3UU5A

The glic pentameric ligand-gated ion channel loop2-20' mutant reduced in solution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVECNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu5A01
5FJVA 3U8MA 2BYNA 3WTIA 4HFIA 2KSRA 3U8NA 1OEDB 3UU5A 4PIRA 4ZRUA 2MAWA 5HEHA 2Y58A 4HFBA 4QH5A 3ZDHA 3RI5A 3UU8A 2BG9A 2BYPA 4DBMA 3RIFA 4AFGA 2PGZA 2X00D 5AFJA 4WV9A 2LKGA 3ZDGA 4TNVA 4HQPA 2BYQA 2XYSA 3UQ7A 2BR7A 5HEGA 4FRRA 5HCMA 5BW2A 4HFDA 4QH1A 4COFA 2WNLA 3C84A 3T4MA 4BFQA 3WTHA 4HFHA 1UX2A 4TWHA 4LMKA 5BRXA 3P50A 4UXUA 5L4HA 3IGQA 4ILAA 2XQ8A 4NZBA 2X00A 2Y56A 4BQTA 1OEDE 2ZJUA 3PEOA 4ILBA 3RIAA 1OEDC 3P4WA 2BJ0A 2XNTA 3PMZA 3WTOA 5HEOA 3TLUA 5J5FA 2M6IA 3SIOA 2XQ9A 2XQ6A 3TLSA 4UY2A 2YKSA 4QAAA 5AFLA 2BG9B 5J0ZA 4EZ1A 3WTKA 3UU6A 2M6BA 3RQWA 2UZ6A 4LMLA 3TLTA 3UQ4A 5J5GA 3U8LA 2XQ4A 4ZJSA 2LM2A 5AINA 3JAEA 2Y57A 5AFHA 5J5HA 5TVCA 5JMEA 2W8FA 4IL9A 5LG3A 4ZR6A 2VL0A 4A98A 2BYRA 3EHZA 3U8JA 5J5IA 2XQ5A 2WNJA 3EI0A 5CFBA 2XYTA 4XHEA 2XQAA 4ZZBA 4X5TA 5L47A 4QH4A 5HEJA 1I9BA 2XQ7A 3GUAA 5CO5A 3SQ9A 3WTMA 4ALXA 2WNCA 4ZK1A 2LKHA 4QACA 4ZZCA 4D01A 4ILCA 5AFKA 2BG9E 3EAMA 4HFCA 2W8GA 4HFEA 5HCJA 2BG9C 2WZYA 4UM3P 5AFNA 4B5DA 5KE4A 4AFTA 4IREA 5HEUA 4TWFA 4UM3S 2Y7YA 4UM3A 2WN9A 2PH9A 3SQ6A 5SYOA 4F8HA 3U8KA 2XQ3A 4TWDA 3C79A 2XNVA 4ZK4A 3WIPA 3TLWA 2YMEA 3ZKRA 5L4EA 3RHWA 2YOEA 4AFHA 2BR8A 1UW6A 4TNWA 1OEDA 4IL4A 4Z90A 3UU3A 4LMJA 4Z91A 2YMDA 5IUXA 1UV6A 2XNUA 3WTJA 3LSVA 4ZJTA 2XZ5A 3JADA 2QC1B 2Y54A 3JAFA 5KZUA 3WTLA 4A97A 2BYSA 2XZ6A 2LLYA 3WTNA 2YN6A 4UM1A 3UU4A 4NPPA 5AFMA 3SH1A 3TLVA 4QABA 3UUBA 5LXBA 2C9TA 2ZJVA 5AFMB 3RQUA 4XK9A 5BP0A
chains in the Genus database with same CATH superfamily
4PK5A 3U8MA 5FP3A 4B6XA 3EDVA 5CJ5A 4QH5A 1OXZA 3FZKB 1HX1B 2PGZA 2XASB 2LKGA 5ABFA 2ZMAA 3I9YA 2FUPA 4NUUA 3NZPA 3GMIA 3N2GE 4X62T 1XDPA 3S4UA 5L4HA 4A5XA 2W62A 2FJBA 2E5LT 4OHFA 1OEDC 1J1JA 4TV9E 3TLUA 1MNDA 1D0YA 3SRZA 5AFLA 4L5GA 4DMVA 2DWKA 2NR4A 1NAFA 1HX8A 4JI6T 3QC9A 3UUXB 3Q2MA 3FXEB 3N9LA 5L3CB 3Q5XA 5LHGB 5AFNA 4ZI3C 2BG9C 3ONJA 2HPJA 4IGUA 5IHYA 5ADXL 2DHRA 3VHLA 4EB6E 2K48A 4DR3T 2W63A 3ZCJA 3K1SA 5F5WA 5LGNB 4LMJA 3SFDA 3CKDA 2NWBA 2DCFA 2WWVA 4IE6A 4P0BA 5A1LA 2CE7A 3CX6B 3NWIA 2CXLA 3O1JA 4WW0A 5LXBA 4DV0T 2HH7A 4EIWA 2D0TA 2JQHA 2IW5B 4JUYA 4ZRUA 2Y58A 1XNRT 3P7IA 3RIFA 4KHPT 3UFEA 2XY8B 1YKEB 2WNLA 3WTHA 1UX2A 2G0UA 2FJAA 1T72A 2WP9A 2C5IT 3CQCB 4YHHT 4H9SE 5FKYA 3HKCE 4HN9A 2KMFA 3PEOA 3OKQA 2D5UA 2K9AA 2WDVA 4H63H 3PUXF 3SIOA 2ODUA 5EK2A 4OK0A 2CEAA 2E8IA 4CZZB 5ABFB 1SA0E 5J5GA 1I6ZA 2XQ4A 3IEEA 4GYSA 1W0BA 2BYRA 2E9XC 3N2KE 2YDRA 3ZN0B 3QK6A 5KE4A 1D1CA 3PUWF 2LOSA 5FMNA 5SYOA 5L3EB 2XQ3A 4DV5T 2E2AA 3AVRA 1HG5A 2YMEA 5HWXA 2VVSA 2CHNA 2A9UA 1HTJF 4K0UA 2LSYA 2WCAA 3FB2A 2W0GA 2VKOA 5FXVA 2OV9A 3DTOA 1WYCA 4IHJE 3RF1A 4ZI3D 5GONE 3VKGA 4ISTA 4QABA 5AFMB 5LBMA 2J62A 3BQLA 3WTIA 3N9OA 5EZYE 4K0KT 4CXYA 3N9NA 4OX9T 3X1DA 5AQUB 1KK7A 2MTQA 4BJNA 4N78D 5HEGA 4HFDA 4M1PA 4HFHA 2D0UA 2UXBT 2N1GA 2YINA 4UXUA 2XQ8A 2UU9T 3RPUA 5BMVE 5JQGE 1NWMX 5J5FA 5C8YE 3M65A 2ZLYA 4EXTA 5JDGA 2Q9QA 3SS1A 1HG2A 2W4XA 5LGTB 4O8SA 2P9BA 3L3PA 5IWAT 4QX7B 3U3IA 2WAUA 1J5ET 2X9WA 1D1AA 4P09A 1VCTA 4JYAT 5JTGA 3FHNA 4HFCA 3D0TA 1FEWA 4AFTA 1O3XA 4OYKA 3GN5A 2WU2A 4UM3S 4CI3B 2PH9A 2RP4A 3CPZA 3VR8A 3RHWA 2WZHA 4PFPA 4U2ZA 2JQKA 3OJAA 2C5JA 4L0RA 1UUSA 2E9XD 3AE9A 1Y64B 3P8CD 2XZ5A 2NTXA 3OBVE 3ZSTA 2QGSA 4CI2B 3WTLA 2XZ6A 4JI4T 2K24A 2KZ7B 4PFOA 2C9TA 3RQUA 5FJVA 3AA7B 4U7YA 2Z6EA 5DJQC 3PUYF 2LM9A 1GQEA 3N9QA 2XM2A 2H7VC 5FYMA 3ONLC 5HEHA 3CVRA 4EYYR 2X00D 3ZDGA 4TNVA 2XQYA 3ZEFB 3RYFE 4C90A 3O1IA 3N9MA 2WMNA 4AQFA 4QKNA 2V5CA 1US7B 3ZT7A 3ZC0A 4AQGA 4BQTA 3AE8A 3PMZA 4ZXLA 1DU2A 3AE3A 2FJDA 5HEOA 2YKSA 4DR5T 1B7TA 3RIUA 3CX8B 1YQ4A 1M7KA 5J0ZA 3PV0F 2UXNB 5AQIB 5EK4A 5FVKA 4ZJSA 1IBMT 2W8FA 1MNEA 1N32T 2UXDT 2VASA 5JDFA 4XHEA 2XQAA 2BVLA 4QH4A 3SQ9A 3AEDA 3A7MA 4YHJA 5AFKA 4UIGA 2Q9QB 4HEAA 4EZHA 4HGAA 4AKHA 3J9X1 4O4HE 3AA6B 3C79A 2CLYC 2J1DG 2DWGA 5FL1A 3WTJA 5JDQA 3VR9A 3RYIE 4IDQA 3EUHA 5KZUA 1FIOA 2XAFB 2BYSA 2XAHB 3NRYA 4DV1T 1IZNB 1W9RA 3GN5B 1LRZA 2FBWA 4XK9A 3GWHA 1JNZA 4HFIA 2CBJA 2X51A 4KX6A 3OYXA 4B3MT 5HXSA 4DBMA 2NW8A 5AFJA 4CXWA 4H9RC 4YJ3E 5LJNA 4YFSA 4IDOA 5LOVE 3P50A 3B57A 5LNKA 2WU5A 2V7KA 3K3OA 1QLBA 4KMCA 3MJXA 1UX5A 3KV9A 3V5UA 3VRBA 3ZMTB 2LM2A 5TVCA 4I43B 2VL0A 4LFCT 2KINB 5CFBA 3PUSA 4H9NC 4GK0E 2MBGA 1YKHB 3KV6A 1IBKT 3RRWA 4E7SA 4QACA 1S94A 3RKOA 2XAJB 4ANJA 3I0QA 4X65T 5L3FB 1MMGA 3ZKRA 2F4VT 2BS4A 3AVSA 1UW6A 4TNWA 1OEDA 4MLKA 1N34T 3AXJA 4KHZF 1NENA 1UK5A 2JPFA 2YU2A 2VVNA 3ZMVB 5AQJB 3OVUA 1BR4A 2X9XA 2X9YA 4JI3T 4DMWA 1UX4A 4UVCB 2WMOA 3ZDHA 4DV3T 2BG9A 2XSAA 2I59A 4HTEA 3RLFF 5BW2A 2UXCT 2IC6A 1WCRA 2XUEA 4LF8T 4AKGA 5LG4A 1QSDA 1FJGT 2L8KA 1XMQT 4B3ST 1T98A 2LSJA 3ZMUB 3U8LA 3PUQA 4XZCA 3PE0A 3G06A 2EHOC 3AE5A 3RYHE 4EV6A 3OYZA 1HNZT 5HXRA 4HE8A 3SFEA 2YDQA 5AQOB 5LMNT 2MPKA 5HEUA 5JRCA 3AE4A 3RH3A 4KUMB 2XTLA 4AISA 5KMGP 2JMKA 4JI7T 4Z90A 2YMDA 4Z91A 5AQKB 3QB5A 2BS3A 2JQ9A 4PJJA 1KNRA 2LSGA 2XZEA 3CQXC 5H6RB 2Y54A 1Z0PA 5AQVB 4LF5T 1BR0A 2LHRA 1W09A 4CQIA 5JDMA 5AFMA 3UUBA 2CMRA 3HI2A 2E9XA 3BQKA 5JREA 1OEDB 3Q5EA 2WB5A 3AXJB 2CCQA 3RI5A 2X68A 4PAGA 3RC8A 1KF6A 4FRRA 2B1EA 4B3TT 4HWHA 4QH1A 4COFA 3CX7B 1YXRA 2JJ9A 4ZI2D 2FJEA 2X00A 3FZFB 1OEDE 1Z8UA 4LFAT 3MK7C 3LG7A 5L2LA 2JRKA 4GKKT 3K3NA 3QB5K 2BG9B 3QOFA 3JC6C 3UQ4A 4LF9T 2HPLA 5AQPB 3UFGA 5JR9C 5JMEA 5KDMC 4PJMA 4IL9A 2D2SA 2XHEB 2XSBA 2XYTA 2XQ7A 4GK5E 2VB6A 3V5SA 4O2AE 3PU8A 3ONXA 3M3ZB 2BG9E 4HFEA 3RC3A 2C0SA 4IREA 5AQMB 1HS7A 4P0AA 4PW8A 4YTNA 4G63A 5LYJE 1ZP0A 1WYBA 4Z8XA 3LK42 4DO0A 2HHHT 3CMLA 3CQGB 3NRXA 5FVLA 3IBPA 1D1BA 2X0HA 4ZEYA 3JADA 2NW9A 3LFMA 3CK6A 3W15B 3T1HT 3PUAA 5JRCB 2V8SV 1VCSA 4IDZA 1W0AA 2ODVA 4NUVA 3EVYA 3K8PC 4ZOLE 3F2EA 3ETUA 4BAYB 4IDPA 4DV2T 5LA6E 4CN1A 4UR9A 4JI0T 1MMAA 2L9QA 4PK6A 2PTFA 4GIWA 1VRBA 4TWHA 2LOPA 5CGMA 1HNWT 4U33A 3Q5WA 2E9XB 4NZBA 2V26A 2BJ0A 3B5MA 3CIRA 3TLSA 4UY2A 1SUMB 1WLXA 2IHR1 3ZYMA 1FMWA 5F8PA 4YTMA 3RQWA 5LBQB 2BZBA 3R84B 3IA3A 2RA1A 4QX8B 3ETVA 4OFZA 5DABA 4DUZT 1L0VA 2WZYA 2W8GA 2UUBT 5JH7E 2XPKA 4UM3A 1KFYA 3N9PA 3JC6D 2XNVA 1KNPA 2YEVC 4CXXA 3NZQA 2KWIB 4WZXA 3ZCIA 4NIQA 3PTRB 5FXZA 2XNUA 5CB4E 4U74A 5JDLA 2QC1B 1JNRA 3JAFA 2WDRA 2CHOA 4IE4A 2IDOB 4UELA 4UM1A 3UU4A 3SH1A 2CA5A 2LSIA 5BP0A 3L09A 5AQLB 4E7ZA 3DP7A 4PJLA 1ZOYA 3C4WA 4WV9A 4YSYA 3H3AA 3DJBA 2N9DA 5C2TA 3J7Yq 3HL6A 4XAXB 2PBIA 2YK0A 3FBZA 4KI0F 2Y6XA 1XDOA 4G2AA 1SHZC 2PG8A 3OPCA 2WSSV 4HWCA 4EZ1A 3E22E 4PJNA 5AINA 4DV7T 4JI1T 1MMNA 5LG3A 4A98A 3BQIA 5TAOA 1LVFA 2WNJA 1KNZA 4ZZBA 3C51A 3GUAA 3WTMA 4AXPA 4TN7B 4ZI7E 2I0MA 4ZK1A 2AE9A 5FXXA 4EEBA 2PJQA 4JI2T 2Q9QC 3PDYA 1HF8A 3U78A 3C4ZA 4TX5A 1HCIA 4JI8T 3FZLB 3SQ6A 3B13A 4DNDA 3C98B 3O4XE 3HR0A 3C64A 3WAJA 4I0UA 3LK3B 3LK2B 2NOXA 4ADZA 2QRXA 1XZYA 2LHNA 4U2YA 3AECA 4WBNE 2NTYA 2PFVA 3LDQB 4A56A 4LFBT 2J47A 1CUNA 2VKHA 4ZHQE 3VKHA 2ZJVA 2ZM6T 2CWYA 4GKJT 1U5PA 4I55E 1AJ3A 1ZEEA 4X1KE 5LHHB 4AFGA 3F31A 2XYSA 3PUGA 4JI5T 4X1IE 5HCMA 3T4MA 3RKGA 5LHIB 5BRXA 1MIYA 4ILUA 2A2FX 3RIAA 3P4WA 2BKPA 2XQ9A 4CN4A 4ERRA 3Q9DA 2W61A 2LSKA 5LB7B 3MACA 2QYWA 4BJMA 2LT3A 1J5WA 1E1HB 5AFHA 5C3JA 5F3JA 2CLYB 3ZJ1A 2BKNA 4ZR6A 3ZMZB 4AQFC 3T1YT 2L3LA 2KT9A 3CWZB 5CO5A 2VL8A 4H9PC 2WQYA 3A5XA 5AQRB 3KFWX 1BR2A 2WN9A 3NKZA 2X0YA 3U8KA 4EYUA 4DBRA 3IHRA 2CWOA 4IL4A 3UTKA 3ZYLA 3NBXX 4FJOA 2V5DA 2H7OA 1ZKEA 4U31A 3ZSSA 4IIJE 4EGWA 2EHOA 3AEEA 2WBLA 3QUJA 2JMHA 5H6QB 1YQ3A 2QVAA 4KBMB 5J2UE 1HNXT 4QXBB 2BS2A 3I0OA 3P4QA 5BR8T 3ZYKA 2BYPA 1G8XA 3ZT5A 2UXXB 2ACXA 5KXJA 3C84A 4B3RT 3C50A 1ZHCA 2CBIA 4JEHB 4LMKA 2LRKA 3F57A 1WR6A 5IYZE 4UV8B 2ACZA 2HN2A 2ZJUA 1LKXA 2WWUA 3NVOA 2DI4A 3L8RA 2IAKA 2NP9A 5CA1E 5LMUT 2CM0A 5J2TE 2QA7A 2M6BA 2UZ6A 4XBFB 4I4TE 2WS3A 3TLTA 3SWHA 3A8YC 2ES0A 3HKBE 4O4JE 3P4PA 2X67A 2XJ7A 4DVDA 4AKLA 4Q25A 4DR1T 1I9BA 5HEJA 2W2UA 2KXPB 2LKHA 3MA9A 2CPTA 4ILCA 3EDUA 3RGLA 4PK4A 2UUAT 3AA0B 2LE8A 4F8HA 3AEBA 4YY3T 2WZIA 2YOEA 4EEDA 2VKDA 4EAHA 3ZMSB 3VU7H 1YD8G 5CA0E 4ZJTA 3FXDB 1QUUA 2BBJA 4TV8E 3PJAJ 5KX5E 3WTNA 2V7MA 5JR9A 1R8IA 3T8OA 2YDSA 3EABA 1Y01A 5LGUB 5FL0A 2KSRA 2I6HA 2WDQA 4YLHA 2VQET 1X9BA 1SE7A 4MFRA 4C91A 2EHOB 2H3RA 4O4LE 1XMOT 3PJAA 4I50E 3ESLA 2RPAA 3KBUA 2H89A 3WTOA 5AQGB 4WYVA 2A3DA 4QAAA 3PUZF 5LXTE 4DUYT 4GYRA 5J5HA 2UUCT 5LCYA 4UV9B 3H3MA 2BDEA 1HR0T 2WNCA 3AE1A 4D01A 3BK9A 3UT5E 4IT4A 1IAPA 2D9DA 3AA1B 3WIPA 3ZN1B 4ISSA 5L3BB 5FXWA 3FBLA 1UV6A 3FZMB 1M62A 3ZPOA 2W67A 4DIDB 3HKDE 4WBOA 2B76A 2ZM2A 5HXHA 1LVKA 3TLVA 3AE2A 5ABEA 4BA9A 2BYNA 2CXFA 2EHOD 3U8NA 4HWFA 3VRAA 3UU5A 2KNDA 4HFBA 2GK9A 4PNIA 3UU8A 3RRCA 2BYQA 3AE7A 3LJCA 4U3CA 3UQ7A 2SPCA 4UF0A 1EZ3A 2MOZA 4MBQA 3I1AA 5JR9B 4HFVA 3E08A 2Y56A 4H9OC 2XNTA 5AQTB 2M6IA 5AQNB 4IE7A 1G73A 3WI3A 3UU6A 4LMLA 3AEGA 5JVDE 5M4YA 4HKAA 4X20E 3WAKA 5FY0A 5AQHB 2XM1A 1I94T 4ZZCA 5L3GB 3EAMA 5HCJA 4TWFA 3UULA 1UCUA 5J1GA 2V6XA 2E5VA 4JEUB 2Y8DA 3UU3A 2V7IA 4U7IA 2V7LA 1MIWA 2LJLA 3LBXA 3PUVF 4UEMA 2VKJA 2K5BB 4CN6A 3P4SA 2YN6A 4O4IE 4EZ4A 5LJMA 2X9HA 2BKOA 2BBHA 1E2AA 4AKRB 4KP3C 4FI5A 2VQFT 4IDNA 3H37A 3KDSE 4WNKA 4HQPA 4EOZB 4MHCA 5DQVA 4DR6T 4H63V 3N2OA 4DV6T 3MZKB 2XAGB 3RX6A 3IGQA 2KLQA 3PURA 4NXMT 5JDHA 2YU1A 1ZV4X 4QXHB 3MKDA 4QXCB 2VK9A 4QHOA 4YJ2E 4IE0A 5ABHA 3WTKA 1T8BA 1MIVA 1IJ5A 4YSXA 3JAEA 4UF0B 1N33T 4J2CA 5J5IA 3KBTA 2CRBA 4L9IA 4X5TA 2H88A 2LRLA 1U4QA 1XNQT 3C4XA 2IC9A 2VURA 4UVAB 4UM3P 4CI1B 2J4GA 3UUMA 1D0ZA 2V1DB 1WRDA 3AEFA 4TWDA 3AAIA 4AQYT 4ZK4A 1VOMA 5L4EA 3K3QC 4AFHA 4O2BE 2BR8A 3ZLIA 4AIUA 5EK3A 5E0OA 4MALA 2V6YA 2JQQA 1KEYA 3HA4A 4YTPA 4A97A 5AFUL 2LEHA 4AI6A 4NPPA 4HWIB 2X0LB 3UUNA 2Y48B 3E0ZA 3N5LA 4OYJA 2W66A 5HXEA 4U72A 3I9WA 4UXNB 1H7CA 2IIUA 4DR4T 3MXZA 1T7SA 3QNUA 4HWDA 3LBXB 3OTOT 3FZHB 3TKLB 2JIWA 3KVBA 1HFAA 2WY2A 1V9DA 4ILAA 1X79A 5FNVE 3GA8A 3AAAB 4ILBA 5AQSB 3KINB 5ABGA 2V7JA 2MYSA 4TUYE 3HKEE 1N36T 2K3WA 2NW7A 2ZM8A 2BVMA 1IBLT 2Y57A 2CXDA 4DR7T 2X66A 3EHZA 3U8JA 2XQ5A 3AE6A 2DLRA 3EI0A 3AEAA 5L47A 4ALXA 1UURA 3Q5DA 5FY7A 2W00A 4B5DA 3ANWA 2KWHA 2OA5A 1WR0A 4QWNB 2C5KT 5HYAA 4LF4T 4ZS2A 1WFDA 3KVAA 2VWAA 5FY1A 1E7PA 2HN1A 1BR1A 4DR2T 5AQQB 4TZ4C 3RIUC 5DQWA 4P1NA 2XAQB 2R6GF 2OLTA 4ZS3A 3PU3A 4PIRA 3IF8B 4DBQA 5AQFB 2MAWA 3R6NA 4YT0A 1IJ6A 1D0XA 5HXCA 4X1YE 2BR7A 3ZC1A 1OWAA 2V6YB 5L3DB 2DL1A 4BFQA 2Q9QD 3KV4A 4YSZA 4H9QC 4X66T 3ABVA 2IMLA 4YXDA 4LF7T 4X64T 2WM9A 4F6RC 2XQ6A 1NEKA 2ZM0A 4GOUA 4JLEA 5HAXA 1MMDA 4DV4T 1XWMA 4JBWF 3SOLA 2M67A 4NXNT 4UVBB 4V1Av 3ZJ2A 2DNXA 1S35A 3JCFA 5ETWA 3KV5A 1CHUA 2N2NA 1UGOA 2A72A 2Y7YA 3AB3B 4ZI2C 1FMVA 2IUBA 3TLWA 5JDNA 3P4RA 3O1HA 4IE5A 3RYCE 5IUXA 3L39A 4JV5T 3LSVA 2AXDS 3ZT6A 3O9XA 5LP6E 2LLYA 4AKIA 4ASKA 5HWYA 4LF6T 3ANWB 3AAEB 1YW0A
chains in the Genus database with same CATH topology
5FJVA 3U8MA 2BYNA 3WTIA 4HFIA 2KSRA 3U8NA 1OEDB 3UU5A 4PIRA 4ZRUA 2MAWA 5HEHA 2Y58A 4HFBA 4QH5A 3ZDHA 3RI5A 3UU8A 2BG9A 2BYPA 4DBMA 3RIFA 4AFGA 2PGZA 2X00D 5AFJA 4WV9A 2LKGA 3ZDGA 4TNVA 4HQPA 2BYQA 2XYSA 3UQ7A 2BR7A 5HEGA 4FRRA 5HCMA 5BW2A 4HFDA 4QH1A 4COFA 2WNLA 3C84A 3T4MA 4BFQA 3WTHA 4HFHA 1UX2A 4TWHA 4LMKA 5BRXA 3P50A 4UXUA 5L4HA 3IGQA 4ILAA 2XQ8A 4NZBA 2X00A 2Y56A 4BQTA 1OEDE 2ZJUA 3PEOA 4ILBA 3RIAA 1OEDC 3P4WA 2BJ0A 2XNTA 3PMZA 3WTOA 5HEOA 3TLUA 5J5FA 2M6IA 3SIOA 2XQ9A 2XQ6A 3TLSA 4UY2A 2YKSA 4QAAA 5AFLA 2BG9B 5J0ZA 4EZ1A 3WTKA 3UU6A 2M6BA 3RQWA 2UZ6A 4LMLA 3TLTA 3UQ4A 5J5GA 3U8LA 2XQ4A 4ZJSA 2LM2A 5AINA 3JAEA 2Y57A 5AFHA 5J5HA 5TVCA 5JMEA 2W8FA 4IL9A 5LG3A 4ZR6A 2VL0A 4A98A 2BYRA 3EHZA 3U8JA 5J5IA 2XQ5A 2WNJA 3EI0A 5CFBA 2XYTA 4XHEA 2XQAA 4ZZBA 4X5TA 5L47A 4QH4A 5HEJA 1I9BA 2XQ7A 3GUAA 5CO5A 3SQ9A 3WTMA 4ALXA 2WNCA 4ZK1A 2LKHA 4QACA 4ZZCA 4D01A 4ILCA 5AFKA 2BG9E 3EAMA 4HFCA 2W8GA 4HFEA 5HCJA 2BG9C 2WZYA 4UM3P 5AFNA 4B5DA 5KE4A 4AFTA 4IREA 5HEUA 4TWFA 4UM3S 2Y7YA 4UM3A 2WN9A 2PH9A 3SQ6A 5SYOA 4F8HA 3U8KA 2XQ3A 4TWDA 3C79A 2XNVA 4ZK4A 3WIPA 3TLWA 2YMEA 3ZKRA 5L4EA 3RHWA 2YOEA 4AFHA 2BR8A 1UW6A 4TNWA 1OEDA 4IL4A 4Z90A 3UU3A 4LMJA 4Z91A 2YMDA 5IUXA 1UV6A 2XNUA 3WTJA 3LSVA 4ZJTA 2XZ5A 3JADA 2QC1B 2Y54A 3JAFA 5KZUA 3WTLA 4A97A 2BYSA 2XZ6A 2LLYA 3WTNA 2YN6A 4UM1A 3UU4A 4NPPA 5AFMA 3SH1A 3TLVA 4QABA 3UUBA 5LXBA 2C9TA 2ZJVA 5AFMB 3RQUA 4XK9A 5BP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJV A;  3U8M A;  2BYN A;  3WTI A;  4HFI A;  2KSR A;  3U8N A;  1OED B;  3UU5 A;  4PIR A;  4ZRU A;  2MAW A;  5HEH A;  2Y58 A;  4HFB A;  4QH5 A;  3ZDH A;  3RI5 A;  3UU8 A;  2BG9 A;  2BYP A;  4DBM A;  3RIF A;  4AFG A;  2PGZ A;  2X00 D;  5AFJ A;  4WV9 A;  2LKG A;  3ZDG A;  4TNV A;  4HQP A;  2BYQ A;  2XYS A;  3UQ7 A;  2BR7 A;  5HEG A;  4FRR A;  5HCM A;  5BW2 A;  4HFD A;  4QH1 A;  4COF A;  2WNL A;  3C84 A;  3T4M A;  4BFQ A;  3WTH A;  4HFH A;  1UX2 A;  4TWH A;  4LMK A;  5BRX A;  3P50 A;  4UXU A;  5L4H A;  3IGQ A;  4ILA A;  2XQ8 A;  4NZB A;  2X00 A;  2Y56 A;  4BQT A;  1OED E;  2ZJU A;  3PEO A;  4ILB A;  3RIA A;  1OED C;  3P4W A;  2BJ0 A;  2XNT A;  3PMZ A;  3WTO A;  5HEO A;  3TLU A;  5J5F A;  2M6I A;  3SIO A;  2XQ9 A;  2XQ6 A;  3TLS A;  4UY2 A;  2YKS A;  4QAA A;  5AFL A;  2BG9 B;  5J0Z A;  4EZ1 A;  3WTK A;  3UU6 A;  2M6B A;  3RQW A;  2UZ6 A;  4LML A;  3TLT A;  3UQ4 A;  5J5G A;  3U8L A;  2XQ4 A;  4ZJS A;  2LM2 A;  5AIN A;  3JAE A;  2Y57 A;  5AFH A;  5J5H A;  5TVC A;  5JME A;  2W8F A;  4IL9 A;  5LG3 A;  4ZR6 A;  2VL0 A;  4A98 A;  2BYR A;  3EHZ A;  3U8J A;  5J5I A;  2XQ5 A;  2WNJ A;  3EI0 A;  5CFB A;  2XYT A;  4XHE A;  2XQA A;  4ZZB A;  4X5T A;  5L47 A;  4QH4 A;  5HEJ A;  1I9B A;  2XQ7 A;  3GUA A;  5CO5 A;  3SQ9 A;  3WTM A;  4ALX A;  2WNC A;  4ZK1 A;  2LKH A;  4QAC A;  4ZZC A;  4D01 A;  4ILC A;  5AFK A;  2BG9 E;  3EAM A;  4HFC A;  2W8G A;  4HFE A;  5HCJ A;  2BG9 C;  2WZY A;  4UM3 P;  5AFN A;  4B5D A;  5KE4 A;  4AFT A;  4IRE A;  5HEU A;  4TWF A;  4UM3 S;  2Y7Y A;  4UM3 A;  2WN9 A;  2PH9 A;  3SQ6 A;  5SYO A;  4F8H A;  3U8K A;  2XQ3 A;  4TWD A;  3C79 A;  2XNV A;  4ZK4 A;  3WIP A;  3TLW A;  2YME A;  3ZKR A;  5L4E A;  3RHW A;  2YOE A;  4AFH A;  2BR8 A;  1UW6 A;  4TNW A;  1OED A;  4IL4 A;  4Z90 A;  3UU3 A;  4LMJ A;  4Z91 A;  2YMD A;  5IUX A;  1UV6 A;  2XNU A;  3WTJ A;  3LSV A;  4ZJT A;  2XZ5 A;  3JAD A;  2QC1 B;  2Y54 A;  3JAF A;  5KZU A;  3WTL A;  4A97 A;  2BYS A;  2XZ6 A;  2LLY A;  3WTN A;  2YN6 A;  4UM1 A;  3UU4 A;  4NPP A;  5AFM A;  3SH1 A;  3TLV A;  4QAB A;  3UUB A;  5LXB A;  2C9T A;  2ZJV A;  5AFM B;  3RQU A;  4XK9 A;  5BP0 A; 
#chains in the Genus database with same CATH topology
 4PK5 A;  3U8M A;  5FP3 A;  4B6X A;  3EDV A;  5CJ5 A;  4QH5 A;  1OXZ A;  3FZK B;  1HX1 B;  2PGZ A;  2XAS B;  2LKG A;  5ABF A;  2ZMA A;  3I9Y A;  2FUP A;  4NUU A;  3NZP A;  3GMI A;  3N2G E;  4X62 T;  1XDP A;  3S4U A;  5L4H A;  4A5X A;  2W62 A;  2FJB A;  2E5L T;  4OHF A;  1OED C;  1J1J A;  4TV9 E;  3TLU A;  1MND A;  1D0Y A;  3SRZ A;  5AFL A;  4L5G A;  4DMV A;  2DWK A;  2NR4 A;  1NAF A;  1HX8 A;  4JI6 T;  3QC9 A;  3UUX B;  3Q2M A;  3FXE B;  3N9L A;  5L3C B;  3Q5X A;  5LHG B;  5AFN A;  4ZI3 C;  2BG9 C;  3ONJ A;  2HPJ A;  4IGU A;  5IHY A;  5ADX L;  2DHR A;  3VHL A;  4EB6 E;  2K48 A;  4DR3 T;  2W63 A;  3ZCJ A;  3K1S A;  5F5W A;  5LGN B;  4LMJ A;  3SFD A;  3CKD A;  2NWB A;  2DCF A;  2WWV A;  4IE6 A;  4P0B A;  5A1L A;  2CE7 A;  3CX6 B;  3NWI A;  2CXL A;  3O1J A;  4WW0 A;  5LXB A;  4DV0 T;  2HH7 A;  4EIW A;  2D0T A;  2JQH A;  2IW5 B;  4JUY A;  4ZRU A;  2Y58 A;  1XNR T;  3P7I A;  3RIF A;  4KHP T;  3UFE A;  2XY8 B;  1YKE B;  2WNL A;  3WTH A;  1UX2 A;  2G0U A;  2FJA A;  1T72 A;  2WP9 A;  2C5I T;  3CQC B;  4YHH T;  4H9S E;  5FKY A;  3HKC E;  4HN9 A;  2KMF A;  3PEO A;  3OKQ A;  2D5U A;  2K9A A;  2WDV A;  4H63 H;  3PUX F;  3SIO A;  2ODU A;  5EK2 A;  4OK0 A;  2CEA A;  2E8I A;  4CZZ B;  5ABF B;  1SA0 E;  5J5G A;  1I6Z A;  2XQ4 A;  3IEE A;  4GYS A;  1W0B A;  2BYR A;  2E9X C;  3N2K E;  2YDR A;  3ZN0 B;  3QK6 A;  5KE4 A;  1D1C A;  3PUW F;  2LOS A;  5FMN A;  5SYO A;  5L3E B;  2XQ3 A;  4DV5 T;  2E2A A;  3AVR A;  1HG5 A;  2YME A;  5HWX A;  2VVS A;  2CHN A;  2A9U A;  1HTJ F;  4K0U A;  2LSY A;  2WCA A;  3FB2 A;  2W0G A;  2VKO A;  5FXV A;  2OV9 A;  3DTO A;  1WYC A;  4IHJ E;  3RF1 A;  4ZI3 D;  5GON E;  3VKG A;  4IST A;  4QAB A;  5AFM B;  5LBM A;  2J62 A;  3BQL A;  3WTI A;  3N9O A;  5EZY E;  4K0K T;  4CXY A;  3N9N A;  4OX9 T;  3X1D A;  5AQU B;  1KK7 A;  2MTQ A;  4BJN A;  4N78 D;  5HEG A;  4HFD A;  4M1P A;  4HFH A;  2D0U A;  2UXB T;  2N1G A;  2YIN A;  4UXU A;  2XQ8 A;  2UU9 T;  3RPU A;  5BMV E;  5JQG E;  1NWM X;  5J5F A;  5C8Y E;  3M65 A;  2ZLY A;  4EXT A;  5JDG A;  2Q9Q A;  3SS1 A;  1HG2 A;  2W4X A;  5LGT B;  4O8S A;  2P9B A;  3L3P A;  5IWA T;  4QX7 B;  3U3I A;  2WAU A;  1J5E T;  2X9W A;  1D1A A;  4P09 A;  1VCT A;  4JYA T;  5JTG A;  3FHN A;  4HFC A;  3D0T A;  1FEW A;  4AFT A;  1O3X A;  4OYK A;  3GN5 A;  2WU2 A;  4UM3 S;  4CI3 B;  2PH9 A;  2RP4 A;  3CPZ A;  3VR8 A;  3RHW A;  2WZH A;  4PFP A;  4U2Z A;  2JQK A;  3OJA A;  2C5J A;  4L0R A;  1UUS A;  2E9X D;  3AE9 A;  1Y64 B;  3P8C D;  2XZ5 A;  2NTX A;  3OBV E;  3ZST A;  2QGS A;  4CI2 B;  3WTL A;  2XZ6 A;  4JI4 T;  2K24 A;  2KZ7 B;  4PFO A;  2C9T A;  3RQU A;  5FJV A;  3AA7 B;  4U7Y A;  2Z6E A;  5DJQ C;  3PUY F;  2LM9 A;  1GQE A;  3N9Q A;  2XM2 A;  2H7V C;  5FYM A;  3ONL C;  5HEH A;  3CVR A;  4EYY R;  2X00 D;  3ZDG A;  4TNV A;  2XQY A;  3ZEF B;  3RYF E;  4C90 A;  3O1I A;  3N9M A;  2WMN A;  4AQF A;  4QKN A;  2V5C A;  1US7 B;  3ZT7 A;  3ZC0 A;  4AQG A;  4BQT A;  3AE8 A;  3PMZ A;  4ZXL A;  1DU2 A;  3AE3 A;  2FJD A;  5HEO A;  2YKS A;  4DR5 T;  1B7T A;  3RIU A;  3CX8 B;  1YQ4 A;  1M7K A;  5J0Z A;  3PV0 F;  2UXN B;  5AQI B;  5EK4 A;  5FVK A;  4ZJS A;  1IBM T;  2W8F A;  1MNE A;  1N32 T;  2UXD T;  2VAS A;  5JDF A;  4XHE A;  2XQA A;  2BVL A;  4QH4 A;  3SQ9 A;  3AED A;  3A7M A;  4YHJ A;  5AFK A;  4UIG A;  2Q9Q B;  4HEA A;  4EZH A;  4HGA A;  4AKH A;  3J9X 1;  4O4H E;  3AA6 B;  3C79 A;  2CLY C;  2J1D G;  2DWG A;  5FL1 A;  3WTJ A;  5JDQ A;  3VR9 A;  3RYI E;  4IDQ A;  3EUH A;  5KZU A;  1FIO A;  2XAF B;  2BYS A;  2XAH B;  3NRY A;  4DV1 T;  1IZN B;  1W9R A;  3GN5 B;  1LRZ A;  2FBW A;  4XK9 A;  3GWH A;  1JNZ A;  4HFI A;  2CBJ A;  2X51 A;  4KX6 A;  3OYX A;  4B3M T;  5HXS A;  4DBM A;  2NW8 A;  5AFJ A;  4CXW A;  4H9R C;  4YJ3 E;  5LJN A;  4YFS A;  4IDO A;  5LOV E;  3P50 A;  3B57 A;  5LNK A;  2WU5 A;  2V7K A;  3K3O A;  1QLB A;  4KMC A;  3MJX A;  1UX5 A;  3KV9 A;  3V5U A;  3VRB A;  3ZMT B;  2LM2 A;  5TVC A;  4I43 B;  2VL0 A;  4LFC T;  2KIN B;  5CFB A;  3PUS A;  4H9N C;  4GK0 E;  2MBG A;  1YKH B;  3KV6 A;  1IBK T;  3RRW A;  4E7S A;  4QAC A;  1S94 A;  3RKO A;  2XAJ B;  4ANJ A;  3I0Q A;  4X65 T;  5L3F B;  1MMG A;  3ZKR A;  2F4V T;  2BS4 A;  3AVS A;  1UW6 A;  4TNW A;  1OED A;  4MLK A;  1N34 T;  3AXJ A;  4KHZ F;  1NEN A;  1UK5 A;  2JPF A;  2YU2 A;  2VVN A;  3ZMV B;  5AQJ B;  3OVU A;  1BR4 A;  2X9X A;  2X9Y A;  4JI3 T;  4DMW A;  1UX4 A;  4UVC B;  2WMO A;  3ZDH A;  4DV3 T;  2BG9 A;  2XSA A;  2I59 A;  4HTE A;  3RLF F;  5BW2 A;  2UXC T;  2IC6 A;  1WCR A;  2XUE A;  4LF8 T;  4AKG A;  5LG4 A;  1QSD A;  1FJG T;  2L8K A;  1XMQ T;  4B3S T;  1T98 A;  2LSJ A;  3ZMU B;  3U8L A;  3PUQ A;  4XZC A;  3PE0 A;  3G06 A;  2EHO C;  3AE5 A;  3RYH E;  4EV6 A;  3OYZ A;  1HNZ T;  5HXR A;  4HE8 A;  3SFE A;  2YDQ A;  5AQO B;  5LMN T;  2MPK A;  5HEU A;  5JRC A;  3AE4 A;  3RH3 A;  4KUM B;  2XTL A;  4AIS A;  5KMG P;  2JMK A;  4JI7 T;  4Z90 A;  2YMD A;  4Z91 A;  5AQK B;  3QB5 A;  2BS3 A;  2JQ9 A;  4PJJ A;  1KNR A;  2LSG A;  2XZE A;  3CQX C;  5H6R B;  2Y54 A;  1Z0P A;  5AQV B;  4LF5 T;  1BR0 A;  2LHR A;  1W09 A;  4CQI A;  5JDM A;  5AFM A;  3UUB A;  2CMR A;  3HI2 A;  2E9X A;  3BQK A;  5JRE A;  1OED B;  3Q5E A;  2WB5 A;  3AXJ B;  2CCQ A;  3RI5 A;  2X68 A;  4PAG A;  3RC8 A;  1KF6 A;  4FRR A;  2B1E A;  4B3T T;  4HWH A;  4QH1 A;  4COF A;  3CX7 B;  1YXR A;  2JJ9 A;  4ZI2 D;  2FJE A;  2X00 A;  3FZF B;  1OED E;  1Z8U A;  4LFA T;  3MK7 C;  3LG7 A;  5L2L A;  2JRK A;  4GKK T;  3K3N A;  3QB5 K;  2BG9 B;  3QOF A;  3JC6 C;  3UQ4 A;  4LF9 T;  2HPL A;  5AQP B;  3UFG A;  5JR9 C;  5JME A;  5KDM C;  4PJM A;  4IL9 A;  2D2S A;  2XHE B;  2XSB A;  2XYT A;  2XQ7 A;  4GK5 E;  2VB6 A;  3V5S A;  4O2A E;  3PU8 A;  3ONX A;  3M3Z B;  2BG9 E;  4HFE A;  3RC3 A;  2C0S A;  4IRE A;  5AQM B;  1HS7 A;  4P0A A;  4PW8 A;  4YTN A;  4G63 A;  5LYJ E;  1ZP0 A;  1WYB A;  4Z8X A;  3LK4 2;  4DO0 A;  2HHH T;  3CML A;  3CQG B;  3NRX A;  5FVL A;  3IBP A;  1D1B A;  2X0H A;  4ZEY A;  3JAD A;  2NW9 A;  3LFM A;  3CK6 A;  3W15 B;  3T1H T;  3PUA A;  5JRC B;  2V8S V;  1VCS A;  4IDZ A;  1W0A A;  2ODV A;  4NUV A;  3EVY A;  3K8P C;  4ZOL E;  3F2E A;  3ETU A;  4BAY B;  4IDP A;  4DV2 T;  5LA6 E;  4CN1 A;  4UR9 A;  4JI0 T;  1MMA A;  2L9Q A;  4PK6 A;  2PTF A;  4GIW A;  1VRB A;  4TWH A;  2LOP A;  5CGM A;  1HNW T;  4U33 A;  3Q5W A;  2E9X B;  4NZB A;  2V26 A;  2BJ0 A;  3B5M A;  3CIR A;  3TLS A;  4UY2 A;  1SUM B;  1WLX A;  2IHR 1;  3ZYM A;  1FMW A;  5F8P A;  4YTM A;  3RQW A;  5LBQ B;  2BZB A;  3R84 B;  3IA3 A;  2RA1 A;  4QX8 B;  3ETV A;  4OFZ A;  5DAB A;  4DUZ T;  1L0V A;  2WZY A;  2W8G A;  2UUB T;  5JH7 E;  2XPK A;  4UM3 A;  1KFY A;  3N9P A;  3JC6 D;  2XNV A;  1KNP A;  2YEV C;  4CXX A;  3NZQ A;  2KWI B;  4WZX A;  3ZCI A;  4NIQ A;  3PTR B;  5FXZ A;  2XNU A;  5CB4 E;  4U74 A;  5JDL A;  2QC1 B;  1JNR A;  3JAF A;  2WDR A;  2CHO A;  4IE4 A;  2IDO B;  4UEL A;  4UM1 A;  3UU4 A;  3SH1 A;  2CA5 A;  2LSI A;  5BP0 A;  3L09 A;  5AQL B;  4E7Z A;  3DP7 A;  4PJL A;  1ZOY A;  3C4W A;  4WV9 A;  4YSY A;  3H3A A;  3DJB A;  2N9D A;  5C2T A;  3J7Y q;  3HL6 A;  4XAX B;  2PBI A;  2YK0 A;  3FBZ A;  4KI0 F;  2Y6X A;  1XDO A;  4G2A A;  1SHZ C;  2PG8 A;  3OPC A;  2WSS V;  4HWC A;  4EZ1 A;  3E22 E;  4PJN A;  5AIN A;  4DV7 T;  4JI1 T;  1MMN A;  5LG3 A;  4A98 A;  3BQI A;  5TAO A;  1LVF A;  2WNJ A;  1KNZ A;  4ZZB A;  3C51 A;  3GUA A;  3WTM A;  4AXP A;  4TN7 B;  4ZI7 E;  2I0M A;  4ZK1 A;  2AE9 A;  5FXX A;  4EEB A;  2PJQ A;  4JI2 T;  2Q9Q C;  3PDY A;  1HF8 A;  3U78 A;  3C4Z A;  4TX5 A;  1HCI A;  4JI8 T;  3FZL B;  3SQ6 A;  3B13 A;  4DND A;  3C98 B;  3O4X E;  3HR0 A;  3C64 A;  3WAJ A;  4I0U A;  3LK3 B;  3LK2 B;  2NOX A;  4ADZ A;  2QRX A;  1XZY A;  2LHN A;  4U2Y A;  3AEC A;  4WBN E;  2NTY A;  2PFV A;  3LDQ B;  4A56 A;  4LFB T;  2J47 A;  1CUN A;  2VKH A;  4ZHQ E;  3VKH A;  2ZJV A;  2ZM6 T;  2CWY A;  4GKJ T;  1U5P A;  4I55 E;  1AJ3 A;  1ZEE A;  4X1K E;  5LHH B;  4AFG A;  3F31 A;  2XYS A;  3PUG A;  4JI5 T;  4X1I E;  5HCM A;  3T4M A;  3RKG A;  5LHI B;  5BRX A;  1MIY A;  4ILU A;  2A2F X;  3RIA A;  3P4W A;  2BKP A;  2XQ9 A;  4CN4 A;  4ERR A;  3Q9D A;  2W61 A;  2LSK A;  5LB7 B;  3MAC A;  2QYW A;  4BJM A;  2LT3 A;  1J5W A;  1E1H B;  5AFH A;  5C3J A;  5F3J A;  2CLY B;  3ZJ1 A;  2BKN A;  4ZR6 A;  3ZMZ B;  4AQF C;  3T1Y T;  2L3L A;  2KT9 A;  3CWZ B;  5CO5 A;  2VL8 A;  4H9P C;  2WQY A;  3A5X A;  5AQR B;  3KFW X;  1BR2 A;  2WN9 A;  3NKZ A;  2X0Y A;  3U8K A;  4EYU A;  4DBR A;  3IHR A;  2CWO A;  4IL4 A;  3UTK A;  3ZYL A;  3NBX X;  4FJO A;  2V5D A;  2H7O A;  1ZKE A;  4U31 A;  3ZSS A;  4IIJ E;  4EGW A;  2EHO A;  3AEE A;  2WBL A;  3QUJ A;  2JMH A;  5H6Q B;  1YQ3 A;  2QVA A;  4KBM B;  5J2U E;  1HNX T;  4QXB B;  2BS2 A;  3I0O A;  3P4Q A;  5BR8 T;  3ZYK A;  2BYP A;  1G8X A;  3ZT5 A;  2UXX B;  2ACX A;  5KXJ A;  3C84 A;  4B3R T;  3C50 A;  1ZHC A;  2CBI A;  4JEH B;  4LMK A;  2LRK A;  3F57 A;  1WR6 A;  5IYZ E;  4UV8 B;  2ACZ A;  2HN2 A;  2ZJU A;  1LKX A;  2WWU A;  3NVO A;  2DI4 A;  3L8R A;  2IAK A;  2NP9 A;  5CA1 E;  5LMU T;  2CM0 A;  5J2T E;  2QA7 A;  2M6B A;  2UZ6 A;  4XBF B;  4I4T E;  2WS3 A;  3TLT A;  3SWH A;  3A8Y C;  2ES0 A;  3HKB E;  4O4J E;  3P4P A;  2X67 A;  2XJ7 A;  4DVD A;  4AKL A;  4Q25 A;  4DR1 T;  1I9B A;  5HEJ A;  2W2U A;  2KXP B;  2LKH A;  3MA9 A;  2CPT A;  4ILC A;  3EDU A;  3RGL A;  4PK4 A;  2UUA T;  3AA0 B;  2LE8 A;  4F8H A;  3AEB A;  4YY3 T;  2WZI A;  2YOE A;  4EED A;  2VKD A;  4EAH A;  3ZMS B;  3VU7 H;  1YD8 G;  5CA0 E;  4ZJT A;  3FXD B;  1QUU A;  2BBJ A;  4TV8 E;  3PJA J;  5KX5 E;  3WTN A;  2V7M A;  5JR9 A;  1R8I A;  3T8O A;  2YDS A;  3EAB A;  1Y01 A;  5LGU B;  5FL0 A;  2KSR A;  2I6H A;  2WDQ A;  4YLH A;  2VQE T;  1X9B A;  1SE7 A;  4MFR A;  4C91 A;  2EHO B;  2H3R A;  4O4L E;  1XMO T;  3PJA A;  4I50 E;  3ESL A;  2RPA A;  3KBU A;  2H89 A;  3WTO A;  5AQG B;  4WYV A;  2A3D A;  4QAA A;  3PUZ F;  5LXT E;  4DUY T;  4GYR A;  5J5H A;  2UUC T;  5LCY A;  4UV9 B;  3H3M A;  2BDE A;  1HR0 T;  2WNC A;  3AE1 A;  4D01 A;  3BK9 A;  3UT5 E;  4IT4 A;  1IAP A;  2D9D A;  3AA1 B;  3WIP A;  3ZN1 B;  4ISS A;  5L3B B;  5FXW A;  3FBL A;  1UV6 A;  3FZM B;  1M62 A;  3ZPO A;  2W67 A;  4DID B;  3HKD E;  4WBO A;  2B76 A;  2ZM2 A;  5HXH A;  1LVK A;  3TLV A;  3AE2 A;  5ABE A;  4BA9 A;  2BYN A;  2CXF A;  2EHO D;  3U8N A;  4HWF A;  3VRA A;  3UU5 A;  2KND A;  4HFB A;  2GK9 A;  4PNI A;  3UU8 A;  3RRC A;  2BYQ A;  3AE7 A;  3LJC A;  4U3C A;  3UQ7 A;  2SPC A;  4UF0 A;  1EZ3 A;  2MOZ A;  4MBQ A;  3I1A A;  5JR9 B;  4HFV A;  3E08 A;  2Y56 A;  4H9O C;  2XNT A;  5AQT B;  2M6I A;  5AQN B;  4IE7 A;  1G73 A;  3WI3 A;  3UU6 A;  4LML A;  3AEG A;  5JVD E;  5M4Y A;  4HKA A;  4X20 E;  3WAK A;  5FY0 A;  5AQH B;  2XM1 A;  1I94 T;  4ZZC A;  5L3G B;  3EAM A;  5HCJ A;  4TWF A;  3UUL A;  1UCU A;  5J1G A;  2V6X A;  2E5V A;  4JEU B;  2Y8D A;  3UU3 A;  2V7I A;  4U7I A;  2V7L A;  1MIW A;  2LJL A;  3LBX A;  3PUV F;  4UEM A;  2VKJ A;  2K5B B;  4CN6 A;  3P4S A;  2YN6 A;  4O4I E;  4EZ4 A;  5LJM A;  2X9H A;  2BKO A;  2BBH A;  1E2A A;  4AKR B;  4KP3 C;  4FI5 A;  2VQF T;  4IDN A;  3H37 A;  3KDS E;  4WNK A;  4HQP A;  4EOZ B;  4MHC A;  5DQV A;  4DR6 T;  4H63 V;  3N2O A;  4DV6 T;  3MZK B;  2XAG B;  3RX6 A;  3IGQ A;  2KLQ A;  3PUR A;  4NXM T;  5JDH A;  2YU1 A;  1ZV4 X;  4QXH B;  3MKD A;  4QXC B;  2VK9 A;  4QHO A;  4YJ2 E;  4IE0 A;  5ABH A;  3WTK A;  1T8B A;  1MIV A;  1IJ5 A;  4YSX A;  3JAE A;  4UF0 B;  1N33 T;  4J2C A;  5J5I A;  3KBT A;  2CRB A;  4L9I A;  4X5T A;  2H88 A;  2LRL A;  1U4Q A;  1XNQ T;  3C4X A;  2IC9 A;  2VUR A;  4UVA B;  4UM3 P;  4CI1 B;  2J4G A;  3UUM A;  1D0Z A;  2V1D B;  1WRD A;  3AEF A;  4TWD A;  3AAI A;  4AQY T;  4ZK4 A;  1VOM A;  5L4E A;  3K3Q C;  4AFH A;  4O2B E;  2BR8 A;  3ZLI A;  4AIU A;  5EK3 A;  5E0O A;  4MAL A;  2V6Y A;  2JQQ A;  1KEY A;  3HA4 A;  4YTP A;  4A97 A;  5AFU L;  2LEH A;  4AI6 A;  4NPP A;  4HWI B;  2X0L B;  3UUN A;  2Y48 B;  3E0Z A;  3N5L A;  4OYJ A;  2W66 A;  5HXE A;  4U72 A;  3I9W A;  4UXN B;  1H7C A;  2IIU A;  4DR4 T;  3MXZ A;  1T7S A;  3QNU A;  4HWD A;  3LBX B;  3OTO T;  3FZH B;  3TKL B;  2JIW A;  3KVB A;  1HFA A;  2WY2 A;  1V9D A;  4ILA A;  1X79 A;  5FNV E;  3GA8 A;  3AAA B;  4ILB A;  5AQS B;  3KIN B;  5ABG A;  2V7J A;  2MYS A;  4TUY E;  3HKE E;  1N36 T;  2K3W A;  2NW7 A;  2ZM8 A;  2BVM A;  1IBL T;  2Y57 A;  2CXD A;  4DR7 T;  2X66 A;  3EHZ A;  3U8J A;  2XQ5 A;  3AE6 A;  2DLR A;  3EI0 A;  3AEA A;  5L47 A;  4ALX A;  1UUR A;  3Q5D A;  5FY7 A;  2W00 A;  4B5D A;  3ANW A;  2KWH A;  2OA5 A;  1WR0 A;  4QWN B;  2C5K T;  5HYA A;  4LF4 T;  4ZS2 A;  1WFD A;  3KVA A;  2VWA A;  5FY1 A;  1E7P A;  2HN1 A;  1BR1 A;  4DR2 T;  5AQQ B;  4TZ4 C;  3RIU C;  5DQW A;  4P1N A;  2XAQ B;  2R6G F;  2OLT A;  4ZS3 A;  3PU3 A;  4PIR A;  3IF8 B;  4DBQ A;  5AQF B;  2MAW A;  3R6N A;  4YT0 A;  1IJ6 A;  1D0X A;  5HXC A;  4X1Y E;  2BR7 A;  3ZC1 A;  1OWA A;  2V6Y B;  5L3D B;  2DL1 A;  4BFQ A;  2Q9Q D;  3KV4 A;  4YSZ A;  4H9Q C;  4X66 T;  3ABV A;  2IML A;  4YXD A;  4LF7 T;  4X64 T;  2WM9 A;  4F6R C;  2XQ6 A;  1NEK A;  2ZM0 A;  4GOU A;  4JLE A;  5HAX A;  1MMD A;  4DV4 T;  1XWM A;  4JBW F;  3SOL A;  2M67 A;  4NXN T;  4UVB B;  4V1A v;  3ZJ2 A;  2DNX A;  1S35 A;  3JCF A;  5ETW A;  3KV5 A;  1CHU A;  2N2N A;  1UGO A;  2A72 A;  2Y7Y A;  3AB3 B;  4ZI2 C;  1FMV A;  2IUB A;  3TLW A;  5JDN A;  3P4R A;  3O1H A;  4IE5 A;  3RYC E;  5IUX A;  3L39 A;  4JV5 T;  3LSV A;  2AXD S;  3ZT6 A;  3O9X A;  5LP6 E;  2LLY A;  4AKI A;  4ASK A;  5HWY A;  4LF6 T;  3ANW B;  3AAE B;  1YW0 A; 
#chains in the Genus database with same CATH homology
 5FJV A;  3U8M A;  2BYN A;  3WTI A;  4HFI A;  2KSR A;  3U8N A;  1OED B;  3UU5 A;  4PIR A;  4ZRU A;  2MAW A;  5HEH A;  2Y58 A;  4HFB A;  4QH5 A;  3ZDH A;  3RI5 A;  3UU8 A;  2BG9 A;  2BYP A;  4DBM A;  3RIF A;  4AFG A;  2PGZ A;  2X00 D;  5AFJ A;  4WV9 A;  2LKG A;  3ZDG A;  4TNV A;  4HQP A;  2BYQ A;  2XYS A;  3UQ7 A;  2BR7 A;  5HEG A;  4FRR A;  5HCM A;  5BW2 A;  4HFD A;  4QH1 A;  4COF A;  2WNL A;  3C84 A;  3T4M A;  4BFQ A;  3WTH A;  4HFH A;  1UX2 A;  4TWH A;  4LMK A;  5BRX A;  3P50 A;  4UXU A;  5L4H A;  3IGQ A;  4ILA A;  2XQ8 A;  4NZB A;  2X00 A;  2Y56 A;  4BQT A;  1OED E;  2ZJU A;  3PEO A;  4ILB A;  3RIA A;  1OED C;  3P4W A;  2BJ0 A;  2XNT A;  3PMZ A;  3WTO A;  5HEO A;  3TLU A;  5J5F A;  2M6I A;  3SIO A;  2XQ9 A;  2XQ6 A;  3TLS A;  4UY2 A;  2YKS A;  4QAA A;  5AFL A;  2BG9 B;  5J0Z A;  4EZ1 A;  3WTK A;  3UU6 A;  2M6B A;  3RQW A;  2UZ6 A;  4LML A;  3TLT A;  3UQ4 A;  5J5G A;  3U8L A;  2XQ4 A;  4ZJS A;  2LM2 A;  5AIN A;  3JAE A;  2Y57 A;  5AFH A;  5J5H A;  5TVC A;  5JME A;  2W8F A;  4IL9 A;  5LG3 A;  4ZR6 A;  2VL0 A;  4A98 A;  2BYR A;  3EHZ A;  3U8J A;  5J5I A;  2XQ5 A;  2WNJ A;  3EI0 A;  5CFB A;  2XYT A;  4XHE A;  2XQA A;  4ZZB A;  4X5T A;  5L47 A;  4QH4 A;  5HEJ A;  1I9B A;  2XQ7 A;  3GUA A;  5CO5 A;  3SQ9 A;  3WTM A;  4ALX A;  2WNC A;  4ZK1 A;  2LKH A;  4QAC A;  4ZZC A;  4D01 A;  4ILC A;  5AFK A;  2BG9 E;  3EAM A;  4HFC A;  2W8G A;  4HFE A;  5HCJ A;  2BG9 C;  2WZY A;  4UM3 P;  5AFN A;  4B5D A;  5KE4 A;  4AFT A;  4IRE A;  5HEU A;  4TWF A;  4UM3 S;  2Y7Y A;  4UM3 A;  2WN9 A;  2PH9 A;  3SQ6 A;  5SYO A;  4F8H A;  3U8K A;  2XQ3 A;  4TWD A;  3C79 A;  2XNV A;  4ZK4 A;  3WIP A;  3TLW A;  2YME A;  3ZKR A;  5L4E A;  3RHW A;  2YOE A;  4AFH A;  2BR8 A;  1UW6 A;  4TNW A;  1OED A;  4IL4 A;  4Z90 A;  3UU3 A;  4LMJ A;  4Z91 A;  2YMD A;  5IUX A;  1UV6 A;  2XNU A;  3WTJ A;  3LSV A;  4ZJT A;  2XZ5 A;  3JAD A;  2QC1 B;  2Y54 A;  3JAF A;  5KZU A;  3WTL A;  4A97 A;  2BYS A;  2XZ6 A;  2LLY A;  3WTN A;  2YN6 A;  4UM1 A;  3UU4 A;  4NPP A;  5AFM A;  3SH1 A;  3TLV A;  4QAB A;  3UUB A;  5LXB A;  2C9T A;  2ZJV A;  5AFM B;  3RQU A;  4XK9 A;  5BP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...