3UU5A

The glic pentameric ligand-gated ion channel loop2-20' mutant reduced in solution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVECNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu5A01
4LMKA 4UXUA 3ZDHA 2YKSA 4HFIA 5AFKA 1UW6A 2XNVA 2XNTA 2Y57A 2QC1B 2BYSA 3RIAA 3PMZA 1OEDC 2YMDA 3UU8A 3U8NA 5HEUA 3RQWA 2ZJVA 5LXBA 4PIRA 2WNCA 2XZ6A 3WTMA 1UX2A 3T4MA 4HQPA 2LLYA 4ZZBA 3P4WA 3TLWA 4ZR6A 4TWDA 4UM3S 4BFQA 2W8GA 3C84A 5IUXA 3UQ7A 2BR7A 2PH9A 4UY2A 5AINA 5BP0A 3EAMA 2ZJUA 4HFCA 4FRRA 4QH4A 3TLTA 2LKHA 2UZ6A 4HFHA 2Y7YA 5L47A 5KE4A 3JAFA 4ZZCA 4F8HA 2WNLA 5J5GA 4AFGA 5AFMA 4UM3A 4QH1A 3ZKRA 4X5TA 3U8MA 4EZ1A 2WN9A 4HFEA 4NZBA 2BG9E 4DBMA 3WTIA 2Y56A 3U8KA 4UM3P 5J5IA 5BW2A 3UUBA 4WV9A 5BRXA 4XHEA 2Y58A 2BG9B 3U8LA 2XQ6A 5HEOA 2BYNA 3P50A 5HCJA 5LG3A 4ALXA 2XQ8A 5HEHA 1UV6A 3LSVA 5HEJA 2XQAA 5AFJA 2BR8A 2XQ4A 4Z90A 2VL0A 3UU4A 3ZDGA 4A97A 5HCMA 3TLUA 5AFLA 3JAEA 3WIPA 5CO5A 2X00A 3UU5A 4HFBA 4ILBA 4ILCA 3C79A 4D01A 2C9TA 3UQ4A 4QH5A 5FJVA 4Z91A 4ZK4A 4ZJSA 3U8JA 3SQ9A 4LMLA 3TLSA 3PEOA 4ZRUA 4COFA 1I9BA 3SQ6A 5TVCA 2YN6A 4A98A 2BG9C 4TWHA 3TLVA 3GUAA 4IL4A 3RQUA 4ILAA 2BJ0A 5J5FA 5L4EA 2Y54A 3WTHA 1OEDE 3RIFA 4IREA 3UU6A 2PGZA 4IL9A 4TWFA 2YMEA 5AFMB 2LM2A 4B5DA 2BYRA 4LMJA 3WTJA 3RHWA 5JMEA 5L4HA 3RI5A 2WNJA 2YOEA 2XNUA 5J5HA 3SIOA 4TNWA 5AFNA 2XQ3A 4TNVA 1OEDA 2LKGA 2W8FA 2X00D 3JADA 2XYTA 2M6IA 2BYPA 2XZ5A 4QACA 5CFBA 3SH1A 4QAAA 4BQTA 1OEDB 2WZYA 2XYSA 4AFTA 4UM1A 5HEGA 5SYOA 3WTNA 2XQ9A 2KSRA 2BYQA 4AFHA 4XK9A 4ZJTA 4NPPA 3UU3A 3WTOA 5KZUA 4HFDA 5AFHA 2MAWA 4QABA 4ZK1A 2XQ5A 3WTKA 5J0ZA 2M6BA 3WTLA 3EHZA 3EI0A 3IGQA 2XQ7A 2BG9A
chains in the Genus database with same CATH superfamily
2X0HA 4YT0A 3AE9A 4WZXA 3UTKA 2XNTA 1S35A 1JNZA 3RIAA 3RPUA 5LHIB 2DHRA 2CMRA 3UFGA 4AIUA 3DP7A 1FMWA 2W0GA 2JPFA 1VOMA 4UIGA 2ZJUA 4QH4A 2LKHA 3LK2B 2YK0A 5KE4A 2I6HA 5KXJA 2CXFA 1R8IA 3ZPOA 4NZBA 2R6GF 5HXHA 1IBLT 3UULA 3MACA 2VWAA 4QXCB 5JR9B 5ABFB 4UELA 4IE0A 2IIUA 1V9DA 2V1DB 3WIPA 1H7CA 4DV3T 3DJBA 2DCFA 2A3DA 3P7IA 4TX5A 4HN9A 3ZJ1A 2CM0A 4PJJA 2WAUA 1U5PA 4YHJA 3VKHA 3ONJA 2NW8A 3ZJ2A 3VU7H 3EDVA 3K8PC 4X1YE 3RF1A 3CVRA 5FY7A 5JRCB 3U3IA 4TV8E 2ZMAA 3BQLA 3WAKA 3UU3A 5JTGA 5AQPB 4YSYA 4KMCA 3WTLA 1D1CA 2HHHT 3OYXA 2E8IA 2BS2A 4LMKA 1HCIA 5LGUB 3EDUA 4BA9A 1XZYA 2I0MA 4O2AE 1X9BA 3UU8A 4KUMB 3P4WA 5JH7E 3O1IA 3AA7B 3BK9A 4CN4A 4CXXA 4XZCA 4U2ZA 1LVKA 1ZOYA 5JDLA 5F3JA 4WBNE 3ZCIA 4XHEA 4DR7T 5FXXA 3VHLA 5LJMA 4P0AA 2XQAA 3ZSTA 3ZDGA 3QB5A 3FZFB 5HXSA 2VL8A 4TWHA 4YTMA 4K0KT 4XAXB 1WYBA 4CI2B 2EHOB 3AAEB 2H89A 3CMLA 4DR4T 4EZ4A 1XWMA 5J5HA 2WS3A 1E2AA 2L3LA 5JVDE 5L3DB 2WMNA 4UVAB 2X66A 2MTQA 3QK6A 5HEGA 2LOPA 3C4WA 2BYQA 1HX8A 5LGNB 3MK7C 4B3MT 3NVOA 3RIUC 2V7MA 3LDQB 5LBQB 4ZS3A 5C2TA 2Y57A 2D5UA 2JIWA 3MZKB 4DV5T 5HEUA 5JDQA 4L5GA 1HNZT 2XM1A 4AQFC 3TKLB 2X9WA 4BFQA 4CZZB 3P4SA 2W67A 4G63A 4UEMA 4HFCA 4FRRA 3C64A 2Y7YA 2K5BB 3NZPA 4EZ1A 3NRXA 4EB6E 2Y58A 4CN6A 5JR9C 4ZEYA 4HWIB 2UUBT 3AVSA 4IGUA 2WZIA 4KBMB 3M3ZB 2E9XC 2YDRA 5DQVA 2WSSV 3H37A 1CHUA 5AQTB 5FXWA 4AKRB 3ZMTB 5J5FA 5LXTE 2VKDA 2YEVC 3KV5A 2F4VT 2LT3A 3EUHA 3SIOA 4MFRA 3N2OA 3AEFA 2G0UA 5ABHA 2MYSA 2CBIA 5HWYA 4AI6A 2E9XD 1Z8UA 2PTFA 2BG9A 2JQHA 4UXUA 1ZHCA 2CCQA 4ZXLA 3LFMA 2BZBA 3IHRA 2XZ6A 2UU9T 3TLWA 3CKDA 4ZR6A 5LGTB 3RYHE 2J1DG 2J4GA 1HS7A 3OYZA 5LA6E 3RYIE 4GK5E 2VQET 3FHNA 2VKJA 2IDOB 4QWNB 2CWYA 4X5TA 4YTPA 2BG9E 4FI5A 2P9BA 4EYUA 4JI5T 1IBMT 2IAKA 4TZ4C 5HEOA 3ONLC 3K1SA 2XQ8A 2XQYA 3LSVA 2KXPB 2WB5A 5BMVE 1QSDA 3ZLIA 1YD8G 4JBWF 2PFVA 2C0SA 1LKXA 2PBIA 3KVAA 5CA1E 5FJVA 3BQKA 4PNIA 4E7SA 4COFA 2LSKA 5HYAA 3WAJA 1UX4A 4OYKA 3RGLA 1E1HB 2CXLA 3Q5XA 4ZI3D 4YJ2E 4LMJA 2V7LA 2Y8DA 4ZS2A 2W00A 1OEDA 3UUMA 3ZEFB 3KV4A 2XASB 5J1GA 3EVYA 3CX6B 1M7KA 4YLHA 3Q9DA 5JDHA 2YU1A 3GWHA 2WCAA 5KZUA 1FIOA 1ZV4X 3CQXC 3K3OA 3OJAA 2V5CA 4HTEA 5AQGB 3FBLA 4UF0B 2W61A 1SA0E 3PUXF 2BBHA 3OTOT 3PMZA 5LCYA 3AE3A 4EOZB 5LOVE 3RQWA 3AAIA 5JQGE 1SHZC 4ASKA 2KNDA 3N9PA 4EGWA 4HWCA 3ZCJA 1D1BA 5CGMA 3SFEA 3U8MA 2QGSA 3PDYA 4ILUA 4DBMA 4MLKA 2BG9B 3UFEA 5AQLB 2IC6A 4U7IA 5HAXA 2E5LT 4MHCA 4O4LE 2UXDT 3TLUA 4D01A 1QLBA 3HR0A 2JRKA 3TLSA 1J5ET 5KMGP 3PUSA 4PJMA 4JEHB 2LHRA 5GONE 4QXBB 2ZLYA 4UV8B 2Z6EA 3WTJA 4EYYR 2XNUA 3CIRA 4CI1B 4QX8B 5HXEA 3PUGA 5CFBA 2HN2A 5JREA 1OEDB 2WZHA 4X64T 2E2AA 4AFTA 2KT9A 2DNXA 3WTNA 5AQMB 1WCRA 2HH7A 4YFSA 4DNDA 5AQKB 4JLEA 3RC8A 1HTJF 2BDEA 3AE2A 4HWFA 1AJ3A 2I59A 4UF0A 3PTRB 3NWIA 1UX2A 3T4MA 2XAFB 1D0YA 3WI3A 1WR0A 4MBQA 4X65T 4CXYA 1WYCA 4B3ST 2M67A 4ZZCA 4EZHA 4QH1A 2NOXA 4DO0A 1XNQT 2C5KT 2DLRA 2DWKA 3U8LA 3T8OA 1UURA 2JMKA 4Z90A 2VL0A 2L9QA 4A97A 2X00A 4M1PA 1VRBA 1WLXA 2LEHA 2NR4A 4C90A 4PK5A 5C3JA 3SQ6A 2XAGB 5KX5E 2V7JA 2CWOA 3ZC0A 2ZM0A 2LM2A 2D9DA 3KBUA 3RHWA 5L4HA 5L3GB 3ZMSB 2W8FA 4I43B 3E08A 4AKHA 4ISTA 1XNRT 2IUBA 4AFHA 2NW9A 5KDMC 5LMUT 3ETUA 4PFOA 2YDQA 5AQVB 3LK42 5FVKA 2BS3A 2MAWA 5FY1A 2XM2A 3EI0A 1HR0T 4AQGA 1FJGT 2XTLA 1ZEEA 4DUZT 3AB3B 4IT4A 4YSZA 2PJQA 5J2TE 2OLTA 2NP9A 2FBWA 3UQ7A 2X0LB 1T72A 1HF8A 3F31A 3CX8B 4DR6T 3ZKRA 3ZMVB 3BQIA 3RKOA 4LF8T 4WNKA 5J2UE 4NIQA 2V5DA 2H88A 3QB5K 4C91A 1Z0PA 4H9QC 3ETVA 5CO5A 3UU5A 4HFBA 3F2EA 4I55E 4WBOA 4ZJSA 3SQ9A 4BJNA 3LJCA 2YU2A 3MXZA 4U74A 2XHEB 5L2LA 3KDSE 4JI8T 4B3RT 2Y54A 4GIWA 3WTHA 3PUZF 3J9X1 4B5DA 3K3QC 3L39A 3G06A 2X00D 4L0RA 2XZ5A 5FVLA 2CEAA 1BR1A 1WFDA 2XAHB 1OWAA 3CQGB 3CX7B 1MMGA 5EK2A 2W2UA 2FJDA 2LHNA 5AQUB 2UUAT 5ABFA 3LK3B 4U31A 3ZDHA 3AA1B 5AFKA 3KV9A 4I50E 2VKHA 4PFPA 2BYSA 1VCSA 3UUXB 3GA8A 5FP3A 2A72A 1DU2A 3FZMB 3ZMUB 1UUSA 2NWBA 4TWDA 1XMQT 4I0UA 2LSYA 2UXXB 4P1NA 5AQHB 3Q5WA 4AXPA 3T1YT 1WR6A 4AFGA 2UXCT 4X1KE 3LBXB 2WNLA 3E0ZA 4UXNB 3C51A 2ODUA 3ZT5A 3C50A 3ZMZB 4HFEA 3P4QA 5J5IA 1CUNA 4E7ZA 3I0QA 4JI4T 5IYZE 5ABEA 4U33A 4ZI2D 1UV6A 2CLYB 4IDNA 4CN1A 5FL1A 5AFLA 2VK9A 4GKKT 4DV4T 2C9TA 4ERRA 4JI2T 1GQEA 4LMLA 4X66T 3GUAA 2JQ9A 2WY2A 4KX6A 5L4EA 3ZC1A 5ADXL 1N34T 5L3EB 3QOFA 3LBXA 1YW0A 2EHOD 4LFAT 4O4IE 4GYSA 4Q25A 2BKPA 2XPKA 3KFWX 4QACA 4YTNA 2D2SA 3OKQA 2OA5A 4XK9A 2WP9A 2KZ7B 4IDPA 4PW8A 2VKOA 2UUCT 2VASA 3JC6C 3FZHB 3SRZA 3ANWA 2ACZA 2Y48B 2QRXA 3HL6A 3HA4A 3B57A 3KVBA 2C5JA 4H9NC 3WTMA 3RYFE 2X9XA 4UR9A 2K3WA 1N32T 3PUYF 3PE0A 4YSXA 4X20E 1S94A 2UZ6A 4J2CA 5IWAT 3JAFA 4H63H 3O9XA 4KHZF 2WN9A 4WV9A 3P50A 3M65A 1YXRA 3FBZA 2BR8A 2XQ4A 5L3FB 4YY3T 3NBXX 1W9RA 3R6NA 3T1HT 3JAEA 2L8KA 2IC9A 3AAAB 4ZOLE 3PEOA 5DABA 3FXDB 3N2KE 4EEBA 2E9XA 1W0AA 1ZP0A 2BYRA 3MKDA 2HPJA 3HKDE 4JI3T 2QVAA 4TNVA 2LKGA 2BS4A 3QNUA 4O8SA 1X79A 3L3PA 4PJLA 1J5WA 3L8RA 4G2AA 4DMWA 1IBKT 3WTOA 3RLFF 1EZ3A 3FZKB 4QABA 4KP3C 4ZI7E 3A8YC 3PUWF 1N36T 3IGQA 2Y6XA 2WU2A 5FYMA 1QUUA 4LFBT 2YDSA 3S4UA 1JNRA 3CK6A 4DV1T 2SPCA 2KMFA 4DVDA 1FMVA 2BKNA 1LVFA 3RIUA 5FXZA 5AQNB 3N2GE 4ZHQE 3RC3A 3RRWA 4BAYB 5AINA 4UY2A 3OPCA 4HWHA 3EAMA 2FJEA 2QA7A 4F8HA 5J5GA 3KV6A 5TAOA 3MJXA 5FKYA 2W63A 5BRXA 3PJAJ 1XMOT 3AEGA 3PUQA 3ANWB 1MMNA 5C8YE 4ZI2C 3NRYA 3C79A 5FNVE 3ESLA 3ZN1B 1I9BA 4IL4A 4ILAA 5HWXA 4TV9E 3PURA 1E7PA 4IREA 2PGZA 1UGOA 4DUYT 5ABGA 2MOZA 4P09A 3RI5A 4FJOA 4OFZA 5EZYE 5JR9A 4IE5A 4TNWA 3JADA 2BYPA 2IHR1 4QKNA 4Z8XA 5EK3A 1KNRA 2XYSA 2WWVA 3AE5A 3MA9A 3N9MA 4IIJE 3FB2A 3IEEA 4NUVA 2XAJB 2WBLA 5AQOB 1SUMB 4IDOA 2XQ5A 4EAHA 2JQQA 1LRZA 1XDPA 2XQ7A 5AQRB 2B1EA 5IHYA 3AE7A 5JDGA 2CPTA 2VURA 2QC1B 3PV0F 1OEDC 3NKZA 2D0TA 3U8NA 5LXBA 3ONXA 2WNCA 4HWDA 2UXBT 4KI0F 4HQPA 4ADZA 2CE7A 3LG7A 2BR7A 2CRBA 2PH9A 2W62A 1NENA 1NEKA 4H9SE 5F5WA 3QUJA 2N1GA 3WTIA 4NXNT 1W09A 3UUBA 4JUYA 2XQ6A 5HCJA 3HKEE 1HX1B 5HEHA 4K0UA 2NTYA 3UU4A 4HFVA 2JMHA 2KWHA 1YQ4A 3RH3A 3QC9A 4ZK4A 4TN7B 1MNDA 4CXWA 1UK5A 2W66A 4GK0E 3L09A 4PK6A 5TVCA 4XBFB 5A1LA 2YN6A 3B5MA 2LSIA 3TLVA 1NWMX 3P4PA 5FXVA 2BJ0A 2CA5A 4JI7T 2GK9A 3AECA 2YMEA 3R84B 1YKEB 2WNJA 4JI0T 4DV6T 2XQ3A 2D0UA 4O4HE 4JI6T 2LRLA 2XZEA 2WZYA 2BVLA 2JQKA 3JC6D 4ZJTA 1UCUA 1YKHB 4ZI3C 2WDVA 1HG2A 3V5UA 5J0ZA 3J7Yq 2YKSA 4DR5T 4OYJA 3C4ZA 4QX7B 2N9DA 5LP6E 2PG8A 5AFUL 2XAQB 4UM3S 5CJ5A 2BKOA 5BP0A 3D0TA 4MALA 4DR1T 1IJ6A 3N9QA 3AXJB 3DTOA 4AISA 3A7MA 4AQYT 4PAGA 4ALXA 5HEJA 5AFJA 3B13A 4X1IE 5HCMA 1HNXT 3RX6A 3UQ4A 2RP4A 2IMLA 2W4XA 4LF5T 2NTXA 3AE8A 2HN1A 3AA0B 5JDFA 5HXRA 4TWFA 5JDMA 3AXJA 2LJLA 3ABVA 5H6QB 5JDNA 5JRCA 3K3NA 1KK7A 4X62T 2XSAA 1US7B 4TUYE 4QAAA 3CWZB 4IE4A 1XDOA 3ZT7A 3N9OA 5F8PA 3A5XA 4UVBB 3WTKA 3RRCA 2Q9QC 3O1HA 5LG4A 5AQQB 2X9HA 4AQFA 4PJNA 2ZM6T 1IAPA 2KLQA 2N2NA 5AQIB 4PIRA 1Y64B 5L3CB 3Q5DA 3N9LA 3I0OA 1O3XA 3CQCB 4YHHT 2V8SV 4LFCT 3C84A 2VB6A 3W15B 4L9IA 3TLTA 4EXTA 1T7SA 3HKBE 3SS1A 1KNZA 4LF4T 3P8CD 4B3TT 5AQSB 2K48A 3AE4A 1UX5A 5DQWA 2BYNA 2J47A 2V7KA 3SWHA 3KBTA 3GN5A 4ILCA 4Z91A 2EHOA 4ISSA 1B7TA 3I1AA 1MNEA 4ZRUA 3PUAA 1T8BA 3Q2MA 2WU5A 1J1JA 5FL0A 2B76A 3RQUA 4AKLA 3VR9A 1FEWA 3AE6A 1OEDE 1IJ5A 2V7IA 2QYWA 4B6XA 2CLYC 5M4YA 4IL9A 5CA0E 3AE1A 2XSBA 4U2YA 2LE8A 1W0BA 2M6IA 2C5IT 2JJ9A 4ANJA 2KWIB 3AEBA 4DV7T 5SYOA 2XQ9A 5AQJB 4NPPA 1MIYA 2HPLA 2FJBA 4LF6T 4O2BE 4EV6A 4O4JE 2ACXA 2AE9A 4NXMT 3FXEB 4V1Av 4JEUB 4QXHB 4HE8A 3GMIA 4ZZBA 2LSJA 4AKIA 4AKGA 2X9YA 3Q5EA 2XY8B 3IBPA 4UV9B 3ZYKA 2Q9QB 4GYRA 3PUVF 3I9YA 3OBVE 5DJQC 4HFHA 5L47A 2Q9QD 5AFMA 4UM3A 1BR2A 2X68A 4YXDA 1KEYA 4IHJE 2VQFT 2OV9A 2LSGA 2RPAA 1IZNB 1NAFA 2CHOA 3SOLA 2LM9A 5FMNA 2WDRA 1D0ZA 5LBMA 4H63V 4ILBA 3ZN0B 4BJMA 4WW0A 2WWUA 3GN5B 4HGAA 4UVCB 2DI4A 4A98A 1D0XA 3RKGA 1N33T 2XUEA 3I9WA 4DR2T 4DV2T 3N9NA 2EHOC 3RIFA 1D1AA 2MBGA 2KINB 4GOUA 5AFMB 2IW5B 4DIDB 3FZLB 5JMEA 3E22E 1YQ3A 2E9XB 2YOEA 3O1JA 4P0BA 2CHNA 3SH1A 3RYCE 2H7VC 1MMAA 4UM1A 3PU8A 3UUNA 3IF8B 4OHFA 5EK4A 2RA1A 2FUPA 4HFDA 4ZK1A 3EHZA 2LRKA 4F6RC 4DV0T 3OVUA 3PJAA 4HFIA 5BR8T 2VVNA 4I4TE 1UW6A 2XNVA 4U72A 2YMDA 3O4XE 1T98A 2FJAA 2X0YA 4JV5T 3EABA 2W8GA 5IUXA 1BR4A 2LOSA 2MPKA 5FY0A 2DL1A 2Q9QA 2K24A 2BVMA 2E5VA 5L3BB 3C98B 2Y56A 2BBJA 2CXDA 1KFYA 5LG3A 1VCTA 2J62A 2DWGA 3AEDA 4WYVA 4IDQA 4KHPT 4YJ3E 2ZM2A 4JYAT 5CB4E 3JCFA 1G73A 4QH5A 2V26A 3H3MA 4A5XA 2UXNB 2WM9A 1Y01A 1SE7A 3SFDA 2V6YB 4DMVA 5E0OA 3X1DA 3UU6A 2CBJA 4NUUA 4CQIA 5H6RB 3F57A 4LF9T 4DBRA 4HEAA 5AFNA 1HG5A 4U3CA 1U4QA 1ZKEA 1HNWT 3VKGA 2AXDS 4EEDA 2XYTA 2X51A 4EIWA 4CI3B 2A2FX 3C4XA 2WQYA 1MMDA 3PU3A 3ZSSA 4IE6A 3V5SA 5HXCA 3ZYLA 3CPZA 5LB7B 1M62A 5AFHA 1HFAA 3UT5E 4PK4A 4N78D 5LNKA 1L0VA 3KINB 3HI2A 4H9RC 2ZJVA 3N5LA 1WRDA 3VR8A 1MIWA 2LLYA 2ES0A 3NZQA 4QHOA 1I6ZA 1KNPA 4IE7A 5LHGB 4JI1T 3ZT6A 4IDZA 2ZM8A 3U8KA 4UM3P 3HKCE 5BW2A 3H3AA 5LMNT 2WMOA 1KF6A 3U78A 2ODVA 3VRAA 1BR0A 3U8JA 3VRBA 4LF7T 5LHHB 4HKAA 3IA3A 4GKJT 3AEAA 2BG9C 2H3RA 2X67A 4H9PC 2H7OA 4DR3T 2V6YA 4H9OC 1OXZA 2VVSA 5AQFB 5LYJE 1MIVA 1G8XA 2WDQA 4BQTA 4A56A 2V6XA 2XJ7A 5LJNA 4OK0A 4DBQA 2KSRA 5ETWA 3P4RA 3AVRA 2A9UA 3AA6B 4U7YA 2YINA 2M6BA 3ZYMA 1I94T 3AEEA 4OX9T 2NW7A 2K9AA
chains in the Genus database with same CATH topology
4LMKA 4UXUA 3ZDHA 2YKSA 4HFIA 5AFKA 1UW6A 2XNVA 2XNTA 2Y57A 2QC1B 2BYSA 3RIAA 3PMZA 1OEDC 2YMDA 3UU8A 3U8NA 5HEUA 3RQWA 2ZJVA 5LXBA 4PIRA 2WNCA 2XZ6A 3WTMA 1UX2A 3T4MA 4HQPA 2LLYA 4ZZBA 3P4WA 3TLWA 4ZR6A 4TWDA 4UM3S 4BFQA 2W8GA 3C84A 5IUXA 3UQ7A 2BR7A 2PH9A 4UY2A 5AINA 5BP0A 3EAMA 2ZJUA 4HFCA 4FRRA 4QH4A 3TLTA 2LKHA 2UZ6A 4HFHA 2Y7YA 5L47A 5KE4A 3JAFA 4ZZCA 4F8HA 2WNLA 5J5GA 4AFGA 5AFMA 4UM3A 4QH1A 3ZKRA 4X5TA 3U8MA 4EZ1A 2WN9A 4HFEA 4NZBA 2BG9E 4DBMA 3WTIA 2Y56A 3U8KA 4UM3P 5J5IA 5BW2A 3UUBA 4WV9A 5BRXA 4XHEA 2Y58A 2BG9B 3U8LA 2XQ6A 5HEOA 2BYNA 3P50A 5HCJA 5LG3A 4ALXA 2XQ8A 5HEHA 1UV6A 3LSVA 5HEJA 2XQAA 5AFJA 2BR8A 2XQ4A 4Z90A 2VL0A 3UU4A 3ZDGA 4A97A 5HCMA 3TLUA 5AFLA 3JAEA 3WIPA 5CO5A 2X00A 3UU5A 4HFBA 4ILBA 4ILCA 3C79A 4D01A 2C9TA 3UQ4A 4QH5A 5FJVA 4Z91A 4ZK4A 4ZJSA 3U8JA 3SQ9A 4LMLA 3TLSA 3PEOA 4ZRUA 4COFA 1I9BA 3SQ6A 5TVCA 2YN6A 4A98A 2BG9C 4TWHA 3TLVA 3GUAA 4IL4A 3RQUA 4ILAA 2BJ0A 5J5FA 5L4EA 2Y54A 3WTHA 1OEDE 3RIFA 4IREA 3UU6A 2PGZA 4IL9A 4TWFA 2YMEA 5AFMB 2LM2A 4B5DA 2BYRA 4LMJA 3WTJA 3RHWA 5JMEA 5L4HA 3RI5A 2WNJA 2YOEA 2XNUA 5J5HA 3SIOA 4TNWA 5AFNA 2XQ3A 4TNVA 1OEDA 2LKGA 2W8FA 2X00D 3JADA 2XYTA 2M6IA 2BYPA 2XZ5A 4QACA 5CFBA 3SH1A 4QAAA 4BQTA 1OEDB 2WZYA 2XYSA 4AFTA 4UM1A 5HEGA 5SYOA 3WTNA 2XQ9A 2KSRA 2BYQA 4AFHA 4XK9A 4ZJTA 4NPPA 3UU3A 3WTOA 5KZUA 4HFDA 5AFHA 2MAWA 4QABA 4ZK1A 2XQ5A 3WTKA 5J0ZA 2M6BA 3WTLA 3EHZA 3EI0A 3IGQA 2XQ7A 2BG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMK A;  4UXU A;  3ZDH A;  2YKS A;  4HFI A;  5AFK A;  1UW6 A;  2XNV A;  2XNT A;  2Y57 A;  2QC1 B;  2BYS A;  3RIA A;  3PMZ A;  1OED C;  2YMD A;  3UU8 A;  3U8N A;  5HEU A;  3RQW A;  2ZJV A;  5LXB A;  4PIR A;  2WNC A;  2XZ6 A;  3WTM A;  1UX2 A;  3T4M A;  4HQP A;  2LLY A;  4ZZB A;  3P4W A;  3TLW A;  4ZR6 A;  4TWD A;  4UM3 S;  4BFQ A;  2W8G A;  3C84 A;  5IUX A;  3UQ7 A;  2BR7 A;  2PH9 A;  4UY2 A;  5AIN A;  5BP0 A;  3EAM A;  2ZJU A;  4HFC A;  4FRR A;  4QH4 A;  3TLT A;  2LKH A;  2UZ6 A;  4HFH A;  2Y7Y A;  5L47 A;  5KE4 A;  3JAF A;  4ZZC A;  4F8H A;  2WNL A;  5J5G A;  4AFG A;  5AFM A;  4UM3 A;  4QH1 A;  3ZKR A;  4X5T A;  3U8M A;  4EZ1 A;  2WN9 A;  4HFE A;  4NZB A;  2BG9 E;  4DBM A;  3WTI A;  2Y56 A;  3U8K A;  4UM3 P;  5J5I A;  5BW2 A;  3UUB A;  4WV9 A;  5BRX A;  4XHE A;  2Y58 A;  2BG9 B;  3U8L A;  2XQ6 A;  5HEO A;  2BYN A;  3P50 A;  5HCJ A;  5LG3 A;  4ALX A;  2XQ8 A;  5HEH A;  1UV6 A;  3LSV A;  5HEJ A;  2XQA A;  5AFJ A;  2BR8 A;  2XQ4 A;  4Z90 A;  2VL0 A;  3UU4 A;  3ZDG A;  4A97 A;  5HCM A;  3TLU A;  5AFL A;  3JAE A;  3WIP A;  5CO5 A;  2X00 A;  3UU5 A;  4HFB A;  4ILB A;  4ILC A;  3C79 A;  4D01 A;  2C9T A;  3UQ4 A;  4QH5 A;  5FJV A;  4Z91 A;  4ZK4 A;  4ZJS A;  3U8J A;  3SQ9 A;  4LML A;  3TLS A;  3PEO A;  4ZRU A;  4COF A;  1I9B A;  3SQ6 A;  5TVC A;  2YN6 A;  4A98 A;  2BG9 C;  4TWH A;  3TLV A;  3GUA A;  4IL4 A;  3RQU A;  4ILA A;  2BJ0 A;  5J5F A;  5L4E A;  2Y54 A;  3WTH A;  1OED E;  3RIF A;  4IRE A;  3UU6 A;  2PGZ A;  4IL9 A;  4TWF A;  2YME A;  5AFM B;  2LM2 A;  4B5D A;  2BYR A;  4LMJ A;  3WTJ A;  3RHW A;  5JME A;  5L4H A;  3RI5 A;  2WNJ A;  2YOE A;  2XNU A;  5J5H A;  3SIO A;  4TNW A;  5AFN A;  2XQ3 A;  4TNV A;  1OED A;  2LKG A;  2W8F A;  2X00 D;  3JAD A;  2XYT A;  2M6I A;  2BYP A;  2XZ5 A;  4QAC A;  5CFB A;  3SH1 A;  4QAA A;  4BQT A;  1OED B;  2WZY A;  2XYS A;  4AFT A;  4UM1 A;  5HEG A;  5SYO A;  3WTN A;  2XQ9 A;  2KSR A;  2BYQ A;  4AFH A;  4XK9 A;  4ZJT A;  4NPP A;  3UU3 A;  3WTO A;  5KZU A;  4HFD A;  5AFH A;  2MAW A;  4QAB A;  4ZK1 A;  2XQ5 A;  3WTK A;  5J0Z A;  2M6B A;  3WTL A;  3EHZ A;  3EI0 A;  3IGQ A;  2XQ7 A;  2BG9 A; 
#chains in the Genus database with same CATH topology
 2X0H A;  4YT0 A;  3AE9 A;  4WZX A;  3UTK A;  2XNT A;  1S35 A;  1JNZ A;  3RIA A;  3RPU A;  5LHI B;  2DHR A;  2CMR A;  3UFG A;  4AIU A;  3DP7 A;  1FMW A;  2W0G A;  2JPF A;  1VOM A;  4UIG A;  2ZJU A;  4QH4 A;  2LKH A;  3LK2 B;  2YK0 A;  5KE4 A;  2I6H A;  5KXJ A;  2CXF A;  1R8I A;  3ZPO A;  4NZB A;  2R6G F;  5HXH A;  1IBL T;  3UUL A;  3MAC A;  2VWA A;  4QXC B;  5JR9 B;  5ABF B;  4UEL A;  4IE0 A;  2IIU A;  1V9D A;  2V1D B;  3WIP A;  1H7C A;  4DV3 T;  3DJB A;  2DCF A;  2A3D A;  3P7I A;  4TX5 A;  4HN9 A;  3ZJ1 A;  2CM0 A;  4PJJ A;  2WAU A;  1U5P A;  4YHJ A;  3VKH A;  3ONJ A;  2NW8 A;  3ZJ2 A;  3VU7 H;  3EDV A;  3K8P C;  4X1Y E;  3RF1 A;  3CVR A;  5FY7 A;  5JRC B;  3U3I A;  4TV8 E;  2ZMA A;  3BQL A;  3WAK A;  3UU3 A;  5JTG A;  5AQP B;  4YSY A;  4KMC A;  3WTL A;  1D1C A;  2HHH T;  3OYX A;  2E8I A;  2BS2 A;  4LMK A;  1HCI A;  5LGU B;  3EDU A;  4BA9 A;  1XZY A;  2I0M A;  4O2A E;  1X9B A;  3UU8 A;  4KUM B;  3P4W A;  5JH7 E;  3O1I A;  3AA7 B;  3BK9 A;  4CN4 A;  4CXX A;  4XZC A;  4U2Z A;  1LVK A;  1ZOY A;  5JDL A;  5F3J A;  4WBN E;  3ZCI A;  4XHE A;  4DR7 T;  5FXX A;  3VHL A;  5LJM A;  4P0A A;  2XQA A;  3ZST A;  3ZDG A;  3QB5 A;  3FZF B;  5HXS A;  2VL8 A;  4TWH A;  4YTM A;  4K0K T;  4XAX B;  1WYB A;  4CI2 B;  2EHO B;  3AAE B;  2H89 A;  3CML A;  4DR4 T;  4EZ4 A;  1XWM A;  5J5H A;  2WS3 A;  1E2A A;  2L3L A;  5JVD E;  5L3D B;  2WMN A;  4UVA B;  2X66 A;  2MTQ A;  3QK6 A;  5HEG A;  2LOP A;  3C4W A;  2BYQ A;  1HX8 A;  5LGN B;  3MK7 C;  4B3M T;  3NVO A;  3RIU C;  2V7M A;  3LDQ B;  5LBQ B;  4ZS3 A;  5C2T A;  2Y57 A;  2D5U A;  2JIW A;  3MZK B;  4DV5 T;  5HEU A;  5JDQ A;  4L5G A;  1HNZ T;  2XM1 A;  4AQF C;  3TKL B;  2X9W A;  4BFQ A;  4CZZ B;  3P4S A;  2W67 A;  4G63 A;  4UEM A;  4HFC A;  4FRR A;  3C64 A;  2Y7Y A;  2K5B B;  3NZP A;  4EZ1 A;  3NRX A;  4EB6 E;  2Y58 A;  4CN6 A;  5JR9 C;  4ZEY A;  4HWI B;  2UUB T;  3AVS A;  4IGU A;  2WZI A;  4KBM B;  3M3Z B;  2E9X C;  2YDR A;  5DQV A;  2WSS V;  3H37 A;  1CHU A;  5AQT B;  5FXW A;  4AKR B;  3ZMT B;  5J5F A;  5LXT E;  2VKD A;  2YEV C;  3KV5 A;  2F4V T;  2LT3 A;  3EUH A;  3SIO A;  4MFR A;  3N2O A;  3AEF A;  2G0U A;  5ABH A;  2MYS A;  2CBI A;  5HWY A;  4AI6 A;  2E9X D;  1Z8U A;  2PTF A;  2BG9 A;  2JQH A;  4UXU A;  1ZHC A;  2CCQ A;  4ZXL A;  3LFM A;  2BZB A;  3IHR A;  2XZ6 A;  2UU9 T;  3TLW A;  3CKD A;  4ZR6 A;  5LGT B;  3RYH E;  2J1D G;  2J4G A;  1HS7 A;  3OYZ A;  5LA6 E;  3RYI E;  4GK5 E;  2VQE T;  3FHN A;  2VKJ A;  2IDO B;  4QWN B;  2CWY A;  4X5T A;  4YTP A;  2BG9 E;  4FI5 A;  2P9B A;  4EYU A;  4JI5 T;  1IBM T;  2IAK A;  4TZ4 C;  5HEO A;  3ONL C;  3K1S A;  2XQ8 A;  2XQY A;  3LSV A;  2KXP B;  2WB5 A;  5BMV E;  1QSD A;  3ZLI A;  1YD8 G;  4JBW F;  2PFV A;  2C0S A;  1LKX A;  2PBI A;  3KVA A;  5CA1 E;  5FJV A;  3BQK A;  4PNI A;  4E7S A;  4COF A;  2LSK A;  5HYA A;  3WAJ A;  1UX4 A;  4OYK A;  3RGL A;  1E1H B;  2CXL A;  3Q5X A;  4ZI3 D;  4YJ2 E;  4LMJ A;  2V7L A;  2Y8D A;  4ZS2 A;  2W00 A;  1OED A;  3UUM A;  3ZEF B;  3KV4 A;  2XAS B;  5J1G A;  3EVY A;  3CX6 B;  1M7K A;  4YLH A;  3Q9D A;  5JDH A;  2YU1 A;  3GWH A;  2WCA A;  5KZU A;  1FIO A;  1ZV4 X;  3CQX C;  3K3O A;  3OJA A;  2V5C A;  4HTE A;  5AQG B;  3FBL A;  4UF0 B;  2W61 A;  1SA0 E;  3PUX F;  2BBH A;  3OTO T;  3PMZ A;  5LCY A;  3AE3 A;  4EOZ B;  5LOV E;  3RQW A;  3AAI A;  5JQG E;  1SHZ C;  4ASK A;  2KND A;  3N9P A;  4EGW A;  4HWC A;  3ZCJ A;  1D1B A;  5CGM A;  3SFE A;  3U8M A;  2QGS A;  3PDY A;  4ILU A;  4DBM A;  4MLK A;  2BG9 B;  3UFE A;  5AQL B;  2IC6 A;  4U7I A;  5HAX A;  2E5L T;  4MHC A;  4O4L E;  2UXD T;  3TLU A;  4D01 A;  1QLB A;  3HR0 A;  2JRK A;  3TLS A;  1J5E T;  5KMG P;  3PUS A;  4PJM A;  4JEH B;  2LHR A;  5GON E;  4QXB B;  2ZLY A;  4UV8 B;  2Z6E A;  3WTJ A;  4EYY R;  2XNU A;  3CIR A;  4CI1 B;  4QX8 B;  5HXE A;  3PUG A;  5CFB A;  2HN2 A;  5JRE A;  1OED B;  2WZH A;  4X64 T;  2E2A A;  4AFT A;  2KT9 A;  2DNX A;  3WTN A;  5AQM B;  1WCR A;  2HH7 A;  4YFS A;  4DND A;  5AQK B;  4JLE A;  3RC8 A;  1HTJ F;  2BDE A;  3AE2 A;  4HWF A;  1AJ3 A;  2I59 A;  4UF0 A;  3PTR B;  3NWI A;  1UX2 A;  3T4M A;  2XAF B;  1D0Y A;  3WI3 A;  1WR0 A;  4MBQ A;  4X65 T;  4CXY A;  1WYC A;  4B3S T;  2M67 A;  4ZZC A;  4EZH A;  4QH1 A;  2NOX A;  4DO0 A;  1XNQ T;  2C5K T;  2DLR A;  2DWK A;  3U8L A;  3T8O A;  1UUR A;  2JMK A;  4Z90 A;  2VL0 A;  2L9Q A;  4A97 A;  2X00 A;  4M1P A;  1VRB A;  1WLX A;  2LEH A;  2NR4 A;  4C90 A;  4PK5 A;  5C3J A;  3SQ6 A;  2XAG B;  5KX5 E;  2V7J A;  2CWO A;  3ZC0 A;  2ZM0 A;  2LM2 A;  2D9D A;  3KBU A;  3RHW A;  5L4H A;  5L3G B;  3ZMS B;  2W8F A;  4I43 B;  3E08 A;  4AKH A;  4IST A;  1XNR T;  2IUB A;  4AFH A;  2NW9 A;  5KDM C;  5LMU T;  3ETU A;  4PFO A;  2YDQ A;  5AQV B;  3LK4 2;  5FVK A;  2BS3 A;  2MAW A;  5FY1 A;  2XM2 A;  3EI0 A;  1HR0 T;  4AQG A;  1FJG T;  2XTL A;  1ZEE A;  4DUZ T;  3AB3 B;  4IT4 A;  4YSZ A;  2PJQ A;  5J2T E;  2OLT A;  2NP9 A;  2FBW A;  3UQ7 A;  2X0L B;  1T72 A;  1HF8 A;  3F31 A;  3CX8 B;  4DR6 T;  3ZKR A;  3ZMV B;  3BQI A;  3RKO A;  4LF8 T;  4WNK A;  5J2U E;  4NIQ A;  2V5D A;  2H88 A;  3QB5 K;  4C91 A;  1Z0P A;  4H9Q C;  3ETV A;  5CO5 A;  3UU5 A;  4HFB A;  3F2E A;  4I55 E;  4WBO A;  4ZJS A;  3SQ9 A;  4BJN A;  3LJC A;  2YU2 A;  3MXZ A;  4U74 A;  2XHE B;  5L2L A;  3KDS E;  4JI8 T;  4B3R T;  2Y54 A;  4GIW A;  3WTH A;  3PUZ F;  3J9X 1;  4B5D A;  3K3Q C;  3L39 A;  3G06 A;  2X00 D;  4L0R A;  2XZ5 A;  5FVL A;  2CEA A;  1BR1 A;  1WFD A;  2XAH B;  1OWA A;  3CQG B;  3CX7 B;  1MMG A;  5EK2 A;  2W2U A;  2FJD A;  2LHN A;  5AQU B;  2UUA T;  5ABF A;  3LK3 B;  4U31 A;  3ZDH A;  3AA1 B;  5AFK A;  3KV9 A;  4I50 E;  2VKH A;  4PFP A;  2BYS A;  1VCS A;  3UUX B;  3GA8 A;  5FP3 A;  2A72 A;  1DU2 A;  3FZM B;  3ZMU B;  1UUS A;  2NWB A;  4TWD A;  1XMQ T;  4I0U A;  2LSY A;  2UXX B;  4P1N A;  5AQH B;  3Q5W A;  4AXP A;  3T1Y T;  1WR6 A;  4AFG A;  2UXC T;  4X1K E;  3LBX B;  2WNL A;  3E0Z A;  4UXN B;  3C51 A;  2ODU A;  3ZT5 A;  3C50 A;  3ZMZ B;  4HFE A;  3P4Q A;  5J5I A;  1CUN A;  4E7Z A;  3I0Q A;  4JI4 T;  5IYZ E;  5ABE A;  4U33 A;  4ZI2 D;  1UV6 A;  2CLY B;  4IDN A;  4CN1 A;  5FL1 A;  5AFL A;  2VK9 A;  4GKK T;  4DV4 T;  2C9T A;  4ERR A;  4JI2 T;  1GQE A;  4LML A;  4X66 T;  3GUA A;  2JQ9 A;  2WY2 A;  4KX6 A;  5L4E A;  3ZC1 A;  5ADX L;  1N34 T;  5L3E B;  3QOF A;  3LBX A;  1YW0 A;  2EHO D;  4LFA T;  4O4I E;  4GYS A;  4Q25 A;  2BKP A;  2XPK A;  3KFW X;  4QAC A;  4YTN A;  2D2S A;  3OKQ A;  2OA5 A;  4XK9 A;  2WP9 A;  2KZ7 B;  4IDP A;  4PW8 A;  2VKO A;  2UUC T;  2VAS A;  3JC6 C;  3FZH B;  3SRZ A;  3ANW A;  2ACZ A;  2Y48 B;  2QRX A;  3HL6 A;  3HA4 A;  3B57 A;  3KVB A;  2C5J A;  4H9N C;  3WTM A;  3RYF E;  2X9X A;  4UR9 A;  2K3W A;  1N32 T;  3PUY F;  3PE0 A;  4YSX A;  4X20 E;  1S94 A;  2UZ6 A;  4J2C A;  5IWA T;  3JAF A;  4H63 H;  3O9X A;  4KHZ F;  2WN9 A;  4WV9 A;  3P50 A;  3M65 A;  1YXR A;  3FBZ A;  2BR8 A;  2XQ4 A;  5L3F B;  4YY3 T;  3NBX X;  1W9R A;  3R6N A;  3T1H T;  3JAE A;  2L8K A;  2IC9 A;  3AAA B;  4ZOL E;  3PEO A;  5DAB A;  3FXD B;  3N2K E;  4EEB A;  2E9X A;  1W0A A;  1ZP0 A;  2BYR A;  3MKD A;  2HPJ A;  3HKD E;  4JI3 T;  2QVA A;  4TNV A;  2LKG A;  2BS4 A;  3QNU A;  4O8S A;  1X79 A;  3L3P A;  4PJL A;  1J5W A;  3L8R A;  4G2A A;  4DMW A;  1IBK T;  3WTO A;  3RLF F;  1EZ3 A;  3FZK B;  4QAB A;  4KP3 C;  4ZI7 E;  3A8Y C;  3PUW F;  1N36 T;  3IGQ A;  2Y6X A;  2WU2 A;  5FYM A;  1QUU A;  4LFB T;  2YDS A;  3S4U A;  1JNR A;  3CK6 A;  4DV1 T;  2SPC A;  2KMF A;  4DVD A;  1FMV A;  2BKN A;  1LVF A;  3RIU A;  5FXZ A;  5AQN B;  3N2G E;  4ZHQ E;  3RC3 A;  3RRW A;  4BAY B;  5AIN A;  4UY2 A;  3OPC A;  4HWH A;  3EAM A;  2FJE A;  2QA7 A;  4F8H A;  5J5G A;  3KV6 A;  5TAO A;  3MJX A;  5FKY A;  2W63 A;  5BRX A;  3PJA J;  1XMO T;  3AEG A;  3PUQ A;  3ANW B;  1MMN A;  5C8Y E;  4ZI2 C;  3NRY A;  3C79 A;  5FNV E;  3ESL A;  3ZN1 B;  1I9B A;  4IL4 A;  4ILA A;  5HWX A;  4TV9 E;  3PUR A;  1E7P A;  4IRE A;  2PGZ A;  1UGO A;  4DUY T;  5ABG A;  2MOZ A;  4P09 A;  3RI5 A;  4FJO A;  4OFZ A;  5EZY E;  5JR9 A;  4IE5 A;  4TNW A;  3JAD A;  2BYP A;  2IHR 1;  4QKN A;  4Z8X A;  5EK3 A;  1KNR A;  2XYS A;  2WWV A;  3AE5 A;  3MA9 A;  3N9M A;  4IIJ E;  3FB2 A;  3IEE A;  4NUV A;  2XAJ B;  2WBL A;  5AQO B;  1SUM B;  4IDO A;  2XQ5 A;  4EAH A;  2JQQ A;  1LRZ A;  1XDP A;  2XQ7 A;  5AQR B;  2B1E A;  5IHY A;  3AE7 A;  5JDG A;  2CPT A;  2VUR A;  2QC1 B;  3PV0 F;  1OED C;  3NKZ A;  2D0T A;  3U8N A;  5LXB A;  3ONX A;  2WNC A;  4HWD A;  2UXB T;  4KI0 F;  4HQP A;  4ADZ A;  2CE7 A;  3LG7 A;  2BR7 A;  2CRB A;  2PH9 A;  2W62 A;  1NEN A;  1NEK A;  4H9S E;  5F5W A;  3QUJ A;  2N1G A;  3WTI A;  4NXN T;  1W09 A;  3UUB A;  4JUY A;  2XQ6 A;  5HCJ A;  3HKE E;  1HX1 B;  5HEH A;  4K0U A;  2NTY A;  3UU4 A;  4HFV A;  2JMH A;  2KWH A;  1YQ4 A;  3RH3 A;  3QC9 A;  4ZK4 A;  4TN7 B;  1MND A;  4CXW A;  1UK5 A;  2W66 A;  4GK0 E;  3L09 A;  4PK6 A;  5TVC A;  4XBF B;  5A1L A;  2YN6 A;  3B5M A;  2LSI A;  3TLV A;  1NWM X;  3P4P A;  5FXV A;  2BJ0 A;  2CA5 A;  4JI7 T;  2GK9 A;  3AEC A;  2YME A;  3R84 B;  1YKE B;  2WNJ A;  4JI0 T;  4DV6 T;  2XQ3 A;  2D0U A;  4O4H E;  4JI6 T;  2LRL A;  2XZE A;  2WZY A;  2BVL A;  2JQK A;  3JC6 D;  4ZJT A;  1UCU A;  1YKH B;  4ZI3 C;  2WDV A;  1HG2 A;  3V5U A;  5J0Z A;  3J7Y q;  2YKS A;  4DR5 T;  4OYJ A;  3C4Z A;  4QX7 B;  2N9D A;  5LP6 E;  2PG8 A;  5AFU L;  2XAQ B;  4UM3 S;  5CJ5 A;  2BKO A;  5BP0 A;  3D0T A;  4MAL A;  4DR1 T;  1IJ6 A;  3N9Q A;  3AXJ B;  3DTO A;  4AIS A;  3A7M A;  4AQY T;  4PAG A;  4ALX A;  5HEJ A;  5AFJ A;  3B13 A;  4X1I E;  5HCM A;  1HNX T;  3RX6 A;  3UQ4 A;  2RP4 A;  2IML A;  2W4X A;  4LF5 T;  2NTX A;  3AE8 A;  2HN1 A;  3AA0 B;  5JDF A;  5HXR A;  4TWF A;  5JDM A;  3AXJ A;  2LJL A;  3ABV A;  5H6Q B;  5JDN A;  5JRC A;  3K3N A;  1KK7 A;  4X62 T;  2XSA A;  1US7 B;  4TUY E;  4QAA A;  3CWZ B;  4IE4 A;  1XDO A;  3ZT7 A;  3N9O A;  5F8P A;  3A5X A;  4UVB B;  3WTK A;  3RRC A;  2Q9Q C;  3O1H A;  5LG4 A;  5AQQ B;  2X9H A;  4AQF A;  4PJN A;  2ZM6 T;  1IAP A;  2KLQ A;  2N2N A;  5AQI B;  4PIR A;  1Y64 B;  5L3C B;  3Q5D A;  3N9L A;  3I0O A;  1O3X A;  3CQC B;  4YHH T;  2V8S V;  4LFC T;  3C84 A;  2VB6 A;  3W15 B;  4L9I A;  3TLT A;  4EXT A;  1T7S A;  3HKB E;  3SS1 A;  1KNZ A;  4LF4 T;  3P8C D;  4B3T T;  5AQS B;  2K48 A;  3AE4 A;  1UX5 A;  5DQW A;  2BYN A;  2J47 A;  2V7K A;  3SWH A;  3KBT A;  3GN5 A;  4ILC A;  4Z91 A;  2EHO A;  4ISS A;  1B7T A;  3I1A A;  1MNE A;  4ZRU A;  3PUA A;  1T8B A;  3Q2M A;  2WU5 A;  1J1J A;  5FL0 A;  2B76 A;  3RQU A;  4AKL A;  3VR9 A;  1FEW A;  3AE6 A;  1OED E;  1IJ5 A;  2V7I A;  2QYW A;  4B6X A;  2CLY C;  5M4Y A;  4IL9 A;  5CA0 E;  3AE1 A;  2XSB A;  4U2Y A;  2LE8 A;  1W0B A;  2M6I A;  2C5I T;  2JJ9 A;  4ANJ A;  2KWI B;  3AEB A;  4DV7 T;  5SYO A;  2XQ9 A;  5AQJ B;  4NPP A;  1MIY A;  2HPL A;  2FJB A;  4LF6 T;  4O2B E;  4EV6 A;  4O4J E;  2ACX A;  2AE9 A;  4NXM T;  3FXE B;  4V1A v;  4JEU B;  4QXH B;  4HE8 A;  3GMI A;  4ZZB A;  2LSJ A;  4AKI A;  4AKG A;  2X9Y A;  3Q5E A;  2XY8 B;  3IBP A;  4UV9 B;  3ZYK A;  2Q9Q B;  4GYR A;  3PUV F;  3I9Y A;  3OBV E;  5DJQ C;  4HFH A;  5L47 A;  2Q9Q D;  5AFM A;  4UM3 A;  1BR2 A;  2X68 A;  4YXD A;  1KEY A;  4IHJ E;  2VQF T;  2OV9 A;  2LSG A;  2RPA A;  1IZN B;  1NAF A;  2CHO A;  3SOL A;  2LM9 A;  5FMN A;  2WDR A;  1D0Z A;  5LBM A;  4H63 V;  4ILB A;  3ZN0 B;  4BJM A;  4WW0 A;  2WWU A;  3GN5 B;  4HGA A;  4UVC B;  2DI4 A;  4A98 A;  1D0X A;  3RKG A;  1N33 T;  2XUE A;  3I9W A;  4DR2 T;  4DV2 T;  3N9N A;  2EHO C;  3RIF A;  1D1A A;  2MBG A;  2KIN B;  4GOU A;  5AFM B;  2IW5 B;  4DID B;  3FZL B;  5JME A;  3E22 E;  1YQ3 A;  2E9X B;  2YOE A;  3O1J A;  4P0B A;  2CHN A;  3SH1 A;  3RYC E;  2H7V C;  1MMA A;  4UM1 A;  3PU8 A;  3UUN A;  3IF8 B;  4OHF A;  5EK4 A;  2RA1 A;  2FUP A;  4HFD A;  4ZK1 A;  3EHZ A;  2LRK A;  4F6R C;  4DV0 T;  3OVU A;  3PJA A;  4HFI A;  5BR8 T;  2VVN A;  4I4T E;  1UW6 A;  2XNV A;  4U72 A;  2YMD A;  3O4X E;  1T98 A;  2FJA A;  2X0Y A;  4JV5 T;  3EAB A;  2W8G A;  5IUX A;  1BR4 A;  2LOS A;  2MPK A;  5FY0 A;  2DL1 A;  2Q9Q A;  2K24 A;  2BVM A;  2E5V A;  5L3B B;  3C98 B;  2Y56 A;  2BBJ A;  2CXD A;  1KFY A;  5LG3 A;  1VCT A;  2J62 A;  2DWG A;  3AED A;  4WYV A;  4IDQ A;  4KHP T;  4YJ3 E;  2ZM2 A;  4JYA T;  5CB4 E;  3JCF A;  1G73 A;  4QH5 A;  2V26 A;  3H3M A;  4A5X A;  2UXN B;  2WM9 A;  1Y01 A;  1SE7 A;  3SFD A;  2V6Y B;  4DMV A;  5E0O A;  3X1D A;  3UU6 A;  2CBJ A;  4NUU A;  4CQI A;  5H6R B;  3F57 A;  4LF9 T;  4DBR A;  4HEA A;  5AFN A;  1HG5 A;  4U3C A;  1U4Q A;  1ZKE A;  1HNW T;  3VKG A;  2AXD S;  4EED A;  2XYT A;  2X51 A;  4EIW A;  4CI3 B;  2A2F X;  3C4X A;  2WQY A;  1MMD A;  3PU3 A;  3ZSS A;  4IE6 A;  3V5S A;  5HXC A;  3ZYL A;  3CPZ A;  5LB7 B;  1M62 A;  5AFH A;  1HFA A;  3UT5 E;  4PK4 A;  4N78 D;  5LNK A;  1L0V A;  3KIN B;  3HI2 A;  4H9R C;  2ZJV A;  3N5L A;  1WRD A;  3VR8 A;  1MIW A;  2LLY A;  2ES0 A;  3NZQ A;  4QHO A;  1I6Z A;  1KNP A;  4IE7 A;  5LHG B;  4JI1 T;  3ZT6 A;  4IDZ A;  2ZM8 A;  3U8K A;  4UM3 P;  3HKC E;  5BW2 A;  3H3A A;  5LMN T;  2WMO A;  1KF6 A;  3U78 A;  2ODV A;  3VRA A;  1BR0 A;  3U8J A;  3VRB A;  4LF7 T;  5LHH B;  4HKA A;  3IA3 A;  4GKJ T;  3AEA A;  2BG9 C;  2H3R A;  2X67 A;  4H9P C;  2H7O A;  4DR3 T;  2V6Y A;  4H9O C;  1OXZ A;  2VVS A;  5AQF B;  5LYJ E;  1MIV A;  1G8X A;  2WDQ A;  4BQT A;  4A56 A;  2V6X A;  2XJ7 A;  5LJN A;  4OK0 A;  4DBQ A;  2KSR A;  5ETW A;  3P4R A;  3AVR A;  2A9U A;  3AA6 B;  4U7Y A;  2YIN A;  2M6B A;  3ZYM A;  1I94 T;  3AEE A;  4OX9 T;  2NW7 A;  2K9A A; 
#chains in the Genus database with same CATH homology
 4LMK A;  4UXU A;  3ZDH A;  2YKS A;  4HFI A;  5AFK A;  1UW6 A;  2XNV A;  2XNT A;  2Y57 A;  2QC1 B;  2BYS A;  3RIA A;  3PMZ A;  1OED C;  2YMD A;  3UU8 A;  3U8N A;  5HEU A;  3RQW A;  2ZJV A;  5LXB A;  4PIR A;  2WNC A;  2XZ6 A;  3WTM A;  1UX2 A;  3T4M A;  4HQP A;  2LLY A;  4ZZB A;  3P4W A;  3TLW A;  4ZR6 A;  4TWD A;  4UM3 S;  4BFQ A;  2W8G A;  3C84 A;  5IUX A;  3UQ7 A;  2BR7 A;  2PH9 A;  4UY2 A;  5AIN A;  5BP0 A;  3EAM A;  2ZJU A;  4HFC A;  4FRR A;  4QH4 A;  3TLT A;  2LKH A;  2UZ6 A;  4HFH A;  2Y7Y A;  5L47 A;  5KE4 A;  3JAF A;  4ZZC A;  4F8H A;  2WNL A;  5J5G A;  4AFG A;  5AFM A;  4UM3 A;  4QH1 A;  3ZKR A;  4X5T A;  3U8M A;  4EZ1 A;  2WN9 A;  4HFE A;  4NZB A;  2BG9 E;  4DBM A;  3WTI A;  2Y56 A;  3U8K A;  4UM3 P;  5J5I A;  5BW2 A;  3UUB A;  4WV9 A;  5BRX A;  4XHE A;  2Y58 A;  2BG9 B;  3U8L A;  2XQ6 A;  5HEO A;  2BYN A;  3P50 A;  5HCJ A;  5LG3 A;  4ALX A;  2XQ8 A;  5HEH A;  1UV6 A;  3LSV A;  5HEJ A;  2XQA A;  5AFJ A;  2BR8 A;  2XQ4 A;  4Z90 A;  2VL0 A;  3UU4 A;  3ZDG A;  4A97 A;  5HCM A;  3TLU A;  5AFL A;  3JAE A;  3WIP A;  5CO5 A;  2X00 A;  3UU5 A;  4HFB A;  4ILB A;  4ILC A;  3C79 A;  4D01 A;  2C9T A;  3UQ4 A;  4QH5 A;  5FJV A;  4Z91 A;  4ZK4 A;  4ZJS A;  3U8J A;  3SQ9 A;  4LML A;  3TLS A;  3PEO A;  4ZRU A;  4COF A;  1I9B A;  3SQ6 A;  5TVC A;  2YN6 A;  4A98 A;  2BG9 C;  4TWH A;  3TLV A;  3GUA A;  4IL4 A;  3RQU A;  4ILA A;  2BJ0 A;  5J5F A;  5L4E A;  2Y54 A;  3WTH A;  1OED E;  3RIF A;  4IRE A;  3UU6 A;  2PGZ A;  4IL9 A;  4TWF A;  2YME A;  5AFM B;  2LM2 A;  4B5D A;  2BYR A;  4LMJ A;  3WTJ A;  3RHW A;  5JME A;  5L4H A;  3RI5 A;  2WNJ A;  2YOE A;  2XNU A;  5J5H A;  3SIO A;  4TNW A;  5AFN A;  2XQ3 A;  4TNV A;  1OED A;  2LKG A;  2W8F A;  2X00 D;  3JAD A;  2XYT A;  2M6I A;  2BYP A;  2XZ5 A;  4QAC A;  5CFB A;  3SH1 A;  4QAA A;  4BQT A;  1OED B;  2WZY A;  2XYS A;  4AFT A;  4UM1 A;  5HEG A;  5SYO A;  3WTN A;  2XQ9 A;  2KSR A;  2BYQ A;  4AFH A;  4XK9 A;  4ZJT A;  4NPP A;  3UU3 A;  3WTO A;  5KZU A;  4HFD A;  5AFH A;  2MAW A;  4QAB A;  4ZK1 A;  2XQ5 A;  3WTK A;  5J0Z A;  2M6B A;  3WTL A;  3EHZ A;  3EI0 A;  3IGQ A;  2XQ7 A;  2BG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...