3UU5A

The glic pentameric ligand-gated ion channel loop2-20' mutant reduced in solution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVECNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu5A01
2QC1B 4QH5A 3TLUA 2BR7A 4EZ1A 4IL4A 4TWHA 1OEDA 5JMEA 4HFHA 4PIRA 4A97A 3UQ7A 3PEOA 5AFMA 5HEHA 3P4WA 4QACA 2XNTA 2UZ6A 2PGZA 4UM3P 2XZ6A 4BFQA 5LG3A 4ZRUA 3UU5A 4UM3S 2BYNA 5L4EA 3WTKA 2YKSA 4DBMA 3SIOA 2XQ3A 2BG9C 2BR8A 3JAEA 5J5HA 4HFIA 2M6IA 2Y7YA 3WTIA 4ILAA 3TLSA 4UM1A 3U8JA 4IL9A 3EI0A 3WTJA 5AFKA 3IGQA 4ZK1A 5HEGA 5AINA 5TVCA 4UXUA 5L47A 3UQ4A 2BJ0A 4HFDA 2BG9B 5AFNA 4FRRA 4XK9A 2XQ5A 2PH9A 5J5GA 4AFHA 1I9BA 5HEUA 4QH1A 2BYRA 4AFGA 4QABA 2BG9E 4HFBA 2Y57A 4ZJSA 4ZK4A 4F8HA 2Y58A 5HEOA 3U8NA 4TNWA 5KZUA 2XQ7A 2W8GA 2KSRA 2WNLA 4ALXA 2WNCA 3U8KA 4QH4A 4HFEA 2XQ9A 3RIAA 4TWFA 2VL0A 2ZJUA 3WTHA 5AFJA 5SYOA 4ZJTA 5BRXA 1UX2A 2W8FA 2LKGA 4ZR6A 5CFBA 5AFHA 2BG9A 3UU6A 2XYSA 2WZYA 2BYPA 4B5DA 5HCJA 5AFLA 2X00A 3RHWA 4A98A 2XQAA 2LKHA 4X5TA 3WTOA 3EAMA 3TLVA 3U8LA 4XHEA 3SQ9A 2Y54A 3SH1A 2WNJA 4IREA 1UV6A 3UU8A 3UUBA 5J0ZA 2XYTA 3ZDHA 2XQ4A 4TNVA 5L4HA 3WTNA 4Z90A 1OEDC 5HCMA 5BW2A 5CO5A 4Z91A 4NPPA 2XQ6A 4COFA 5LXBA 4HFCA 2YN6A 2MAWA 5IUXA 5FJVA 2X00D 2YMDA 3WTLA 3T4MA 2BYSA 2WN9A 5J5FA 4ZZBA 4LMJA 4LMKA 3RQWA 1OEDB 1UW6A 3TLTA 5AFMB 3UU3A 3SQ6A 4QAAA 4HQPA 5HEJA 1OEDE 4ZZCA 2ZJVA 3GUAA 3PMZA 5BP0A 3U8MA 2M6BA 4D01A 4UY2A 3WTMA 3JAFA 3C79A 2Y56A 4BQTA 2LLYA 3LSVA 2XNUA 4NZBA 3TLWA 2YOEA 2XNVA 5J5IA 4ILBA 4WV9A 2YMEA 3WIPA 4TWDA 3JADA 2XZ5A 3ZKRA 2C9TA 2LM2A 4AFTA 3P50A 3RIFA 3ZDGA 4LMLA 3C84A 4UM3A 3RI5A 3RQUA 5KE4A 3EHZA 2BYQA 2XQ8A 4ILCA 3UU4A
chains in the Genus database with same CATH superfamily
3R84B 2A2FX 4QH5A 4TWHA 3PUQA 4HTEA 4DVDA 2PGZA 1LKXA 3LK2B 3PUVF 2BYNA 2CPTA 2YKSA 3OKQA 3I1AA 2FJDA 4EAHA 4EV6A 4HFIA 3DJBA 4UVAB 2ACXA 1KNRA 2Q9QC 2XQ5A 4DV4T 3NWIA 3U8NA 3N2KE 1T8BA 3N9NA 3ZMZB 2XPKA 2WNLA 2KT9A 2UXXB 5HWXA 3RIAA 3RYHE 2VVNA 2DL1A 2X68A 3PJAA 3PUYF 3KDSE 2BG9A 4YSZA 3OYXA 4UVBB 4EXTA 2CBIA 3BQLA 4YFSA 4GIWA 3WAKA 3WAJA 2CXLA 1U5PA 4AKRB 2ZM8A 3ESLA 1WR6A 5JDLA 3EDUA 5HCMA 5BW2A 5CO5A 3PUXF 1SE7A 3ONLC 4HFCA 3PUSA 2YN6A 2WN9A 3SQ6A 2MYSA 5BP0A 4DV5T 2V6YA 4JYAT 2D5UA 3TLWA 2YOEA 2XSBA 2MTQA 2ACZA 2YDSA 2N9DA 2L8KA 3VRAA 2NW9A 1G8XA 1N34T 3LJCA 4UV9B 4DBRA 2F4VT 3QNUA 3U3IA 5FXWA 4DBMA 3RYCE 3W15B 2WCAA 2XQYA 3AEGA 3IGQA 4N78D 3P7IA 3RGLA 2RP4A 4I43B 3MACA 1D1BA 5LHHB 5EK2A 3B13A 1M7KA 1WR0A 4ZJSA 4E7ZA 2CWYA 2B76A 2L3LA 3ANWB 1XNRT 2BS2A 2X67A 2WNCA 2X0YA 1MMNA 2MPKA 2DCFA 4QWNB 2V1DB 4GK5E 1T72A 2JQHA 3RC3A 2RPAA 3UU6A 2BYPA 4DO0A 4ADZA 4DR2T 5H6QB 3AA1B 2H7OA 2LSGA 2WNJA 2CXDA 3UTKA 2XUEA 5FXVA 3GMIA 1ZKEA 4Z90A 2OV9A 2WM9A 1N33T 3IBPA 5FVLA 4ZZBA 3PU8A 2EHOA 2NP9A 1U4QA 4PAGA 5LJNA 3CQXC 2Y48B 3NKZA 3HKEE 3C79A 2YMEA 2XTLA 2NWBA 2WP9A 2LSYA 2J1DG 4MLKA 2D0UA 4NXNT 4U7YA 2KNDA 2V7JA 3O1JA 5HXHA 4WZXA 3FZMB 4PJNA 4JI0T 3A8YC 2LEHA 2V5DA 4JI1T 4AKGA 4EOZB 3U8JA 2LHNA 2WQYA 4IL9A 1XZYA 4O2AE 5AQRB 3EABA 4PJJA 3N9LA 3AA7B 2X9WA 2PH9A 3HR0A 3M65A 1MMDA 4DV0T 4OFZA 4UELA 2QVAA 4TWFA 3S4UA 3KINB 4U2YA 3ZMUB 4CI3B 2JQQA 3PUWF 2C0SA 3N5LA 4CI2B 4TUYE 1XMQT 5ABGA 3KVBA 3RQWA 4ZOLE 2FJAA 1UW6A 3SS1A 4U72A 2K5BB 2XM2A 3KV9A 1OEDE 4YY3T 4UR9A 3ZN1B 3T8OA 3A5XA 5HXSA 2LLYA 3PURA 4CN6A 4WV9A 1VRBA 2KINB 3AEAA 4JBWF 3EHZA 3R6NA 3UU4A 2QC1B 2AE9A 4QXHB 3OVUA 5IHYA 4OYKA 1BR1A 2E9XC 2C5JA 2CE7A 2VWAA 3K1SA 4O4LE 4LF6T 1HS7A 3HKDE 2X9XA 1FJGT 4JV5T 2CMRA 1WYCA 3NVOA 4HWDA 1WLXA 2CRBA 4F8HA 1W0BA 5JDNA 5KZUA 3M3ZB 4CN1A 3RC8A 4U74A 2BKPA 2LHRA 2PBIA 2ZJUA 5AFJA 4ZR6A 2P9BA 1KK7A 2XSAA 3RHWA 3PUAA 4ASKA 1EZ3A 3TLVA 3AEDA 3A7MA 3F2EA 4GOUA 2HPLA 4XAXB 4DV1T 5HXRA 4ZI2C 5LHGB 4TX5A 3HKCE 2I6HA 5JVDE 3H3AA 5AQVB 2VQET 2JJ9A 3TLTA 3CKDA 2W00A 1X9BA 4J2CA 3C51A 4WYVA 3SWHA 2HN1A 3AE1A 1ZP0A 5J2TE 1KFYA 3ZJ1A 4DR6T 3C84A 4HWHA 3TLUA 3VU7H 3AEEA 2D2SA 1M62A 2XZEA 3AEFA 2BKOA 4PK6A 3UQ7A 3PEOA 2V26A 4I4TE 2JQKA 3IHRA 2BVLA 1MNEA 3AE6A 3J7Yq 1X79A 3Q5WA 1N32T 3AXJA 5LA6E 4EB6E 2DWKA 5L3EB 4ZK1A 2N2NA 5IYZE 2BJ0A 2VK9A 4AKHA 2KWIB 5J5GA 3NRXA 4DUYT 1HG2A 5DQWA 1HCIA 4HFBA 3SRZA 5FL1A 1E1HB 2KSRA 2ZM2A 2X0LB 3V5SA 4L5GA 3IEEA 4ZJTA 4KI0F 4ANJA 4AISA 2WZYA 2JPFA 4KMCA 5L3CB 1ZEEA 5ABFA 3WTOA 4YHHT 2W61A 3SH1A 4IREA 3UUBA 3FZFB 3AEBA 3WTNA 2WBLA 3Q5XA 1IZNB 4HWIB 3RRWA 5IWAT 3ZN0B 1S35A 3LBXA 4X1KE 4PK5A 4P0BA 1FEWA 2BKNA 3UU3A 4ZZCA 1J5WA 3FZHB 1Z8UA 3JAFA 2E8IA 4HN9A 4DR5T 1W9RA 5HWYA 4WBNE 2C9TA 1I6ZA 4LFCT 3HI2A 4YHJA 3LG7A 4B6XA 2BYQA 3T1YT 2KMFA 3MA9A 2D0TA 5H6RB 3N9MA 3G06A 4PIRA 4A97A 3ZPOA 2VASA 5HYAA 4NIQA 4BJMA 1ZV4X 4O2BE 2CXFA 3WTKA 2K48A 2BG9C 5AQJB 2E9XB 4TV8E 2BBHA 4ISSA 3N9QA 3GN5B 5AFNA 3QB5K 4JI6T 3F31A 5J2UE 2ZLYA 2LRKA 3ANWA 1CHUA 2VB6A 4JI8T 4WBOA 2DNXA 3JCFA 2W8FA 4LF5T 3ZYMA 5AFHA 5L3GB 5AQMB 4BJNA 4ISTA 2CCQA 2NR4A 1AJ3A 2YK0A 2KZ7B 1QSDA 3AE3A 2E9XD 5CGMA 3FBZA 2A3DA 1WFDA 1XWMA 3E0ZA 3MZKB 4C90A 3ZMVB 5FYMA 3ZT7A 4YSYA 3RLFF 3VKGA 4DR7T 5LB7B 1SUMB 1JNZA 2ZJVA 2DWGA 5LHIB 3CX6B 1HNXT 1Y64B 4YLHA 4DV6T 2YDQA 3WI3A 5CJ5A 4AQFA 2WZIA 2PTFA 2YINA 3RIFA 1IBKT 2LOPA 4A56A 2CEAA 2H88A 2JIWA 4JUYA 5JRCB 3OTOT 4QACA 4HGAA 5CB4E 4EZ4A 3C4XA 5JTGA 4UXNB 2WB5A 5L4EA 4UIGA 4ZI2D 3VR9A 4UM1A 3QUJA 4ZEYA 2JMKA 5AINA 5JQGE 3PTRB 3PUGA 4CXXA 2WDVA 4IE0A 4ZK4A 4TNWA 4JLEA 3ZT5A 1H7CA 3EDVA 4JEUB 4JI2T 1D1CA 2EHOC 3O1HA 3AAEB 4HWCA 1XDPA 1UX2A 4IDPA 5L3DB 5LNKA 2QGSA 2XY8B 2X00A 3Q5DA 4X65T 4IDNA 2XAJB 2UUAT 2SPCA 3LDQB 3NZPA 2UXNB 2ZMAA 2LJLA 4H9OC 4COFA 3HL6A 1HR0T 5IUXA 4JI5T 2K9AA 5CA0E 2FBWA 4HKAA 4DR3T 2J47A 4TZ4C 3Q9DA 2NOXA 4K0KT 3CPZA 3NRYA 4MALA 2A72A 4IT4A 5J0ZA 3VRBA 5JDMA 4UEMA 2BR7A 3UFGA 1YD8G 4IDQA 3FZLB 1OEDA 3O9XA 2UZ6A 4TV9E 4X20E 3UU5A 5AQUB 4WW0A 3JC6D 4I0UA 2XAGB 2AXDS 2CHNA 2WY2A 1IAPA 3SOLA 3FBLA 4O4HE 3RKOA 5DJQC 1UGOA 3AE4A 3KVAA 2V7IA 2BG9B 4AIUA 4UVCB 3C50A 4P1NA 5LGUB 4X62T 5LJMA 3CWZB 4PJLA 1HG5A 5AFUL 5BMVE 4HFEA 3RIUA 5AQTB 3MJXA 4BAYB 4JI7T 5LXTE 4H9PC 4LF9T 2QA7A 1WYBA 2X66A 2IIUA 3C4ZA 4X66T 5BRXA 3AE2A 5LYJE 2M67A 5HCJA 2XASB 2LRLA 5JDHA 2V6YB 4XHEA 4B3RT 1UV6A 2Q9QB 4OX9T 4CQIA 2V6XA 2IAKA 5JR9A 5FXXA 4IIJE 4NUVA 4KX6A 5J5FA 4LMKA 3I0QA 4MHCA 3ONJA 4QAAA 5HEJA 3ZMSB 5JDQA 4P09A 4YSXA 2CLYC 4ZI3C 1HNWT 2VQFT 5JDGA 4L9IA 5F8PA 2WAUA 1MNDA 1HF8A 4LMLA 3RI5A 2WZHA 4EZ1A 3Q5EA 5JMEA 1IJ5A 2Q9QD 3GWHA 3OJAA 4H9SE 4HEAA 1KNZA 4YT0A 3CX7B 3KBTA 5LCYA 3QB5A 1XDOA 3CVRA 4IE6A 1D1AA 1HFAA 4U7IA 2Y7YA 2WMOA 4NUUA 5J1GA 2FUPA 4UXUA 4LFBT 4FJOA 2H7VC 3IF8B 4HFDA 4I55E 4TN7B 1I9BA 5FKYA 2BYRA 4AFGA 5GONE 2RA1A 4CZZB 2LSJA 5A1LA 4DV2T 3KFWX 4QH4A 2CWOA 3VR8A 4ZS2A 1R8IA 2N1GA 3F57A 3CQGB 3WTHA 5LGNB 5SYOA 1E2AA 3Q2MA 2EHOB 4UV8B 4QKNA 2K24A 4OHFA 1YXRA 1N36T 3O1IA 4K0UA 2CA5A 4HE8A 3ZDHA 1E7PA 2LOSA 4CXWA 4MBQA 3ZSSA 5AQSB 2VL8A 4UF0A 2J4GA 3PMZA 2PG8A 4UY2A 1I94T 2ZM0A 4YTMA 2EHOD 3K3QC 3N2OA 4HWFA 2X9HA 3AA6B 5ABHA 3P50A 3RX6A 3RQUA 4O4IE 2W4XA 2PJQA 5AFMA 3ZC1A 3BQKA 3K3OA 2DLRA 3UT5E 3N2GE 4UM3P 4LF8T 3KV4A 3P8CD 3RF1A 2YU1A 4LFAT 3I9WA 3SIOA 2IC9A 2Y6XA 2WDQA 2BDEA 5L47A 2X51A 4DV7T 4QABA 5LMUT 2W8GA 4IE7A 5LGTB 4H9RC 4C91A 4O4JE 3LK42 4ZI7E 5E0OA 1UUSA 4YJ2E 4AI6A 4H9QC 5F3JA 1LVKA 2LKGA 4B3TT 1SA0E 5AQLB 3EAMA 3U8LA 3ZMTB 3SQ9A 3OBVE 3UU8A 3IA3A 3KV6A 4TNVA 5L4HA 4XBFB 1FMVA 2VKOA 5L3FB 4Z91A 3QOFA 2MAWA 3KBUA 1UX4A 2D9DA 3T4MA 3ZSTA 2VURA 2MOZA 3N9PA 4FI5A 5FMNA 4X64T 1D0YA 3E08A 2CLYB 4IL4A 3V5UA 4KHPT 1WCRA 5JRCA 2UUCT 3C64A 2LM9A 3H37A 2ZM6T 5KX5E 2XNTA 3EUHA 3CX8B 4BFQA 3FHNA 4YTPA 2VVSA 2YEVC 4ZXLA 3I9YA 3PU3A 4EYUA 3ZLIA 2BR8A 3JAEA 3EI0A 2BS4A 3WTJA 1MMAA 2IHR1 1YQ4A 1BR0A 3I0OA 4XK9A 4F6RC 3UUMA 1VOMA 2WDRA 4ZI3D 2UXDT 5LP6E 2KWHA 3RRCA 3FXEB 4GYSA 2X0HA 1W0AA 2V5CA 2UU9T 5AFLA 3RYFE 4AQFC 2IDOB 1MIWA 3DTOA 4ZS3A 5DABA 2NTXA 4H63H 4OYJA 2FJEA 2HN2A 2YMDA 4X1IE 3FXDB 2Z6EA 5C8YE 4LMJA 5F5WA 5AQIB 2G0UA 4ILUA 2QRXA 4LF4T 3WTMA 2DHRA 5J5IA 3AE7A 3L3PA 4ILBA 5DQVA 3ZKRA 2LM2A 2IUBA 5AQQB 3AXJB 3X1DA 1HX1B 4IGUA 1UK5A 1NWMX 3BQIA 1G73A 4MFRA 4EYYR 3P4SA 2WS3A 5C2TA 1J5ET 3ZC0A 5ETWA 3LFMA 1YKHB 4IDZA 1BR4A 5AFKA 2KLQA 1UX5A 1HTJF 2ES0A 5KXJA 1T7SA 4I50E 1V9DA 2HPJA 2OA5A 1FMWA 4U33A 1OWAA 1VCTA 3PDYA 5ABFB 2Y58A 5FVKA 5HEOA 1LVFA 1KNPA 2XQ7A 4DMWA 2LSIA 1NAFA 2W66A 2V7LA 1T98A 3FB2A 4AKLA 3AAIA 3MK7C 4ERRA 3LBXB 4XZCA 1HX8A 1ZOYA 4G63A 4PNIA 3SFDA 3E22E 5AQNB 4PK4A 4AKIA 2Q9QA 2BBJA 2BVMA 5FY1A 2CHOA 1OEDC 3RH3A 2H3RA 5FY7A 3VKHA 4QHOA 5LBMA 4PFPA 2IMLA 4EEBA 3H3MA 1SHZC 3C98B 4D01A 3FZKB 3LSVA 4L0RA 1VCSA 4NZBA 3AE8A 3AVSA 4TWDA 2VKJA 1UCUA 3MKDA 5LBQB 4AFTA 2E5LT 4DV3T 2I0MA 2LT3A 1WRDA 5AQHB 5HEHA 4GKJT 2I59A 3RIUC 5KDMC 2XZ6A 2ODUA 5LG3A 4ZRUA 1FIOA 3AVRA 4U3CA 4GKKT 4PJMA 4DNDA 5L2LA 3UQ4A 4Q25A 3UFEA 2HH7A 4FRRA 3ZCIA 3OYZA 4AFHA 2NW7A 5FY0A 5JR9C 2BG9E 5JDFA 4ALXA 3U8KA 4IDOA 2XQ9A 3ONXA 5HXCA 2UXCT 3BK9A 4H9NC 4HFVA 3UULA 3N9OA 2V7MA 5LOVE 5AQKB 2LSKA 5FXZA 4EEDA 2Y8DA 2JQ9A 4WNKA 2W2UA 1IBLT 4BA9A 3WTLA 1NEKA 5C3JA 4KP3C 3HA4A 1UURA 4A5XA 1CUNA 4Z8XA 4EZHA 2HHHT 5FP3A 3RYIE 1ZHCA 2Y56A 4ZHQE 2L9QA 4O8SA 5LG4A 2H89A 5HXEA 5JH7E 1W09A 4DMVA 4P0AA 4HFHA 2XJ7A 1B7TA 3EVYA 5TAOA 2NW8A 4X1YE 5HAXA 2VKDA 2M6IA 1QLBA 4ILAA 3TLSA 1Y01A 1XMOT 2A9UA 4LF7T 1DU2A 3K3NA 4G2AA 3OPCA 5LMNT 3QK6A 3RKGA 3KV5A 5EK4A 3ZYKA 2WU2A 5HEUA 5CA1E 4QH1A 2V8SV 3CK6A 2BZBA 4JI3T 3K8PC 4YTNA 4AXPA 4GK0E 4JEHB 2XHEB 3DP7A 4QX8B 2WMNA 5AQGB 2XYSA 2W0GA 1KEYA 4KBMB 4YJ3E 2KXPB 1OXZA 1QUUA 2FJBA 2XQAA 2LKHA 4X5TA 5ADXL 3B57A 3O4XE 2XQ4A 4QXBB 4CXYA 4EIWA 2JMHA 4H63V 4NPPA 3AAAB 5FL0A 5L3BB 5FJVA 2X00D 2DI4A 2BS3A 4AQYT 3NBXX 1YKEB 1OEDB 3GUAA 1NENA 2CBJA 3L09A 1S94A 1D0XA 2XM1A 3JADA 2YDRA 2XAHB 4JI4T 3MXZA 3L8RA 5EZYE 4DUZT 1O3XA 4ILCA 1KF6A 4UM3S 1GQEA 2XQ3A 3LK3B 3WTIA 2MBGA 5AQOB 3AE5A 2IC6A 5FNVE 5TVCA 3SFEA 2WWVA 4V1Av 4E7SA 3C4WA 2WWUA 3TKLB 2XAQB 2ODVA 4KHZF 3PUZF 5JR9B 2VL0A 2E9XA 3PV0F 4OK0A 5BR8T 2V7KA 2B1EA 2JRKA 3GN5A 3ZYLA 1Z0PA 4B5DA 3ZT6A 4A98A 2IW5B 3ZCJA 3AECA 2GK9A 2UXBT 2XYTA 4DIDB 1BR2A 4DBQA 4AQGA 1IBMT 1XNQT 2UUBT 4CI1B 5JREA 4QXCB 4QX7B 3UUXB 3HKBE 4HQPA 2CM0A 2R6GF 2VKHA 3U8MA 3QC9A 3VHLA 2XNVA 3WIPA 2C5IT 3ZJ2A 4PFOA 4NXMT 5AQPB 3PJAJ 4UM3A 3T1HT 1LRZA 2PFVA 3ZEFB 3U78A 3AE9A 3B5MA 3P4WA 2QYWA 4B3MT 3UUNA 2OLTA 4YXDA 4B3ST 4DR1T 1MIYA 1D0ZA 3CQCB 5J5HA 2J62A 3P4RA 3CMLA 2YU2A 3AB3B 5HEGA 2E2AA 3AA0B 2X9YA 4U31A 4IE4A 4DR4T 3J9X1 2K3WA 1MMGA 2Y57A 3GA8A 2W67A 3P4QA 5AQFB 2C5KT 3JC6C 5ABEA 1MIVA 3CIRA 3RPUA 3P4PA 1YQ3A 4PW8A 4U2ZA 4IE5A 3PE0A 4M1PA 5CFBA 4GYRA 2E5VA 5M4YA 2W63A 4UF0B 3ABVA 3D0TA 2Y54A 4EGWA 3L39A 4CN4A 2WU5A 5LXBA 2XQ6A 5EK3A 2XAFB 2BYSA 2W62A 4KUMB 5AFMB 1IJ6A 2M6BA 1YW0A 5KMGP 2WSSV 3ETVA 4BQTA 2XNUA 1HNZT 4IHJE 1J1JA 1US7B 2XZ5A 3ETUA 3NZQA 1JNRA 3ZDGA 2LE8A 2NTYA 5KE4A 1L0VA 2XQ8A
chains in the Genus database with same CATH topology
2QC1B 4QH5A 3TLUA 2BR7A 4EZ1A 4IL4A 4TWHA 1OEDA 5JMEA 4HFHA 4PIRA 4A97A 3UQ7A 3PEOA 5AFMA 5HEHA 3P4WA 4QACA 2XNTA 2UZ6A 2PGZA 4UM3P 2XZ6A 4BFQA 5LG3A 4ZRUA 3UU5A 4UM3S 2BYNA 5L4EA 3WTKA 2YKSA 4DBMA 3SIOA 2XQ3A 2BG9C 2BR8A 3JAEA 5J5HA 4HFIA 2M6IA 2Y7YA 3WTIA 4ILAA 3TLSA 4UM1A 3U8JA 4IL9A 3EI0A 3WTJA 5AFKA 3IGQA 4ZK1A 5HEGA 5AINA 5TVCA 4UXUA 5L47A 3UQ4A 2BJ0A 4HFDA 2BG9B 5AFNA 4FRRA 4XK9A 2XQ5A 2PH9A 5J5GA 4AFHA 1I9BA 5HEUA 4QH1A 2BYRA 4AFGA 4QABA 2BG9E 4HFBA 2Y57A 4ZJSA 4ZK4A 4F8HA 2Y58A 5HEOA 3U8NA 4TNWA 5KZUA 2XQ7A 2W8GA 2KSRA 2WNLA 4ALXA 2WNCA 3U8KA 4QH4A 4HFEA 2XQ9A 3RIAA 4TWFA 2VL0A 2ZJUA 3WTHA 5AFJA 5SYOA 4ZJTA 5BRXA 1UX2A 2W8FA 2LKGA 4ZR6A 5CFBA 5AFHA 2BG9A 3UU6A 2XYSA 2WZYA 2BYPA 4B5DA 5HCJA 5AFLA 2X00A 3RHWA 4A98A 2XQAA 2LKHA 4X5TA 3WTOA 3EAMA 3TLVA 3U8LA 4XHEA 3SQ9A 2Y54A 3SH1A 2WNJA 4IREA 1UV6A 3UU8A 3UUBA 5J0ZA 2XYTA 3ZDHA 2XQ4A 4TNVA 5L4HA 3WTNA 4Z90A 1OEDC 5HCMA 5BW2A 5CO5A 4Z91A 4NPPA 2XQ6A 4COFA 5LXBA 4HFCA 2YN6A 2MAWA 5IUXA 5FJVA 2X00D 2YMDA 3WTLA 3T4MA 2BYSA 2WN9A 5J5FA 4ZZBA 4LMJA 4LMKA 3RQWA 1OEDB 1UW6A 3TLTA 5AFMB 3UU3A 3SQ6A 4QAAA 4HQPA 5HEJA 1OEDE 4ZZCA 2ZJVA 3GUAA 3PMZA 5BP0A 3U8MA 2M6BA 4D01A 4UY2A 3WTMA 3JAFA 3C79A 2Y56A 4BQTA 2LLYA 3LSVA 2XNUA 4NZBA 3TLWA 2YOEA 2XNVA 5J5IA 4ILBA 4WV9A 2YMEA 3WIPA 4TWDA 3JADA 2XZ5A 3ZKRA 2C9TA 2LM2A 4AFTA 3P50A 3RIFA 3ZDGA 4LMLA 3C84A 4UM3A 3RI5A 3RQUA 5KE4A 3EHZA 2BYQA 2XQ8A 4ILCA 3UU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QC1 B;  4QH5 A;  3TLU A;  2BR7 A;  4EZ1 A;  4IL4 A;  4TWH A;  1OED A;  5JME A;  4HFH A;  4PIR A;  4A97 A;  3UQ7 A;  3PEO A;  5AFM A;  5HEH A;  3P4W A;  4QAC A;  2XNT A;  2UZ6 A;  2PGZ A;  4UM3 P;  2XZ6 A;  4BFQ A;  5LG3 A;  4ZRU A;  3UU5 A;  4UM3 S;  2BYN A;  5L4E A;  3WTK A;  2YKS A;  4DBM A;  3SIO A;  2XQ3 A;  2BG9 C;  2BR8 A;  3JAE A;  5J5H A;  4HFI A;  2M6I A;  2Y7Y A;  3WTI A;  4ILA A;  3TLS A;  4UM1 A;  3U8J A;  4IL9 A;  3EI0 A;  3WTJ A;  5AFK A;  3IGQ A;  4ZK1 A;  5HEG A;  5AIN A;  5TVC A;  4UXU A;  5L47 A;  3UQ4 A;  2BJ0 A;  4HFD A;  2BG9 B;  5AFN A;  4FRR A;  4XK9 A;  2XQ5 A;  2PH9 A;  5J5G A;  4AFH A;  1I9B A;  5HEU A;  4QH1 A;  2BYR A;  4AFG A;  4QAB A;  2BG9 E;  4HFB A;  2Y57 A;  4ZJS A;  4ZK4 A;  4F8H A;  2Y58 A;  5HEO A;  3U8N A;  4TNW A;  5KZU A;  2XQ7 A;  2W8G A;  2KSR A;  2WNL A;  4ALX A;  2WNC A;  3U8K A;  4QH4 A;  4HFE A;  2XQ9 A;  3RIA A;  4TWF A;  2VL0 A;  2ZJU A;  3WTH A;  5AFJ A;  5SYO A;  4ZJT A;  5BRX A;  1UX2 A;  2W8F A;  2LKG A;  4ZR6 A;  5CFB A;  5AFH A;  2BG9 A;  3UU6 A;  2XYS A;  2WZY A;  2BYP A;  4B5D A;  5HCJ A;  5AFL A;  2X00 A;  3RHW A;  4A98 A;  2XQA A;  2LKH A;  4X5T A;  3WTO A;  3EAM A;  3TLV A;  3U8L A;  4XHE A;  3SQ9 A;  2Y54 A;  3SH1 A;  2WNJ A;  4IRE A;  1UV6 A;  3UU8 A;  3UUB A;  5J0Z A;  2XYT A;  3ZDH A;  2XQ4 A;  4TNV A;  5L4H A;  3WTN A;  4Z90 A;  1OED C;  5HCM A;  5BW2 A;  5CO5 A;  4Z91 A;  4NPP A;  2XQ6 A;  4COF A;  5LXB A;  4HFC A;  2YN6 A;  2MAW A;  5IUX A;  5FJV A;  2X00 D;  2YMD A;  3WTL A;  3T4M A;  2BYS A;  2WN9 A;  5J5F A;  4ZZB A;  4LMJ A;  4LMK A;  3RQW A;  1OED B;  1UW6 A;  3TLT A;  5AFM B;  3UU3 A;  3SQ6 A;  4QAA A;  4HQP A;  5HEJ A;  1OED E;  4ZZC A;  2ZJV A;  3GUA A;  3PMZ A;  5BP0 A;  3U8M A;  2M6B A;  4D01 A;  4UY2 A;  3WTM A;  3JAF A;  3C79 A;  2Y56 A;  4BQT A;  2LLY A;  3LSV A;  2XNU A;  4NZB A;  3TLW A;  2YOE A;  2XNV A;  5J5I A;  4ILB A;  4WV9 A;  2YME A;  3WIP A;  4TWD A;  3JAD A;  2XZ5 A;  3ZKR A;  2C9T A;  2LM2 A;  4AFT A;  3P50 A;  3RIF A;  3ZDG A;  4LML A;  3C84 A;  4UM3 A;  3RI5 A;  3RQU A;  5KE4 A;  3EHZ A;  2BYQ A;  2XQ8 A;  4ILC A;  3UU4 A; 
#chains in the Genus database with same CATH topology
 3R84 B;  2A2F X;  4QH5 A;  4TWH A;  3PUQ A;  4HTE A;  4DVD A;  2PGZ A;  1LKX A;  3LK2 B;  3PUV F;  2BYN A;  2CPT A;  2YKS A;  3OKQ A;  3I1A A;  2FJD A;  4EAH A;  4EV6 A;  4HFI A;  3DJB A;  4UVA B;  2ACX A;  1KNR A;  2Q9Q C;  2XQ5 A;  4DV4 T;  3NWI A;  3U8N A;  3N2K E;  1T8B A;  3N9N A;  3ZMZ B;  2XPK A;  2WNL A;  2KT9 A;  2UXX B;  5HWX A;  3RIA A;  3RYH E;  2VVN A;  2DL1 A;  2X68 A;  3PJA A;  3PUY F;  3KDS E;  2BG9 A;  4YSZ A;  3OYX A;  4UVB B;  4EXT A;  2CBI A;  3BQL A;  4YFS A;  4GIW A;  3WAK A;  3WAJ A;  2CXL A;  1U5P A;  4AKR B;  2ZM8 A;  3ESL A;  1WR6 A;  5JDL A;  3EDU A;  5HCM A;  5BW2 A;  5CO5 A;  3PUX F;  1SE7 A;  3ONL C;  4HFC A;  3PUS A;  2YN6 A;  2WN9 A;  3SQ6 A;  2MYS A;  5BP0 A;  4DV5 T;  2V6Y A;  4JYA T;  2D5U A;  3TLW A;  2YOE A;  2XSB A;  2MTQ A;  2ACZ A;  2YDS A;  2N9D A;  2L8K A;  3VRA A;  2NW9 A;  1G8X A;  1N34 T;  3LJC A;  4UV9 B;  4DBR A;  2F4V T;  3QNU A;  3U3I A;  5FXW A;  4DBM A;  3RYC E;  3W15 B;  2WCA A;  2XQY A;  3AEG A;  3IGQ A;  4N78 D;  3P7I A;  3RGL A;  2RP4 A;  4I43 B;  3MAC A;  1D1B A;  5LHH B;  5EK2 A;  3B13 A;  1M7K A;  1WR0 A;  4ZJS A;  4E7Z A;  2CWY A;  2B76 A;  2L3L A;  3ANW B;  1XNR T;  2BS2 A;  2X67 A;  2WNC A;  2X0Y A;  1MMN A;  2MPK A;  2DCF A;  4QWN B;  2V1D B;  4GK5 E;  1T72 A;  2JQH A;  3RC3 A;  2RPA A;  3UU6 A;  2BYP A;  4DO0 A;  4ADZ A;  4DR2 T;  5H6Q B;  3AA1 B;  2H7O A;  2LSG A;  2WNJ A;  2CXD A;  3UTK A;  2XUE A;  5FXV A;  3GMI A;  1ZKE A;  4Z90 A;  2OV9 A;  2WM9 A;  1N33 T;  3IBP A;  5FVL A;  4ZZB A;  3PU8 A;  2EHO A;  2NP9 A;  1U4Q A;  4PAG A;  5LJN A;  3CQX C;  2Y48 B;  3NKZ A;  3HKE E;  3C79 A;  2YME A;  2XTL A;  2NWB A;  2WP9 A;  2LSY A;  2J1D G;  4MLK A;  2D0U A;  4NXN T;  4U7Y A;  2KND A;  2V7J A;  3O1J A;  5HXH A;  4WZX A;  3FZM B;  4PJN A;  4JI0 T;  3A8Y C;  2LEH A;  2V5D A;  4JI1 T;  4AKG A;  4EOZ B;  3U8J A;  2LHN A;  2WQY A;  4IL9 A;  1XZY A;  4O2A E;  5AQR B;  3EAB A;  4PJJ A;  3N9L A;  3AA7 B;  2X9W A;  2PH9 A;  3HR0 A;  3M65 A;  1MMD A;  4DV0 T;  4OFZ A;  4UEL A;  2QVA A;  4TWF A;  3S4U A;  3KIN B;  4U2Y A;  3ZMU B;  4CI3 B;  2JQQ A;  3PUW F;  2C0S A;  3N5L A;  4CI2 B;  4TUY E;  1XMQ T;  5ABG A;  3KVB A;  3RQW A;  4ZOL E;  2FJA A;  1UW6 A;  3SS1 A;  4U72 A;  2K5B B;  2XM2 A;  3KV9 A;  1OED E;  4YY3 T;  4UR9 A;  3ZN1 B;  3T8O A;  3A5X A;  5HXS A;  2LLY A;  3PUR A;  4CN6 A;  4WV9 A;  1VRB A;  2KIN B;  3AEA A;  4JBW F;  3EHZ A;  3R6N A;  3UU4 A;  2QC1 B;  2AE9 A;  4QXH B;  3OVU A;  5IHY A;  4OYK A;  1BR1 A;  2E9X C;  2C5J A;  2CE7 A;  2VWA A;  3K1S A;  4O4L E;  4LF6 T;  1HS7 A;  3HKD E;  2X9X A;  1FJG T;  4JV5 T;  2CMR A;  1WYC A;  3NVO A;  4HWD A;  1WLX A;  2CRB A;  4F8H A;  1W0B A;  5JDN A;  5KZU A;  3M3Z B;  4CN1 A;  3RC8 A;  4U74 A;  2BKP A;  2LHR A;  2PBI A;  2ZJU A;  5AFJ A;  4ZR6 A;  2P9B A;  1KK7 A;  2XSA A;  3RHW A;  3PUA A;  4ASK A;  1EZ3 A;  3TLV A;  3AED A;  3A7M A;  3F2E A;  4GOU A;  2HPL A;  4XAX B;  4DV1 T;  5HXR A;  4ZI2 C;  5LHG B;  4TX5 A;  3HKC E;  2I6H A;  5JVD E;  3H3A A;  5AQV B;  2VQE T;  2JJ9 A;  3TLT A;  3CKD A;  2W00 A;  1X9B A;  4J2C A;  3C51 A;  4WYV A;  3SWH A;  2HN1 A;  3AE1 A;  1ZP0 A;  5J2T E;  1KFY A;  3ZJ1 A;  4DR6 T;  3C84 A;  4HWH A;  3TLU A;  3VU7 H;  3AEE A;  2D2S A;  1M62 A;  2XZE A;  3AEF A;  2BKO A;  4PK6 A;  3UQ7 A;  3PEO A;  2V26 A;  4I4T E;  2JQK A;  3IHR A;  2BVL A;  1MNE A;  3AE6 A;  3J7Y q;  1X79 A;  3Q5W A;  1N32 T;  3AXJ A;  5LA6 E;  4EB6 E;  2DWK A;  5L3E B;  4ZK1 A;  2N2N A;  5IYZ E;  2BJ0 A;  2VK9 A;  4AKH A;  2KWI B;  5J5G A;  3NRX A;  4DUY T;  1HG2 A;  5DQW A;  1HCI A;  4HFB A;  3SRZ A;  5FL1 A;  1E1H B;  2KSR A;  2ZM2 A;  2X0L B;  3V5S A;  4L5G A;  3IEE A;  4ZJT A;  4KI0 F;  4ANJ A;  4AIS A;  2WZY A;  2JPF A;  4KMC A;  5L3C B;  1ZEE A;  5ABF A;  3WTO A;  4YHH T;  2W61 A;  3SH1 A;  4IRE A;  3UUB A;  3FZF B;  3AEB A;  3WTN A;  2WBL A;  3Q5X A;  1IZN B;  4HWI B;  3RRW A;  5IWA T;  3ZN0 B;  1S35 A;  3LBX A;  4X1K E;  4PK5 A;  4P0B A;  1FEW A;  2BKN A;  3UU3 A;  4ZZC A;  1J5W A;  3FZH B;  1Z8U A;  3JAF A;  2E8I A;  4HN9 A;  4DR5 T;  1W9R A;  5HWY A;  4WBN E;  2C9T A;  1I6Z A;  4LFC T;  3HI2 A;  4YHJ A;  3LG7 A;  4B6X A;  2BYQ A;  3T1Y T;  2KMF A;  3MA9 A;  2D0T A;  5H6R B;  3N9M A;  3G06 A;  4PIR A;  4A97 A;  3ZPO A;  2VAS A;  5HYA A;  4NIQ A;  4BJM A;  1ZV4 X;  4O2B E;  2CXF A;  3WTK A;  2K48 A;  2BG9 C;  5AQJ B;  2E9X B;  4TV8 E;  2BBH A;  4ISS A;  3N9Q A;  3GN5 B;  5AFN A;  3QB5 K;  4JI6 T;  3F31 A;  5J2U E;  2ZLY A;  2LRK A;  3ANW A;  1CHU A;  2VB6 A;  4JI8 T;  4WBO A;  2DNX A;  3JCF A;  2W8F A;  4LF5 T;  3ZYM A;  5AFH A;  5L3G B;  5AQM B;  4BJN A;  4IST A;  2CCQ A;  2NR4 A;  1AJ3 A;  2YK0 A;  2KZ7 B;  1QSD A;  3AE3 A;  2E9X D;  5CGM A;  3FBZ A;  2A3D A;  1WFD A;  1XWM A;  3E0Z A;  3MZK B;  4C90 A;  3ZMV B;  5FYM A;  3ZT7 A;  4YSY A;  3RLF F;  3VKG A;  4DR7 T;  5LB7 B;  1SUM B;  1JNZ A;  2ZJV A;  2DWG A;  5LHI B;  3CX6 B;  1HNX T;  1Y64 B;  4YLH A;  4DV6 T;  2YDQ A;  3WI3 A;  5CJ5 A;  4AQF A;  2WZI A;  2PTF A;  2YIN A;  3RIF A;  1IBK T;  2LOP A;  4A56 A;  2CEA A;  2H88 A;  2JIW A;  4JUY A;  5JRC B;  3OTO T;  4QAC A;  4HGA A;  5CB4 E;  4EZ4 A;  3C4X A;  5JTG A;  4UXN B;  2WB5 A;  5L4E A;  4UIG A;  4ZI2 D;  3VR9 A;  4UM1 A;  3QUJ A;  4ZEY A;  2JMK A;  5AIN A;  5JQG E;  3PTR B;  3PUG A;  4CXX A;  2WDV A;  4IE0 A;  4ZK4 A;  4TNW A;  4JLE A;  3ZT5 A;  1H7C A;  3EDV A;  4JEU B;  4JI2 T;  1D1C A;  2EHO C;  3O1H A;  3AAE B;  4HWC A;  1XDP A;  1UX2 A;  4IDP A;  5L3D B;  5LNK A;  2QGS A;  2XY8 B;  2X00 A;  3Q5D A;  4X65 T;  4IDN A;  2XAJ B;  2UUA T;  2SPC A;  3LDQ B;  3NZP A;  2UXN B;  2ZMA A;  2LJL A;  4H9O C;  4COF A;  3HL6 A;  1HR0 T;  5IUX A;  4JI5 T;  2K9A A;  5CA0 E;  2FBW A;  4HKA A;  4DR3 T;  2J47 A;  4TZ4 C;  3Q9D A;  2NOX A;  4K0K T;  3CPZ A;  3NRY A;  4MAL A;  2A72 A;  4IT4 A;  5J0Z A;  3VRB A;  5JDM A;  4UEM A;  2BR7 A;  3UFG A;  1YD8 G;  4IDQ A;  3FZL B;  1OED A;  3O9X A;  2UZ6 A;  4TV9 E;  4X20 E;  3UU5 A;  5AQU B;  4WW0 A;  3JC6 D;  4I0U A;  2XAG B;  2AXD S;  2CHN A;  2WY2 A;  1IAP A;  3SOL A;  3FBL A;  4O4H E;  3RKO A;  5DJQ C;  1UGO A;  3AE4 A;  3KVA A;  2V7I A;  2BG9 B;  4AIU A;  4UVC B;  3C50 A;  4P1N A;  5LGU B;  4X62 T;  5LJM A;  3CWZ B;  4PJL A;  1HG5 A;  5AFU L;  5BMV E;  4HFE A;  3RIU A;  5AQT B;  3MJX A;  4BAY B;  4JI7 T;  5LXT E;  4H9P C;  4LF9 T;  2QA7 A;  1WYB A;  2X66 A;  2IIU A;  3C4Z A;  4X66 T;  5BRX A;  3AE2 A;  5LYJ E;  2M67 A;  5HCJ A;  2XAS B;  2LRL A;  5JDH A;  2V6Y B;  4XHE A;  4B3R T;  1UV6 A;  2Q9Q B;  4OX9 T;  4CQI A;  2V6X A;  2IAK A;  5JR9 A;  5FXX A;  4IIJ E;  4NUV A;  4KX6 A;  5J5F A;  4LMK A;  3I0Q A;  4MHC A;  3ONJ A;  4QAA A;  5HEJ A;  3ZMS B;  5JDQ A;  4P09 A;  4YSX A;  2CLY C;  4ZI3 C;  1HNW T;  2VQF T;  5JDG A;  4L9I A;  5F8P A;  2WAU A;  1MND A;  1HF8 A;  4LML A;  3RI5 A;  2WZH A;  4EZ1 A;  3Q5E A;  5JME A;  1IJ5 A;  2Q9Q D;  3GWH A;  3OJA A;  4H9S E;  4HEA A;  1KNZ A;  4YT0 A;  3CX7 B;  3KBT A;  5LCY A;  3QB5 A;  1XDO A;  3CVR A;  4IE6 A;  1D1A A;  1HFA A;  4U7I A;  2Y7Y A;  2WMO A;  4NUU A;  5J1G A;  2FUP A;  4UXU A;  4LFB T;  4FJO A;  2H7V C;  3IF8 B;  4HFD A;  4I55 E;  4TN7 B;  1I9B A;  5FKY A;  2BYR A;  4AFG A;  5GON E;  2RA1 A;  4CZZ B;  2LSJ A;  5A1L A;  4DV2 T;  3KFW X;  4QH4 A;  2CWO A;  3VR8 A;  4ZS2 A;  1R8I A;  2N1G A;  3F57 A;  3CQG B;  3WTH A;  5LGN B;  5SYO A;  1E2A A;  3Q2M A;  2EHO B;  4UV8 B;  4QKN A;  2K24 A;  4OHF A;  1YXR A;  1N36 T;  3O1I A;  4K0U A;  2CA5 A;  4HE8 A;  3ZDH A;  1E7P A;  2LOS A;  4CXW A;  4MBQ A;  3ZSS A;  5AQS B;  2VL8 A;  4UF0 A;  2J4G A;  3PMZ A;  2PG8 A;  4UY2 A;  1I94 T;  2ZM0 A;  4YTM A;  2EHO D;  3K3Q C;  3N2O A;  4HWF A;  2X9H A;  3AA6 B;  5ABH A;  3P50 A;  3RX6 A;  3RQU A;  4O4I E;  2W4X A;  2PJQ A;  5AFM A;  3ZC1 A;  3BQK A;  3K3O A;  2DLR A;  3UT5 E;  3N2G E;  4UM3 P;  4LF8 T;  3KV4 A;  3P8C D;  3RF1 A;  2YU1 A;  4LFA T;  3I9W A;  3SIO A;  2IC9 A;  2Y6X A;  2WDQ A;  2BDE A;  5L47 A;  2X51 A;  4DV7 T;  4QAB A;  5LMU T;  2W8G A;  4IE7 A;  5LGT B;  4H9R C;  4C91 A;  4O4J E;  3LK4 2;  4ZI7 E;  5E0O A;  1UUS A;  4YJ2 E;  4AI6 A;  4H9Q C;  5F3J A;  1LVK A;  2LKG A;  4B3T T;  1SA0 E;  5AQL B;  3EAM A;  3U8L A;  3ZMT B;  3SQ9 A;  3OBV E;  3UU8 A;  3IA3 A;  3KV6 A;  4TNV A;  5L4H A;  4XBF B;  1FMV A;  2VKO A;  5L3F B;  4Z91 A;  3QOF A;  2MAW A;  3KBU A;  1UX4 A;  2D9D A;  3T4M A;  3ZST A;  2VUR A;  2MOZ A;  3N9P A;  4FI5 A;  5FMN A;  4X64 T;  1D0Y A;  3E08 A;  2CLY B;  4IL4 A;  3V5U A;  4KHP T;  1WCR A;  5JRC A;  2UUC T;  3C64 A;  2LM9 A;  3H37 A;  2ZM6 T;  5KX5 E;  2XNT A;  3EUH A;  3CX8 B;  4BFQ A;  3FHN A;  4YTP A;  2VVS A;  2YEV C;  4ZXL A;  3I9Y A;  3PU3 A;  4EYU A;  3ZLI A;  2BR8 A;  3JAE A;  3EI0 A;  2BS4 A;  3WTJ A;  1MMA A;  2IHR 1;  1YQ4 A;  1BR0 A;  3I0O A;  4XK9 A;  4F6R C;  3UUM A;  1VOM A;  2WDR A;  4ZI3 D;  2UXD T;  5LP6 E;  2KWH A;  3RRC A;  3FXE B;  4GYS A;  2X0H A;  1W0A A;  2V5C A;  2UU9 T;  5AFL A;  3RYF E;  4AQF C;  2IDO B;  1MIW A;  3DTO A;  4ZS3 A;  5DAB A;  2NTX A;  4H63 H;  4OYJ A;  2FJE A;  2HN2 A;  2YMD A;  4X1I E;  3FXD B;  2Z6E A;  5C8Y E;  4LMJ A;  5F5W A;  5AQI B;  2G0U A;  4ILU A;  2QRX A;  4LF4 T;  3WTM A;  2DHR A;  5J5I A;  3AE7 A;  3L3P A;  4ILB A;  5DQV A;  3ZKR A;  2LM2 A;  2IUB A;  5AQQ B;  3AXJ B;  3X1D A;  1HX1 B;  4IGU A;  1UK5 A;  1NWM X;  3BQI A;  1G73 A;  4MFR A;  4EYY R;  3P4S A;  2WS3 A;  5C2T A;  1J5E T;  3ZC0 A;  5ETW A;  3LFM A;  1YKH B;  4IDZ A;  1BR4 A;  5AFK A;  2KLQ A;  1UX5 A;  1HTJ F;  2ES0 A;  5KXJ A;  1T7S A;  4I50 E;  1V9D A;  2HPJ A;  2OA5 A;  1FMW A;  4U33 A;  1OWA A;  1VCT A;  3PDY A;  5ABF B;  2Y58 A;  5FVK A;  5HEO A;  1LVF A;  1KNP A;  2XQ7 A;  4DMW A;  2LSI A;  1NAF A;  2W66 A;  2V7L A;  1T98 A;  3FB2 A;  4AKL A;  3AAI A;  3MK7 C;  4ERR A;  3LBX B;  4XZC A;  1HX8 A;  1ZOY A;  4G63 A;  4PNI A;  3SFD A;  3E22 E;  5AQN B;  4PK4 A;  4AKI A;  2Q9Q A;  2BBJ A;  2BVM A;  5FY1 A;  2CHO A;  1OED C;  3RH3 A;  2H3R A;  5FY7 A;  3VKH A;  4QHO A;  5LBM A;  4PFP A;  2IML A;  4EEB A;  3H3M A;  1SHZ C;  3C98 B;  4D01 A;  3FZK B;  3LSV A;  4L0R A;  1VCS A;  4NZB A;  3AE8 A;  3AVS A;  4TWD A;  2VKJ A;  1UCU A;  3MKD A;  5LBQ B;  4AFT A;  2E5L T;  4DV3 T;  2I0M A;  2LT3 A;  1WRD A;  5AQH B;  5HEH A;  4GKJ T;  2I59 A;  3RIU C;  5KDM C;  2XZ6 A;  2ODU A;  5LG3 A;  4ZRU A;  1FIO A;  3AVR A;  4U3C A;  4GKK T;  4PJM A;  4DND A;  5L2L A;  3UQ4 A;  4Q25 A;  3UFE A;  2HH7 A;  4FRR A;  3ZCI A;  3OYZ A;  4AFH A;  2NW7 A;  5FY0 A;  5JR9 C;  2BG9 E;  5JDF A;  4ALX A;  3U8K A;  4IDO A;  2XQ9 A;  3ONX A;  5HXC A;  2UXC T;  3BK9 A;  4H9N C;  4HFV A;  3UUL A;  3N9O A;  2V7M A;  5LOV E;  5AQK B;  2LSK A;  5FXZ A;  4EED A;  2Y8D A;  2JQ9 A;  4WNK A;  2W2U A;  1IBL T;  4BA9 A;  3WTL A;  1NEK A;  5C3J A;  4KP3 C;  3HA4 A;  1UUR A;  4A5X A;  1CUN A;  4Z8X A;  4EZH A;  2HHH T;  5FP3 A;  3RYI E;  1ZHC A;  2Y56 A;  4ZHQ E;  2L9Q A;  4O8S A;  5LG4 A;  2H89 A;  5HXE A;  5JH7 E;  1W09 A;  4DMV A;  4P0A A;  4HFH A;  2XJ7 A;  1B7T A;  3EVY A;  5TAO A;  2NW8 A;  4X1Y E;  5HAX A;  2VKD A;  2M6I A;  1QLB A;  4ILA A;  3TLS A;  1Y01 A;  1XMO T;  2A9U A;  4LF7 T;  1DU2 A;  3K3N A;  4G2A A;  3OPC A;  5LMN T;  3QK6 A;  3RKG A;  3KV5 A;  5EK4 A;  3ZYK A;  2WU2 A;  5HEU A;  5CA1 E;  4QH1 A;  2V8S V;  3CK6 A;  2BZB A;  4JI3 T;  3K8P C;  4YTN A;  4AXP A;  4GK0 E;  4JEH B;  2XHE B;  3DP7 A;  4QX8 B;  2WMN A;  5AQG B;  2XYS A;  2W0G A;  1KEY A;  4KBM B;  4YJ3 E;  2KXP B;  1OXZ A;  1QUU A;  2FJB A;  2XQA A;  2LKH A;  4X5T A;  5ADX L;  3B57 A;  3O4X E;  2XQ4 A;  4QXB B;  4CXY A;  4EIW A;  2JMH A;  4H63 V;  4NPP A;  3AAA B;  5FL0 A;  5L3B B;  5FJV A;  2X00 D;  2DI4 A;  2BS3 A;  4AQY T;  3NBX X;  1YKE B;  1OED B;  3GUA A;  1NEN A;  2CBJ A;  3L09 A;  1S94 A;  1D0X A;  2XM1 A;  3JAD A;  2YDR A;  2XAH B;  4JI4 T;  3MXZ A;  3L8R A;  5EZY E;  4DUZ T;  1O3X A;  4ILC A;  1KF6 A;  4UM3 S;  1GQE A;  2XQ3 A;  3LK3 B;  3WTI A;  2MBG A;  5AQO B;  3AE5 A;  2IC6 A;  5FNV E;  5TVC A;  3SFE A;  2WWV A;  4V1A v;  4E7S A;  3C4W A;  2WWU A;  3TKL B;  2XAQ B;  2ODV A;  4KHZ F;  3PUZ F;  5JR9 B;  2VL0 A;  2E9X A;  3PV0 F;  4OK0 A;  5BR8 T;  2V7K A;  2B1E A;  2JRK A;  3GN5 A;  3ZYL A;  1Z0P A;  4B5D A;  3ZT6 A;  4A98 A;  2IW5 B;  3ZCJ A;  3AEC A;  2GK9 A;  2UXB T;  2XYT A;  4DID B;  1BR2 A;  4DBQ A;  4AQG A;  1IBM T;  1XNQ T;  2UUB T;  4CI1 B;  5JRE A;  4QXC B;  4QX7 B;  3UUX B;  3HKB E;  4HQP A;  2CM0 A;  2R6G F;  2VKH A;  3U8M A;  3QC9 A;  3VHL A;  2XNV A;  3WIP A;  2C5I T;  3ZJ2 A;  4PFO A;  4NXM T;  5AQP B;  3PJA J;  4UM3 A;  3T1H T;  1LRZ A;  2PFV A;  3ZEF B;  3U78 A;  3AE9 A;  3B5M A;  3P4W A;  2QYW A;  4B3M T;  3UUN A;  2OLT A;  4YXD A;  4B3S T;  4DR1 T;  1MIY A;  1D0Z A;  3CQC B;  5J5H A;  2J62 A;  3P4R A;  3CML A;  2YU2 A;  3AB3 B;  5HEG A;  2E2A A;  3AA0 B;  2X9Y A;  4U31 A;  4IE4 A;  4DR4 T;  3J9X 1;  2K3W A;  1MMG A;  2Y57 A;  3GA8 A;  2W67 A;  3P4Q A;  5AQF B;  2C5K T;  3JC6 C;  5ABE A;  1MIV A;  3CIR A;  3RPU A;  3P4P A;  1YQ3 A;  4PW8 A;  4U2Z A;  4IE5 A;  3PE0 A;  4M1P A;  5CFB A;  4GYR A;  2E5V A;  5M4Y A;  2W63 A;  4UF0 B;  3ABV A;  3D0T A;  2Y54 A;  4EGW A;  3L39 A;  4CN4 A;  2WU5 A;  5LXB A;  2XQ6 A;  5EK3 A;  2XAF B;  2BYS A;  2W62 A;  4KUM B;  5AFM B;  1IJ6 A;  2M6B A;  1YW0 A;  5KMG P;  2WSS V;  3ETV A;  4BQT A;  2XNU A;  1HNZ T;  4IHJ E;  1J1J A;  1US7 B;  2XZ5 A;  3ETU A;  3NZQ A;  1JNR A;  3ZDG A;  2LE8 A;  2NTY A;  5KE4 A;  1L0V A;  2XQ8 A; 
#chains in the Genus database with same CATH homology
 2QC1 B;  4QH5 A;  3TLU A;  2BR7 A;  4EZ1 A;  4IL4 A;  4TWH A;  1OED A;  5JME A;  4HFH A;  4PIR A;  4A97 A;  3UQ7 A;  3PEO A;  5AFM A;  5HEH A;  3P4W A;  4QAC A;  2XNT A;  2UZ6 A;  2PGZ A;  4UM3 P;  2XZ6 A;  4BFQ A;  5LG3 A;  4ZRU A;  3UU5 A;  4UM3 S;  2BYN A;  5L4E A;  3WTK A;  2YKS A;  4DBM A;  3SIO A;  2XQ3 A;  2BG9 C;  2BR8 A;  3JAE A;  5J5H A;  4HFI A;  2M6I A;  2Y7Y A;  3WTI A;  4ILA A;  3TLS A;  4UM1 A;  3U8J A;  4IL9 A;  3EI0 A;  3WTJ A;  5AFK A;  3IGQ A;  4ZK1 A;  5HEG A;  5AIN A;  5TVC A;  4UXU A;  5L47 A;  3UQ4 A;  2BJ0 A;  4HFD A;  2BG9 B;  5AFN A;  4FRR A;  4XK9 A;  2XQ5 A;  2PH9 A;  5J5G A;  4AFH A;  1I9B A;  5HEU A;  4QH1 A;  2BYR A;  4AFG A;  4QAB A;  2BG9 E;  4HFB A;  2Y57 A;  4ZJS A;  4ZK4 A;  4F8H A;  2Y58 A;  5HEO A;  3U8N A;  4TNW A;  5KZU A;  2XQ7 A;  2W8G A;  2KSR A;  2WNL A;  4ALX A;  2WNC A;  3U8K A;  4QH4 A;  4HFE A;  2XQ9 A;  3RIA A;  4TWF A;  2VL0 A;  2ZJU A;  3WTH A;  5AFJ A;  5SYO A;  4ZJT A;  5BRX A;  1UX2 A;  2W8F A;  2LKG A;  4ZR6 A;  5CFB A;  5AFH A;  2BG9 A;  3UU6 A;  2XYS A;  2WZY A;  2BYP A;  4B5D A;  5HCJ A;  5AFL A;  2X00 A;  3RHW A;  4A98 A;  2XQA A;  2LKH A;  4X5T A;  3WTO A;  3EAM A;  3TLV A;  3U8L A;  4XHE A;  3SQ9 A;  2Y54 A;  3SH1 A;  2WNJ A;  4IRE A;  1UV6 A;  3UU8 A;  3UUB A;  5J0Z A;  2XYT A;  3ZDH A;  2XQ4 A;  4TNV A;  5L4H A;  3WTN A;  4Z90 A;  1OED C;  5HCM A;  5BW2 A;  5CO5 A;  4Z91 A;  4NPP A;  2XQ6 A;  4COF A;  5LXB A;  4HFC A;  2YN6 A;  2MAW A;  5IUX A;  5FJV A;  2X00 D;  2YMD A;  3WTL A;  3T4M A;  2BYS A;  2WN9 A;  5J5F A;  4ZZB A;  4LMJ A;  4LMK A;  3RQW A;  1OED B;  1UW6 A;  3TLT A;  5AFM B;  3UU3 A;  3SQ6 A;  4QAA A;  4HQP A;  5HEJ A;  1OED E;  4ZZC A;  2ZJV A;  3GUA A;  3PMZ A;  5BP0 A;  3U8M A;  2M6B A;  4D01 A;  4UY2 A;  3WTM A;  3JAF A;  3C79 A;  2Y56 A;  4BQT A;  2LLY A;  3LSV A;  2XNU A;  4NZB A;  3TLW A;  2YOE A;  2XNV A;  5J5I A;  4ILB A;  4WV9 A;  2YME A;  3WIP A;  4TWD A;  3JAD A;  2XZ5 A;  3ZKR A;  2C9T A;  2LM2 A;  4AFT A;  3P50 A;  3RIF A;  3ZDG A;  4LML A;  3C84 A;  4UM3 A;  3RI5 A;  3RQU A;  5KE4 A;  3EHZ A;  2BYQ A;  2XQ8 A;  4ILC A;  3UU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...