6XA 1SE7A 2XYTA 1BR2A 3V5SA 4UM1A 4HWFA 4O2AE 3OYZA 4CXXA 3R6NA 4H9NC 1X9BA 5LBQB 1IAPA 3KINB 2VVSA 2HH7A 2LSGA 4U74A 2N1GA 3AEEA 4JI3T 2LKHA 1HNXT 3U3IA 4KUMB 3I1AA 1UW6A 3AEBA 3UUMA 5KXJA 5IYZE 3OVUA 3L39A 1HFAA 1XNQT 1E1HB 3UULA 4U33A 3KVAA 2I6HA 2LHRA 4ZS2A 1WLXA 3BQKA 2XQYA 1ZKEA 3AE2A 5LMNT 4L9IA 2WM9A 3BQLA 4HFDA 2D2SA 2YDSA 4CQIA 1D0XA 4MBQA 3Q9DA 4OX9T 3N2OA 5L4EA 2WWUA 2EHOB 3P4WA 3VRBA 2BVLA 1Z8UA 4LFCT 1XDPA 3MZKB 5J2UE 4U31A 2NR4A 2CBIA 2RPAA 2CXLA 4ZR6A 4YSZA 4ZI3D 1I6ZA 3NZPA 1HNZT 4TWDA 4LMKA 4JI0T 3PE0A 3LJCA 2JQHA 2X66A 3PTRB 2IIUA 3TKLB 2WNCA 2XPKA 4BJMA 3C4XA 1W9RA 4H9QC 4PFPA 4IE6A 1WFDA 1WYBA 4X62T 2VQET 3UUXB 4EIWA 5BRXA 2MPKA 4I4TE 4PK4A 5LBMA 2CLYC 4AQYT 1T8BA 3AVRA 2XZEA 3TLVA 5AFLA 2R6GF 5AQIB 1W0AA 3Q5DA 2VKOA 4IE7A 2Q9QB 4AKRB 2JIWA 1G8XA 5JRCA 3PUYF 3UQ4A 3VKHA 3BK9A 3H3AA 3FXDB 5JR9A 2UXXB 4HQPA 1XZYA 4EGWA 5JDQA 3AAAB 4M1PA 2PFVA 3C4WA 5HEUA 5J5IA 2LSJA 2VK9A 4AKIA 2V7KA 2K48A 4CZZB 2CWYA 4DVDA 2H3RA 4JLEA 5KX5E 2C5JA 4PK5A 5FJVA 4DR5T 4G63A 3ZSTA 3ZJ1A 4HWCA 4LF6T 3L09A 2DNXA 4IREA 2VKDA 3ZDHA 2XQ8A 1OEDE 3UQ7A 4DV0T 2WZYA 5FL0A 1WR0A 2ZM8A 4LMJA 1J5ET 3EUHA 3AE6A 4PAGA 3E08A 2RA1A 4WNKA 4IDPA 2W8FA 3UT5E 2ODUA 5AFKA 4DR1T 3VR8A 1MMNA 2LSIA 3WTMA 3QB5A 1HS7A 5JVDE 1T72A 3VR9A 2ZM6T 1LRZA 3ZDGA 2XQ5A 2D9DA 3AEDA 2QYWA 2ZM2A 2BYSA 3HR0A 3SFDA 4QXHB 4BAYB 2ZLYA 4ZEYA 2MOZA 2NTXA 4WYVA 4GYRA 2FBWA 3ONLC 3PUXF 2KZ7B 2JPFA 3ZMUB 2CBJA 3F57A 4ADZA 2XUEA 3I9WA 3ZPOA 5L3BB 1OEDB 3ETUA 3U8LA 3P50A 3I9YA 2JJ9A 5C2TA 5H6RB 5LJMA 5JMEA 5LOVE 3IEEA 5FXVA 4QXCB 1KNPA 4DV5T 2DWGA 4HE8A 5KMGP 3AB3B 3EVYA 4COFA 5HCJA 4PJJA 5JDFA 3AAEB 3PJAA 4QACA 3RYIE 2XAQB 3NKZA 2VL0A 2YDQA 4NUVA 3WTJA 3KBTA 2VURA 5FMNA 5AQKB 2CPTA 3LK42 1ZV4X 1IBMT 2V1DB 2H7OA 3IF8B 1IBKT 2Q9QA 3PU3A 1N33T 5DABA 4DO0A 2BR8A 3I0OA 4X1KE 3O1IA 2YMEA 3GWHA 1MIVA 2K5BB 4B6XA 1NEKA 2CLYB 3SQ6A 3WIPA 2J1DG 3D0TA 3H37A 3SH1A 3W15B 3K1SA 4UVAB 1KNZA 3ZMVB 4DUYT 1HTJF 5AFNA 2V6YB 4P0AA 2PH9A 5HAXA 2WMOA 5C8YE 1LVKA 2FJBA 2YOEA 1YQ3A 4DUZT 3X1DA 2YK0A 5IUXA 2KINB 1I94T 2PBIA 3FB2A 2JRKA 3K3QC 3WTHA 2UXBT 1YKHB 1H7CA 5LGTB 1OEDA 5L3GB 5L4HA 3K3NA 2WN9A 5DQVA 2XM2A 2W63A 2WU2A 2EHOC 1L0VA 1SUMB 3CVRA 4IE5A 2LSYA 2WDQA 3ZC0A 3L8RA 1DU2A 1S94A 3CK6A 3PUZF 2C5IT 5FY7A 5LYJE 3F31A 2DCFA 3BQIA 5AFJA 5HWXA 4AISA 4K0UA 2IHR1 3N9OA 3B5MA 3GA8A 5IWAT 2BZBA 2FJEA 2M67A 5HEGA 2BBHA 2VKHA 2ZM0A 4TX5A 4YSXA 4XK9A 3NVOA 2UXDT 2Y58A 4QH1A 2DHRA 5L3CB 4ZZBA 4LF5T 2UU9T 1D0YA 1HR0T 4C90A 4WZXA 2NW8A 4P09A 5CGMA 3FHNA 2NOXA 2J62A 4FJOA 3B57A 4AI6A 2JMKA 5LXTE 2FUPA 2WSSV 1UV6A 3CQCB 4EZHA 2XZ6A 2X0HA 3SS1A 4MFRA 2V7JA 2QC1B 4HN9A 2BYQA 4UV9B 3AECA 3KV4A 3GN5A 4PK6A 5FXZA 3GUAA 4HTEA 2LEHA 2P9BA 4ZHQE 5AQRB 4A98A 5E0OA 5AQHB 5CO5A 2W4XA 5AFUL 4XHEA 2X0YA 2CCQA 2CXDA 4D01A 4Q25A 2WS3A 2PJQA 3PUGA 4O2BE 4IIJE 2WCAA 4FRRA 2Y8DA 5LP6E 3ZT7A 5C3JA 4QHOA 4AFGA 3UFGA 2D5UA 4JI6T 3DTOA 3ZT5A 3CPZA 4E7ZA 3RIUA 5CA0E 5HXSA 4CI1B 3AE3A 4EV6A 2HPLA 4X1IE 4CN4A 4AXPA 3RI5A 2WP9A 3WTOA 4ILCA 4KBMB 4JI8T 3AE9A 2V6YA 2BDEA 1VCSA 2ES0A 4O4IE 4MLKA 4DR4T 4DBMA 2VQFT 2QVAA 4O8SA 5HEJA 3TLWA 1VRBA 2XAHB 4UVCB 1HX8A 2A2FX 3MXZA 2XAGB 4PFOA 2Q9QD 4AKGA 4BJNA 3FBZA 1W09A 5FL1A 5LXBA 4IE0A 4DBRA 2WDVA 2LLYA 1KEYA 3ZMSB 3ZLIA 4E7SA 5DJQC 3Q5XA 2JMHA 4X65T 2XQ4A 4JYAT 4OYKA 4ZK4A 3FZMB 4ISSA 4EZ4A 4AQGA 3M65A 4IE4A 4TNWA 1QSDA 2XJ7A 3RIFA 2XNUA 3WAJA 2WMNA 4ILAA 3TLTA 2YKSA 2E8IA 4YY3T 4BQTA 4WV9A 4ERRA 5CFBA 1OWAA 1XMQT 3VU7H 1ZP0A 1CUNA 1MMAA 4TN7B 3MJXA 2XNTA 2DL1A 2W00A 3UU5A 4EZ1A 3A5XA 4H9RC 4ILBA 4B3MT 4X66T 5A1LA 1ZOYA 4UEMA 4EYYR 2W67A 2QA7A 4XBFB 2V6XA 2B76A 4NIQA 4I43B 5J5HA 5ABHA 4DR2T 5ABGA 1M62A 2LT3A 2VB6A 4PJLA 2HN2A 4I0UA 4IL9A 5HXRA 2XZ5A 2XQ3A 4GIWA 1U5PA 5CJ5A 2L9QA 1N34T 4DV1T 3H3MA 3CKDA 3RHWA 3RGLA 2OLTA 5J0ZA 4IL4A 4YLHA 3PEOA 3KV5A 2DI4A 5LCYA 4CXWA 1XNRT 1HCIA 1UK5A 3HKDE 1BR4A 4PIRA 3MK7C 1UURA 2KWHA 3ABVA 4B3TT 2Y7YA 4ZRUA 1D1BA 2E9XB 3AA1B 4QX8B 2ZMAA 4U3CA 2E2AA 3IBPA 2CRBA 1G73A 2A72A 1UX4A 4QH5A 5FVLA 3I0QA 3CX8B 3K8PC 4DMVA 3T4MA 5ABFA 2XAFB 4CI3B 1BR0A 1UUSA 4JUYA 4CXYA 3B13A 2H89A 2EHOA 5L3EB 4EYUA 3FXEB 3AE1A 3N9MA 5JRCB 4DV2T 4MHCA 1MNDA 5EK4A 2KWIB 1HG5A 2WQYA 4ANJA 4WW0A 2LRKA 4OHFA 4GK5E 4HWDA 2XAJB 2WU5A 5AQGB 2UUCT 3Q5EA 3CX7B 2IUBA 1IJ6A 3FZLB 2KMFA 1GQEA 3PDYA 1IBLT 3PUWF 4XZCA 3RLFF 5L3FB 5JDLA 1CHUA 1US7B 5ADXL 5AQOB 2XQ6A 2LM2A 3HKEE 1BR1A 1WRDA 4GYSA 2LJLA 2BYPA 1E2AA 4G2AA 4DV6T 3UUNA 2MTQA 1LKXA 2HPJA 5AQQB 3PUQA 4YTPA 2J47A 3FZFB 2E9XA 2WY2A 4DMWA 4DR6T 3ZMTB 5FP3A 2XASB 5FVKA 1AJ3A 4HGAA 2OA5A 3C4ZA 2QGSA 5FNVE 3J9X1 3ZMZB 4J2CA 3EABA 3DJBA 1JNRA 2I59A 5L47A 2LOSA 1LVFA 2G0UA 5L3DB 5LB7B 2K9AA 3JC6D 1ZEEA 2CE7A 3JAFA 5AQUB 5LG4A 3WTIA 5JTGA 3N5LA 2KLQA 2D0TA 5H6QB 3O1HA 1NENA 2BKPA 3QB5K 5AFHA 1V9DA 3WTLA 3EDUA 2X00A 4NZBA 1FIOA 3PURA 3P4QA 1KF6A 1XMOT 1HG2A 4KX6A 4U2YA 4IGUA 5KE4A 4UM3A 3F2EA 5F3JA 5HEHA 1MNEA 4DNDA 2Z6EA 3LDQB 2F4VT 3HL6A 3QOFA 3RIAA 3AA6B 4H63H 3PV0F 4QAAA 3ZC1A 3RKGA 2DLRA 4HKAA 3JADA 4JV5T 2UZ6A 3ANWB 3AEAA 3A7MA 4HWIB 2BYNA 3CIRA 3E22E 4IDOA 4CN6A 2K24A 5BP0A 1KK7A 4HWHA 5LA6E 1YW0A 2VVNA 4QKNA 2M6IA 2N2NA 4WBOA 3N2GE 3JCFA 5L2LA 4B3ST 5LMUT 4L5GA 4QH4A 1NWMX 5JH7E 2MYSA 5ABEA 4X20E 3T1HT 3EDVA 2ODVA 2BVMA 3PUAA 1T7SA 2YU1A 2CWOA 4JI2T 4H9PC 1SHZC 5HCMA 4KMCA 2BKOA 2NW7A 2BJ0A 3KV9A 3EI0A 2QRXA 1T98A 4DV3T 2B1EA 3OKQA 3HKBE 3N2KE 4Z90A 4TNVA 4YSYA 2WNLA 1UGOA 3WTKA 3OJAA 5ETWA 3ZN0B 3QUJA 3UUBA 2XSBA 4UVBB 2WZHA 2LKGA 2X0LB 5LHGB 5AQSB 2ZJUA 3S4UA 3U8MA 4B5DA 2V7MA 3T8OA 3O9XA 2PGZA 4YT0A 5JDNA 2XSAA 1MMGA 3DP7A 4UXNB 4DV7T 4LFBT 3C79A 5LNKA 3O4XE 4U7IA 3ZEFB 4OK0A 4JBWF 3AXJA 1YKEB 3FZKB 3A8YC 3RX6A 1UX5A 3KFWX 4LF7T 3N9NA 1XWMA 1X79A 4PJMA 1JNZA 1J1JA 4C91A 5JDHA 4EAHA 2V7IA 5AQLB 3AVSA 4LF4T 2UUAT 3ONXA 1J5WA 2E9XC 4A5XA 4TV9E 4TUYE 2V5DA 5TAOA 1FJGT 2A9UA 4LF9T 3ZCIA 2MBGA 2WNJA 3ZCJA
chains in the Genus database with same CATH topology
2X00A 4NZBA 3RI5A 4XK9A 3U8NA 2XNVA 3WTOA 4ILCA 3EI0A 2Y58A 3UQ4A 2YMEA 4QH1A 4HFCA 3JAEA 5KE4A 4UM3A 3SQ6A 4HQPA 4ZK1A 4ZZBA 3WIPA 5HEHA 4Z90A 4TNVA 4TWFA 3EAMA 3SH1A 5J5IA 5HEUA 2WNLA 3SQ9A 3C84A 3WTKA 3SIOA 1OEDB 4NPPA 3U8LA 3P50A 4HFDA 3UU8A 5AFMB 4ZZCA 4AFTA 5AFNA 5J5HA 3UUBA 1OEDC 2XQAA 2BG9E 2MAWA 2PH9A 4DBMA 2YMDA 2Y56A 2LKGA 1UV6A 5AFMA 3RIAA 2XQ6A 4HFIA 4IL9A 2YOEA 2LM2A 5HEJA 5L4EA 3TLWA 2XZ5A 4LMLA 2XZ6A 2ZJUA 4UY2A 4QAAA 3P4WA 2XQ3A 2BYPA 3U8MA 5IUXA 5FJVA 4B5DA 2QC1B 2BYQA 5JMEA 3JADA 2PGZA 3RHWA 2BG9B 5LXBA 5J0ZA 2BR7A 2UZ6A 4ZR6A 4IL4A 4HFBA 2C9TA 3WTHA 2BYNA 3GUAA 5J5FA 3C79A 1UX2A 2XYSA 5LG3A 3PEOA 2LLYA 4TWDA 4LMKA 4ZJSA 1OEDA 4COFA 4IREA 5L4HA 5HCJA 3ZDHA 3RQWA 4A98A 2WN9A 4ZJTA 2XQ8A 5AINA 5BP0A 4Z91A 4F8HA 2BG9A 1OEDE 3UQ7A 2WZYA 4QACA 2XQ4A 4PIRA 2Y7YA 4LMJA 5CO5A 2WNCA 4ZK4A 2M6IA 4XHEA 4ZRUA 2XQ7A 4BFQA 5KZUA 1I9BA 2YN6A 3LSVA 4D01A 2VL0A 2W8FA 3EHZA 4TNWA 3UU3A 4UXUA 5SYOA 4A97A 4UM3S 5AFKA 2Y57A 3WTJA 3U8KA 5L47A 3RIFA 5J5GA 3TLSA 4QH5A 5BRXA 5BW2A 4QH4A 2M6BA 3IGQA 3UU4A 2XNUA 4FRRA 2KSRA 4ILAA 3TLTA 2X00D 3WTMA 2W8GA 2YKSA 2BYRA 2XYTA 3T4MA 4UM1A 4AFHA 3UU6A 4AFGA 4BQTA 3ZKRA 4WV9A 3WTNA 2ZJVA 5CFBA 3U8JA 2BG9C 3RQUA 4X5TA 4HFHA 3JAFA 3TLUA 5AFJA 3WTIA 3TLVA 2XQ5A 3ZDGA 5AFLA 4ALXA 4TWHA 5HEOA 5HCMA 4UM3P 2BJ0A 2BYSA 2LKHA 2XNTA 5HEGA 5TVCA 2Y54A 3UU5A 4EZ1A 5AFHA 2XQ9A 3WTLA 4QABA 2BR8A 2WNJA 3PMZA 4ILBA 1UW6A 4HFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X00 A;  4NZB A;  3RI5 A;  4XK9 A;  3U8N A;  2XNV A;  3WTO A;  4ILC A;  3EI0 A;  2Y58 A;  3UQ4 A;  2YME A;  4QH1 A;  4HFC A;  3JAE A;  5KE4 A;  4UM3 A;  3SQ6 A;  4HQP A;  4ZK1 A;  4ZZB A;  3WIP A;  5HEH A;  4Z90 A;  4TNV A;  4TWF A;  3EAM A;  3SH1 A;  5J5I A;  5HEU A;  2WNL A;  3SQ9 A;  3C84 A;  3WTK A;  3SIO A;  1OED B;  4NPP A;  3U8L A;  3P50 A;  4HFD A;  3UU8 A;  5AFM B;  4ZZC A;  4AFT A;  5AFN A;  5J5H A;  3UUB A;  1OED C;  2XQA A;  2BG9 E;  2MAW A;  2PH9 A;  4DBM A;  2YMD A;  2Y56 A;  2LKG A;  1UV6 A;  5AFM A;  3RIA A;  2XQ6 A;  4HFI A;  4IL9 A;  2YOE A;  2LM2 A;  5HEJ A;  5L4E A;  3TLW A;  2XZ5 A;  4LML A;  2XZ6 A;  2ZJU A;  4UY2 A;  4QAA A;  3P4W A;  2XQ3 A;  2BYP A;  3U8M A;  5IUX A;  5FJV A;  4B5D A;  2QC1 B;  2BYQ A;  5JME A;  3JAD A;  2PGZ A;  3RHW A;  2BG9 B;  5LXB A;  5J0Z A;  2BR7 A;  2UZ6 A;  4ZR6 A;  4IL4 A;  4HFB A;  2C9T A;  3WTH A;  2BYN A;  3GUA A;  5J5F A;  3C79 A;  1UX2 A;  2XYS A;  5LG3 A;  3PEO A;  2LLY A;  4TWD A;  4LMK A;  4ZJS A;  1OED A;  4COF A;  4IRE A;  5L4H A;  5HCJ A;  3ZDH A;  3RQW A;  4A98 A;  2WN9 A;  4ZJT A;  2XQ8 A;  5AIN A;  5BP0 A;  4Z91 A;  4F8H A;  2BG9 A;  1OED E;  3UQ7 A;  2WZY A;  4QAC A;  2XQ4 A;  4PIR A;  2Y7Y A;  4LMJ A;  5CO5 A;  2WNC A;  4ZK4 A;  2M6I A;  4XHE A;  4ZRU A;  2XQ7 A;  4BFQ A;  5KZU A;  1I9B A;  2YN6 A;  3LSV A;  4D01 A;  2VL0 A;  2W8F A;  3EHZ A;  4TNW A;  3UU3 A;  4UXU A;  5SYO A;  4A97 A;  4UM3 S;  5AFK A;  2Y57 A;  3WTJ A;  3U8K A;  5L47 A;  3RIF A;  5J5G A;  3TLS A;  4QH5 A;  5BRX A;  5BW2 A;  4QH4 A;  2M6B A;  3IGQ A;  3UU4 A;  2XNU A;  4FRR A;  2KSR A;  4ILA A;  3TLT A;  2X00 D;  3WTM A;  2W8G A;  2YKS A;  2BYR A;  2XYT A;  3T4M A;  4UM1 A;  4AFH A;  3UU6 A;  4AFG A;  4BQT A;  3ZKR A;  4WV9 A;  3WTN A;  2ZJV A;  5CFB A;  3U8J A;  2BG9 C;  3RQU A;  4X5T A;  4HFH A;  3JAF A;  3TLU A;  5AFJ A;  3WTI A;  3TLV A;  2XQ5 A;  3ZDG A;  5AFL A;  4ALX A;  4TWH A;  5HEO A;  5HCM A;  4UM3 P;  2BJ0 A;  2BYS A;  2LKH A;  2XNT A;  5HEG A;  5TVC A;  2Y54 A;  3UU5 A;  4EZ1 A;  5AFH A;  2XQ9 A;  3WTL A;  4QAB A;  2BR8 A;  2WNJ A;  3PMZ A;  4ILB A;  1UW6 A;  4HFE A; 
#chains in the Genus database with same CATH topology
 5HYA A;  1O3X A;  4ZI2 D;  3C51 A;  2C5K T;  4ZS3 A;  2CHO A;  4ZK1 A;  2IDO B;  3FBL A;  4L0R A;  2BKN A;  3ZN1 B;  3RIU C;  4B3R T;  4NUU A;  2AE9 A;  4CI2 B;  3OBV E;  3J7Y q;  3R84 B;  2BS2 A;  4O4H E;  3P4P A;  1Z0P A;  4WBN E;  2CA5 A;  5FY0 A;  2NW9 A;  2XHE B;  2W66 A;  5FYM A;  3ZT6 A;  1ZHC A;  3SFE A;  3LBX B;  2BG9 B;  4YJ2 E;  3RRC A;  3CML A;  3AEF A;  5LG3 A;  4JI7 T;  1MMD A;  4P1N A;  2XQ7 A;  3ZJ2 A;  1I9B A;  4K0K T;  4ASK A;  4ZI7 E;  4UXU A;  5LJN A;  2YU2 A;  5J5G A;  1WCR A;  3UU4 A;  3U78 A;  4GKJ T;  5AQV B;  3UU6 A;  1HNW T;  1IZN B;  2BS3 A;  3RPU A;  3RYC E;  4BA9 A;  2BG9 C;  1S35 A;  3RQU A;  2FJA A;  3AE7 A;  3AA7 B;  2YDR A;  1E7P A;  4XAX B;  2JQQ A;  3Q5W A;  3RKO A;  2W0G A;  5F5W A;  2KND A;  4QAB A;  2WWV A;  4YJ3 E;  3QC9 A;  2C0S A;  2XNV A;  2VAS A;  3JAE A;  4GK0 E;  4AQF C;  3KBU A;  5AQP B;  4UV8 B;  4X1Y E;  3SQ9 A;  2UXN B;  4JEU B;  4AFT A;  2GK9 A;  2JQ9 A;  3RH3 A;  2BG9 E;  3MA9 A;  2YMD A;  2Q9Q C;  4EED A;  3RYF E;  2IC9 A;  1FMV A;  5DQW A;  4YHH T;  1YXR A;  3CQX C;  2V8S V;  2AXD S;  4YFS A;  1OXZ A;  2KXP B;  1R8I A;  2YEV C;  5LHI B;  2BR7 A;  4P0B A;  5FKY A;  2C9T A;  5JR9 C;  5J1G A;  3WAK A;  5F8P A;  2UXC T;  5AIN A;  2XY8 B;  2ACZ A;  2LRL A;  5HXE A;  5ABF B;  4HEA A;  3PU8 A;  1QLB A;  5AQT B;  4MAL A;  3JC6 C;  4EXT A;  2I0M A;  3ANW A;  4YHJ A;  4F6R C;  2W8G A;  4AFH A;  3ESL A;  2HHH T;  5CA1 E;  2ZJV A;  2IW5 B;  4N78 D;  2YIN A;  4DV4 T;  3SWH A;  5FY1 A;  4H9O C;  4TV8 E;  2H88 A;  4UR9 A;  2D0U A;  5AQN B;  1NAF A;  3RRW A;  3QK6 A;  2XQ9 A;  4PJN A;  3KDS E;  2X9H A;  5M4Y A;  3G06 A;  4U72 A;  1D1A A;  1VOM A;  4JI5 T;  3HKC E;  1B7T A;  2VWA A;  1KFY A;  4YTM A;  4IST A;  4KI0 F;  1FMW A;  2X51 A;  1OED C;  4I50 E;  2IC6 A;  2Y56 A;  5AFM A;  4U2Z A;  2JQK A;  3IHR A;  4LML A;  4HFV A;  4ZOL E;  2CM0 A;  4OYJ A;  2NP9 A;  4NXM T;  4QXB B;  3LG7 A;  1VCT A;  1MIY A;  3UFE A;  3LK3 B;  2BS4 A;  2SPC A;  4ZJT A;  1FEW A;  5EK3 A;  5GON E;  2X9W A;  5FXX A;  5LGN B;  2YN6 A;  4PW8 A;  1YQ4 A;  3RC3 A;  3EHZ A;  3T1Y T;  3UU3 A;  5SYO A;  5HXC A;  1UCU A;  3AE4 A;  2X9Y A;  3NRY A;  5JDM A;  3RC8 A;  4DBQ A;  5JRE A;  4Z8X A;  5JDG A;  1HF8 A;  3E0Z A;  4HFH A;  3UTK A;  2X67 A;  3C50 A;  4ALX A;  4TWH A;  2A3D A;  2L8K A;  3HA4 A;  2LOP A;  3AE5 A;  3P4S A;  3OTO T;  1U4Q A;  2LM9 A;  5TVC A;  4JI4 T;  3K3O A;  2NWB A;  4IDQ A;  2L3L A;  3AXJ B;  4JEH B;  3SOL A;  4O4J E;  4HFE A;  1Y64 B;  1W0B A;  3LK2 B;  4ZXL A;  1N32 T;  3ETV A;  3LBX A;  2NTY A;  4TZ4 C;  3GN5 B;  5HWY A;  4TWF A;  5IHY A;  3HI2 A;  1Y01 A;  3N9P A;  3SIO A;  4IHJ E;  4ZZC A;  2CMR A;  3V5U A;  3N9L A;  2XQA A;  3AEG A;  2IAK A;  3C64 A;  1WR6 A;  4IT4 A;  1XDO A;  4EOZ B;  4UY2 A;  3KV6 A;  3GMI A;  1D1C A;  3CX6 B;  4KHZ F;  4ZI2 C;  3ZYL A;  2PG8 A;  4AKH A;  2IML A;  1YD8 G;  4HFB A;  5FXW A;  4LFA T;  3OPC A;  1UX2 A;  2XYS A;  4PNI A;  3VRA A;  2XM1 A;  2CXF A;  2KT9 A;  4Z91 A;  4UF0 A;  3KVB A;  4UEL A;  2V5C A;  3LFM A;  3P4R A;  3CWZ B;  2DWK A;  4ILU A;  2BBJ A;  4CN1 A;  4NXN T;  4LF8 T;  3TLS A;  5BW2 A;  3IGQ A;  2M6B A;  4IDZ A;  2WAU A;  4H9S E;  2KSR A;  5J2T E;  3ZKR A;  4KP3 C;  5JR9 B;  3WTN A;  3VKG A;  5JQG E;  5AQF B;  4X5T A;  3TLU A;  3PUV F;  3ZYK A;  2H7V C;  2WBL A;  5HEO A;  4UM3 P;  4AIU A;  3Q2M A;  3SRZ A;  3PUS A;  3AA0 B;  3U8N A;  5LHH B;  4GKK T;  2RP4 A;  3NWI A;  1QUU A;  4UF0 B;  5EK2 A;  3EAM A;  3C84 A;  2N9D A;  4QWN B;  5AFM B;  2MAW A;  2UUB T;  4U7Y A;  2EHO D;  3ONJ A;  3WI3 A;  2VKJ A;  4YXD A;  1HX1 B;  2CEA A;  3P8C D;  3OYX A;  3C98 B;  4H63 V;  1IJ5 A;  4O4L E;  3FZH B;  4FI5 A;  5BR8 T;  3NRX A;  3N9Q A;  3RQW A;  2FJD A;  4UIG A;  1M7K A;  4F8H A;  3NBX X;  4GOU A;  4DID B;  3LSV A;  4UM3 S;  4A97 A;  3CQG B;  2E5V A;  5EZY E;  3PJA J;  2X00 D;  2WDR A;  2BYR A;  2WZI A;  4EB6 E;  3U8J A;  2X68 A;  2XTL A;  4DR7 T;  3NZQ A;  3ZSS A;  1KNR A;  4KHP T;  4EEB A;  2Y54 A;  3ZYM A;  2E5L T;  2V7L A;  3PMZ A;  2V26 A;  4V1A v;  5CB4 E;  3MKD A;  2Y48 B;  5BMV E;  4HFC A;  3QNU A;  2HN1 A;  4QX7 B;  2WB5 A;  3RF1 A;  1EZ3 A;  2LE8 A;  2W2U A;  2E9X D;  5KDM C;  4IDN A;  4YTN A;  2W62 A;  4NPP A;  3UU8 A;  2OV9 A;  2ACX A;  2CHN A;  5HXH A;  4X64 T;  3P7I A;  2K3W A;  4OFZ A;  4DR3 T;  4HFI A;  2W61 A;  2X9X A;  3L3P A;  5AQJ B;  4AKL A;  1SA0 E;  1WYC A;  4I55 E;  3O1J A;  4AQF A;  5J5F A;  5LGU B;  3AAI A;  4ZJS A;  2J4G A;  2LSK A;  3RYH E;  2BG9 A;  4ZI3 C;  5AQM B;  2PTF A;  2LHN A;  1N36 T;  4BFQ A;  5KZU A;  3MAC A;  1MIW A;  1D0Z A;  3M3Z B;  2Y57 A;  4A56 A;  3U8K A;  3AE8 A;  3VHL A;  4JI1 T;  3IA3 A;  2VL8 A;  2Y6X A;  1SE7 A;  2XYT A;  1BR2 A;  3V5S A;  4UM1 A;  4HWF A;  4O2A E;  3OYZ A;  4CXX A;  3R6N A;  4H9N C;  1X9B A;  5LBQ B;  1IAP A;  3KIN B;  2VVS A;  2HH7 A;  2LSG A;  4U74 A;  2N1G A;  3AEE A;  4JI3 T;  2LKH A;  1HNX T;  3U3I A;  4KUM B;  3I1A A;  1UW6 A;  3AEB A;  3UUM A;  5KXJ A;  5IYZ E;  3OVU A;  3L39 A;  1HFA A;  1XNQ T;  1E1H B;  3UUL A;  4U33 A;  3KVA A;  2I6H A;  2LHR A;  4ZS2 A;  1WLX A;  3BQK A;  2XQY A;  1ZKE A;  3AE2 A;  5LMN T;  4L9I A;  2WM9 A;  3BQL A;  4HFD A;  2D2S A;  2YDS A;  4CQI A;  1D0X A;  4MBQ A;  3Q9D A;  4OX9 T;  3N2O A;  5L4E A;  2WWU A;  2EHO B;  3P4W A;  3VRB A;  2BVL A;  1Z8U A;  4LFC T;  1XDP A;  3MZK B;  5J2U E;  4U31 A;  2NR4 A;  2CBI A;  2RPA A;  2CXL A;  4ZR6 A;  4YSZ A;  4ZI3 D;  1I6Z A;  3NZP A;  1HNZ T;  4TWD A;  4LMK A;  4JI0 T;  3PE0 A;  3LJC A;  2JQH A;  2X66 A;  3PTR B;  2IIU A;  3TKL B;  2WNC A;  2XPK A;  4BJM A;  3C4X A;  1W9R A;  4H9Q C;  4PFP A;  4IE6 A;  1WFD A;  1WYB A;  4X62 T;  2VQE T;  3UUX B;  4EIW A;  5BRX A;  2MPK A;  4I4T E;  4PK4 A;  5LBM A;  2CLY C;  4AQY T;  1T8B A;  3AVR A;  2XZE A;  3TLV A;  5AFL A;  2R6G F;  5AQI B;  1W0A A;  3Q5D A;  2VKO A;  4IE7 A;  2Q9Q B;  4AKR B;  2JIW A;  1G8X A;  5JRC A;  3PUY F;  3UQ4 A;  3VKH A;  3BK9 A;  3H3A A;  3FXD B;  5JR9 A;  2UXX B;  4HQP A;  1XZY A;  4EGW A;  5JDQ A;  3AAA B;  4M1P A;  2PFV A;  3C4W A;  5HEU A;  5J5I A;  2LSJ A;  2VK9 A;  4AKI A;  2V7K A;  2K48 A;  4CZZ B;  2CWY A;  4DVD A;  2H3R A;  4JLE A;  5KX5 E;  2C5J A;  4PK5 A;  5FJV A;  4DR5 T;  4G63 A;  3ZST A;  3ZJ1 A;  4HWC A;  4LF6 T;  3L09 A;  2DNX A;  4IRE A;  2VKD A;  3ZDH A;  2XQ8 A;  1OED E;  3UQ7 A;  4DV0 T;  2WZY A;  5FL0 A;  1WR0 A;  2ZM8 A;  4LMJ A;  1J5E T;  3EUH A;  3AE6 A;  4PAG A;  3E08 A;  2RA1 A;  4WNK A;  4IDP A;  2W8F A;  3UT5 E;  2ODU A;  5AFK A;  4DR1 T;  3VR8 A;  1MMN A;  2LSI A;  3WTM A;  3QB5 A;  1HS7 A;  5JVD E;  1T72 A;  3VR9 A;  2ZM6 T;  1LRZ A;  3ZDG A;  2XQ5 A;  2D9D A;  3AED A;  2QYW A;  2ZM2 A;  2BYS A;  3HR0 A;  3SFD A;  4QXH B;  4BAY B;  2ZLY A;  4ZEY A;  2MOZ A;  2NTX A;  4WYV A;  4GYR A;  2FBW A;  3ONL C;  3PUX F;  2KZ7 B;  2JPF A;  3ZMU B;  2CBJ A;  3F57 A;  4ADZ A;  2XUE A;  3I9W A;  3ZPO A;  5L3B B;  1OED B;  3ETU A;  3U8L A;  3P50 A;  3I9Y A;  2JJ9 A;  5C2T A;  5H6R B;  5LJM A;  5JME A;  5LOV E;  3IEE A;  5FXV A;  4QXC B;  1KNP A;  4DV5 T;  2DWG A;  4HE8 A;  5KMG P;  3AB3 B;  3EVY A;  4COF A;  5HCJ A;  4PJJ A;  5JDF A;  3AAE B;  3PJA A;  4QAC A;  3RYI E;  2XAQ B;  3NKZ A;  2VL0 A;  2YDQ A;  4NUV A;  3WTJ A;  3KBT A;  2VUR A;  5FMN A;  5AQK B;  2CPT A;  3LK4 2;  1ZV4 X;  1IBM T;  2V1D B;  2H7O A;  3IF8 B;  1IBK T;  2Q9Q A;  3PU3 A;  1N33 T;  5DAB A;  4DO0 A;  2BR8 A;  3I0O A;  4X1K E;  3O1I A;  2YME A;  3GWH A;  1MIV A;  2K5B B;  4B6X A;  1NEK A;  2CLY B;  3SQ6 A;  3WIP A;  2J1D G;  3D0T A;  3H37 A;  3SH1 A;  3W15 B;  3K1S A;  4UVA B;  1KNZ A;  3ZMV B;  4DUY T;  1HTJ F;  5AFN A;  2V6Y B;  4P0A A;  2PH9 A;  5HAX A;  2WMO A;  5C8Y E;  1LVK A;  2FJB A;  2YOE A;  1YQ3 A;  4DUZ T;  3X1D A;  2YK0 A;  5IUX A;  2KIN B;  1I94 T;  2PBI A;  3FB2 A;  2JRK A;  3K3Q C;  3WTH A;  2UXB T;  1YKH B;  1H7C A;  5LGT B;  1OED A;  5L3G B;  5L4H A;  3K3N A;  2WN9 A;  5DQV A;  2XM2 A;  2W63 A;  2WU2 A;  2EHO C;  1L0V A;  1SUM B;  3CVR A;  4IE5 A;  2LSY A;  2WDQ A;  3ZC0 A;  3L8R A;  1DU2 A;  1S94 A;  3CK6 A;  3PUZ F;  2C5I T;  5FY7 A;  5LYJ E;  3F31 A;  2DCF A;  3BQI A;  5AFJ A;  5HWX A;  4AIS A;  4K0U A;  2IHR 1;  3N9O A;  3B5M A;  3GA8 A;  5IWA T;  2BZB A;  2FJE A;  2M67 A;  5HEG A;  2BBH A;  2VKH A;  2ZM0 A;  4TX5 A;  4YSX A;  4XK9 A;  3NVO A;  2UXD T;  2Y58 A;  4QH1 A;  2DHR A;  5L3C B;  4ZZB A;  4LF5 T;  2UU9 T;  1D0Y A;  1HR0 T;  4C90 A;  4WZX A;  2NW8 A;  4P09 A;  5CGM A;  3FHN A;  2NOX A;  2J62 A;  4FJO A;  3B57 A;  4AI6 A;  2JMK A;  5LXT E;  2FUP A;  2WSS V;  1UV6 A;  3CQC B;  4EZH A;  2XZ6 A;  2X0H A;  3SS1 A;  4MFR A;  2V7J A;  2QC1 B;  4HN9 A;  2BYQ A;  4UV9 B;  3AEC A;  3KV4 A;  3GN5 A;  4PK6 A;  5FXZ A;  3GUA A;  4HTE A;  2LEH A;  2P9B A;  4ZHQ E;  5AQR B;  4A98 A;  5E0O A;  5AQH B;  5CO5 A;  2W4X A;  5AFU L;  4XHE A;  2X0Y A;  2CCQ A;  2CXD A;  4D01 A;  4Q25 A;  2WS3 A;  2PJQ A;  3PUG A;  4O2B E;  4IIJ E;  2WCA A;  4FRR A;  2Y8D A;  5LP6 E;  3ZT7 A;  5C3J A;  4QHO A;  4AFG A;  3UFG A;  2D5U A;  4JI6 T;  3DTO A;  3ZT5 A;  3CPZ A;  4E7Z A;  3RIU A;  5CA0 E;  5HXS A;  4CI1 B;  3AE3 A;  4EV6 A;  2HPL A;  4X1I E;  4CN4 A;  4AXP A;  3RI5 A;  2WP9 A;  3WTO A;  4ILC A;  4KBM B;  4JI8 T;  3AE9 A;  2V6Y A;  2BDE A;  1VCS A;  2ES0 A;  4O4I E;  4MLK A;  4DR4 T;  4DBM A;  2VQF T;  2QVA A;  4O8S A;  5HEJ A;  3TLW A;  1VRB A;  2XAH B;  4UVC B;  1HX8 A;  2A2F X;  3MXZ A;  2XAG B;  4PFO A;  2Q9Q D;  4AKG A;  4BJN A;  3FBZ A;  1W09 A;  5FL1 A;  5LXB A;  4IE0 A;  4DBR A;  2WDV A;  2LLY A;  1KEY A;  3ZMS B;  3ZLI A;  4E7S A;  5DJQ C;  3Q5X A;  2JMH A;  4X65 T;  2XQ4 A;  4JYA T;  4OYK A;  4ZK4 A;  3FZM B;  4ISS A;  4EZ4 A;  4AQG A;  3M65 A;  4IE4 A;  4TNW A;  1QSD A;  2XJ7 A;  3RIF A;  2XNU A;  3WAJ A;  2WMN A;  4ILA A;  3TLT A;  2YKS A;  2E8I A;  4YY3 T;  4BQT A;  4WV9 A;  4ERR A;  5CFB A;  1OWA A;  1XMQ T;  3VU7 H;  1ZP0 A;  1CUN A;  1MMA A;  4TN7 B;  3MJX A;  2XNT A;  2DL1 A;  2W00 A;  3UU5 A;  4EZ1 A;  3A5X A;  4H9R C;  4ILB A;  4B3M T;  4X66 T;  5A1L A;  1ZOY A;  4UEM A;  4EYY R;  2W67 A;  2QA7 A;  4XBF B;  2V6X A;  2B76 A;  4NIQ A;  4I43 B;  5J5H A;  5ABH A;  4DR2 T;  5ABG A;  1M62 A;  2LT3 A;  2VB6 A;  4PJL A;  2HN2 A;  4I0U A;  4IL9 A;  5HXR A;  2XZ5 A;  2XQ3 A;  4GIW A;  1U5P A;  5CJ5 A;  2L9Q A;  1N34 T;  4DV1 T;  3H3M A;  3CKD A;  3RHW A;  3RGL A;  2OLT A;  5J0Z A;  4IL4 A;  4YLH A;  3PEO A;  3KV5 A;  2DI4 A;  5LCY A;  4CXW A;  1XNR T;  1HCI A;  1UK5 A;  3HKD E;  1BR4 A;  4PIR A;  3MK7 C;  1UUR A;  2KWH A;  3ABV A;  4B3T T;  2Y7Y A;  4ZRU A;  1D1B A;  2E9X B;  3AA1 B;  4QX8 B;  2ZMA A;  4U3C A;  2E2A A;  3IBP A;  2CRB A;  1G73 A;  2A72 A;  1UX4 A;  4QH5 A;  5FVL A;  3I0Q A;  3CX8 B;  3K8P C;  4DMV A;  3T4M A;  5ABF A;  2XAF B;  4CI3 B;  1BR0 A;  1UUS A;  4JUY A;  4CXY A;  3B13 A;  2H89 A;  2EHO A;  5L3E B;  4EYU A;  3FXE B;  3AE1 A;  3N9M A;  5JRC B;  4DV2 T;  4MHC A;  1MND A;  5EK4 A;  2KWI B;  1HG5 A;  2WQY A;  4ANJ A;  4WW0 A;  2LRK A;  4OHF A;  4GK5 E;  4HWD A;  2XAJ B;  2WU5 A;  5AQG B;  2UUC T;  3Q5E A;  3CX7 B;  2IUB A;  1IJ6 A;  3FZL B;  2KMF A;  1GQE A;  3PDY A;  1IBL T;  3PUW F;  4XZC A;  3RLF F;  5L3F B;  5JDL A;  1CHU A;  1US7 B;  5ADX L;  5AQO B;  2XQ6 A;  2LM2 A;  3HKE E;  1BR1 A;  1WRD A;  4GYS A;  2LJL A;  2BYP A;  1E2A A;  4G2A A;  4DV6 T;  3UUN A;  2MTQ A;  1LKX A;  2HPJ A;  5AQQ B;  3PUQ A;  4YTP A;  2J47 A;  3FZF B;  2E9X A;  2WY2 A;  4DMW A;  4DR6 T;  3ZMT B;  5FP3 A;  2XAS B;  5FVK A;  1AJ3 A;  4HGA A;  2OA5 A;  3C4Z A;  2QGS A;  5FNV E;  3J9X 1;  3ZMZ B;  4J2C A;  3EAB A;  3DJB A;  1JNR A;  2I59 A;  5L47 A;  2LOS A;  1LVF A;  2G0U A;  5L3D B;  5LB7 B;  2K9A A;  3JC6 D;  1ZEE A;  2CE7 A;  3JAF A;  5AQU B;  5LG4 A;  3WTI A;  5JTG A;  3N5L A;  2KLQ A;  2D0T A;  5H6Q B;  3O1H A;  1NEN A;  2BKP A;  3QB5 K;  5AFH A;  1V9D A;  3WTL A;  3EDU A;  2X00 A;  4NZB A;  1FIO A;  3PUR A;  3P4Q A;  1KF6 A;  1XMO T;  1HG2 A;  4KX6 A;  4U2Y A;  4IGU A;  5KE4 A;  4UM3 A;  3F2E A;  5F3J A;  5HEH A;  1MNE A;  4DND A;  2Z6E A;  3LDQ B;  2F4V T;  3HL6 A;  3QOF A;  3RIA A;  3AA6 B;  4H63 H;  3PV0 F;  4QAA A;  3ZC1 A;  3RKG A;  2DLR A;  4HKA A;  3JAD A;  4JV5 T;  2UZ6 A;  3ANW B;  3AEA A;  3A7M A;  4HWI B;  2BYN A;  3CIR A;  3E22 E;  4IDO A;  4CN6 A;  2K24 A;  5BP0 A;  1KK7 A;  4HWH A;  5LA6 E;  1YW0 A;  2VVN A;  4QKN A;  2M6I A;  2N2N A;  4WBO A;  3N2G E;  3JCF A;  5L2L A;  4B3S T;  5LMU T;  4L5G A;  4QH4 A;  1NWM X;  5JH7 E;  2MYS A;  5ABE A;  4X20 E;  3T1H T;  3EDV A;  2ODV A;  2BVM A;  3PUA A;  1T7S A;  2YU1 A;  2CWO A;  4JI2 T;  4H9P C;  1SHZ C;  5HCM A;  4KMC A;  2BKO A;  2NW7 A;  2BJ0 A;  3KV9 A;  3EI0 A;  2QRX A;  1T98 A;  4DV3 T;  2B1E A;  3OKQ A;  3HKB E;  3N2K E;  4Z90 A;  4TNV A;  4YSY A;  2WNL A;  1UGO A;  3WTK A;  3OJA A;  5ETW A;  3ZN0 B;  3QUJ A;  3UUB A;  2XSB A;  4UVB B;  2WZH A;  2LKG A;  2X0L B;  5LHG B;  5AQS B;  2ZJU A;  3S4U A;  3U8M A;  4B5D A;  2V7M A;  3T8O A;  3O9X A;  2PGZ A;  4YT0 A;  5JDN A;  2XSA A;  1MMG A;  3DP7 A;  4UXN B;  4DV7 T;  4LFB T;  3C79 A;  5LNK A;  3O4X E;  4U7I A;  3ZEF B;  4OK0 A;  4JBW F;  3AXJ A;  1YKE B;  3FZK B;  3A8Y C;  3RX6 A;  1UX5 A;  3KFW X;  4LF7 T;  3N9N A;  1XWM A;  1X79 A;  4PJM A;  1JNZ A;  1J1J A;  4C91 A;  5JDH A;  4EAH A;  2V7I A;  5AQL B;  3AVS A;  4LF4 T;  2UUA T;  3ONX A;  1J5W A;  2E9X C;  4A5X A;  4TV9 E;  4TUY E;  2V5D A;  5TAO A;  1FJG T;  2A9U A;  4LF9 T;  3ZCI A;  2MBG A;  2WNJ A;  3ZCJ A; 
#chains in the Genus database with same CATH homology
 2X00 A;  4NZB A;  3RI5 A;  4XK9 A;  3U8N A;  2XNV A;  3WTO A;  4ILC A;  3EI0 A;  2Y58 A;  3UQ4 A;  2YME A;  4QH1 A;  4HFC A;  3JAE A;  5KE4 A;  4UM3 A;  3SQ6 A;  4HQP A;  4ZK1 A;  4ZZB A;  3WIP A;  5HEH A;  4Z90 A;  4TNV A;  4TWF A;  3EAM A;  3SH1 A;  5J5I A;  5HEU A;  2WNL A;  3SQ9 A;  3C84 A;  3WTK A;  3SIO A;  1OED B;  4NPP A;  3U8L A;  3P50 A;  4HFD A;  3UU8 A;  5AFM B;  4ZZC A;  4AFT A;  5AFN A;  5J5H A;  3UUB A;  1OED C;  2XQA A;  2BG9 E;  2MAW A;  2PH9 A;  4DBM A;  2YMD A;  2Y56 A;  2LKG A;  1UV6 A;  5AFM A;  3RIA A;  2XQ6 A;  4HFI A;  4IL9 A;  2YOE A;  2LM2 A;  5HEJ A;  5L4E A;  3TLW A;  2XZ5 A;  4LML A;  2XZ6 A;  2ZJU A;  4UY2 A;  4QAA A;  3P4W A;  2XQ3 A;  2BYP A;  3U8M A;  5IUX A;  5FJV A;  4B5D A;  2QC1 B;  2BYQ A;  5JME A;  3JAD A;  2PGZ A;  3RHW A;  2BG9 B;  5LXB A;  5J0Z A;  2BR7 A;  2UZ6 A;  4ZR6 A;  4IL4 A;  4HFB A;  2C9T A;  3WTH A;  2BYN A;  3GUA A;  5J5F A;  3C79 A;  1UX2 A;  2XYS A;  5LG3 A;  3PEO A;  2LLY A;  4TWD A;  4LMK A;  4ZJS A;  1OED A;  4COF A;  4IRE A;  5L4H A;  5HCJ A;  3ZDH A;  3RQW A;  4A98 A;  2WN9 A;  4ZJT A;  2XQ8 A;  5AIN A;  5BP0 A;  4Z91 A;  4F8H A;  2BG9 A;  1OED E;  3UQ7 A;  2WZY A;  4QAC A;  2XQ4 A;  4PIR A;  2Y7Y A;  4LMJ A;  5CO5 A;  2WNC A;  4ZK4 A;  2M6I A;  4XHE A;  4ZRU A;  2XQ7 A;  4BFQ A;  5KZU A;  1I9B A;  2YN6 A;  3LSV A;  4D01 A;  2VL0 A;  2W8F A;  3EHZ A;  4TNW A;  3UU3 A;  4UXU A;  5SYO A;  4A97 A;  4UM3 S;  5AFK A;  2Y57 A;  3WTJ A;  3U8K A;  5L47 A;  3RIF A;  5J5G A;  3TLS A;  4QH5 A;  5BRX A;  5BW2 A;  4QH4 A;  2M6B A;  3IGQ A;  3UU4 A;  2XNU A;  4FRR A;  2KSR A;  4ILA A;  3TLT A;  2X00 D;  3WTM A;  2W8G A;  2YKS A;  2BYR A;  2XYT A;  3T4M A;  4UM1 A;  4AFH A;  3UU6 A;  4AFG A;  4BQT A;  3ZKR A;  4WV9 A;  3WTN A;  2ZJV A;  5CFB A;  3U8J A;  2BG9 C;  3RQU A;  4X5T A;  4HFH A;  3JAF A;  3TLU A;  5AFJ A;  3WTI A;  3TLV A;  2XQ5 A;  3ZDG A;  5AFL A;  4ALX A;  4TWH A;  5HEO A;  5HCM A;  4UM3 P;  2BJ0 A;  2BYS A;  2LKH A;  2XNT A;  5HEG A;  5TVC A;  2Y54 A;  3UU5 A;  4EZ1 A;  5AFH A;  2XQ9 A;  3WTL A;  4QAB A;  2BR8 A;  2WNJ A;  3PMZ A;  4ILB A;  1UW6 A;  4HFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...