3UU5A

The glic pentameric ligand-gated ion channel loop2-20' mutant reduced in solution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVECNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu5A01
3U8JA 4HFCA 4F8HA 2BYNA 3U8MA 2MAWA 5HEJA 2Y57A 2WN9A 5TVCA 5J5FA 3JADA 4IL9A 5HCJA 2PH9A 5J5IA 4QAAA 2XQ7A 3WTJA 2BYSA 4QH1A 5FJVA 3U8NA 4HFEA 3TLWA 2W8FA 3WTNA 4LMLA 2XYTA 3C79A 4XK9A 2YN6A 4AFGA 3TLTA 3WTHA 3JAFA 3SH1A 1OEDE 3UU6A 4HQPA 4ZJTA 2XNVA 4AFTA 3RQUA 3UQ7A 4ILCA 2XZ6A 4WV9A 2XYSA 4TWFA 4X5TA 2BR7A 4LMKA 2XQ9A 2WNJA 2WZYA 3WTOA 5BW2A 4UXUA 3ZDGA 2XZ5A 4IL4A 5CFBA 1OEDA 1UW6A 2W8GA 4XHEA 5SYOA 5AFNA 2Y54A 5L47A 2XQAA 4TNWA 4LMJA 4UM1A 2XQ3A 4ZJSA 5AFHA 4TNVA 3P50A 4HFBA 2ZJVA 5AFMA 5HEHA 2BG9C 1I9BA 3UUBA 4ZR6A 3WIPA 2YMDA 2LKHA 2XQ5A 3IGQA 5L4HA 5J5GA 3SIOA 5JMEA 2QC1B 4BFQA 4UY2A 3P4WA 4UM3P 2VL0A 4NPPA 2LLYA 3C84A 2BYPA 4QH5A 1OEDB 2YMEA 4UM3A 2LKGA 4QH4A 5L4EA 3UU8A 4BQTA 2M6IA 4HFIA 2PGZA 2XQ4A 3TLUA 3UU3A 4D01A 5J0ZA 1UV6A 4QABA 3EAMA 2X00D 3WTKA 3PEOA 3UQ4A 2BYRA 3TLSA 3UU4A 1UX2A 4DBMA 5J5HA 5HEOA 4AFHA 4ZZBA 4EZ1A 5KE4A 2ZJUA 4ZK1A 2WNLA 3ZKRA 3U8LA 2BG9E 5HEUA 5AFJA 3PMZA 3WTLA 5AFLA 4A97A 2X00A 2Y7YA 3WTIA 4COFA 4FRRA 4HFDA 2XQ8A 2LM2A 2BJ0A 2UZ6A 4Z90A 2BR8A 4ILBA 3RQWA 4TWHA 2BG9A 5HEGA 3RI5A 2Y56A 2Y58A 4UM3S 3SQ9A 3U8KA 3T4MA 3TLVA 2XNTA 3JAEA 4ZK4A 4HFHA 3ZDHA 2BYQA 2KSRA 4QACA 2YOEA 4ZRUA 5AFMB 3UU5A 2XQ6A 3EHZA 3RIFA 3EI0A 5LG3A 4NZBA 3SQ6A 4ZZCA 4A98A 2C9TA 5HCMA 2BG9B 4PIRA 5IUXA 2WNCA 5BRXA 3RHWA 4Z91A 5KZUA 2XNUA 4ALXA 4TWDA 4IREA 5LXBA 3RIAA 1OEDC 5AINA 3WTMA 2YKSA 4B5DA 2M6BA 5AFKA 3GUAA 5CO5A 3LSVA 5BP0A 4ILAA
chains in the Genus database with same CATH superfamily
3GN5B 5FY1A 2J47A 5EK2A 2W63A 4IL9A 4DV5T 3U8NA 3H37A 3ZMUB 5AQFB 1HG5A 3HA4A 4LMLA 3C79A 4H9PC 5DABA 4HQPA 2QVAA 4U2YA 2CCQA 4H9NC 5JDGA 3R6NA 2GK9A 2V7IA 1VCTA 3S4UA 2PG8A 4WW0A 2YMDA 4GYSA 3P7IA 4IHJE 5ETWA 1HNXT 4AKIA 3F31A 3KFWX 3ZT5A 5DQWA 3UU3A 1O3XA 4EIWA 2CXFA 2X00D 3PEOA 3UQ4A 2BYRA 3UU4A 3MJXA 3AAEB 4B3MT 1D0ZA 3PUVF 1QSDA 2XTLA 5AFJA 4YTNA 1BR1A 5JDNA 4HFDA 1WCRA 4UVCB 3HL6A 5FXXA 2BR8A 2JMHA 3RQWA 3RI5A 2IHR1 3AA7B 1UGOA 3I0QA 4L9IA 2WDQA 1UX5A 2LM9A 3HKEE 2XQ6A 3K3NA 4AKHA 3ZN0B 3CWZB 3KDSE 4B3ST 4ERRA 2BZBA 4YT0A 2FJBA 2XASB 2YINA 2XNUA 2W62A 4TWDA 4EZ4A 3RIAA 3ZCJA 2WB5A 4KHZF 2BBHA 3C4ZA 2WSSV 3NZQA 2I6HA 3MKDA 4HEAA 1W09A 5TVCA 2PH9A 5FL0A 1KF6A 3WTJA 2PFVA 4JLEA 3UUNA 4DBRA 5ABGA 4QH1A 4QX8B 4EXTA 2W8FA 4DIDB 4JEUB 3O1JA 2Q9QA 3AEEA 3ZC0A 1UX4A 5FP3A 3DTOA 3T8OA 2HN2A 4UXUA 3ESLA 3WAKA 2VB6A 3PUSA 4UM1A 4PFOA 5IHYA 4PNIA 2BS2A 1IBKT 3C4XA 5AQVB 2LKHA 2I0MA 4JI8T 3IA3A 4UM3P 2Y8DA 5LP6E 5TAOA 4G2AA 4BQTA 3N9QA 1ZKEA 5F8PA 3IF8B 1FIOA 5ADXL 4ZI2C 2Y7YA 2XQ8A 3F57A 4YHHT 2BG9A 1G73A 1X79A 2WBLA 2CM0A 2NWBA 2NTYA 2Y48B 4PK6A 3H3MA 4JI1T 3QOFA 4CN1A 2E9XA 2NW9A 4X20E 4ZZCA 2W00A 1HR0T 4A98A 4DV2T 2D9DA 5BRXA 2W2UA 5F3JA 4IE4A 2V5CA 4IE5A 4UF0A 3LK2B 5H6RB 2JQHA 1L0VA 3AE7A 4O4JE 3N2GE 4UEMA 2WN9A 3RGLA 4JI5T 2BKOA 4IDPA 4ZI3D 4ADZA 2UXBT 3CX7B 2J4GA 4AQFA 3MA9A 4X62T 3AE6A 2V7LA 3PTRB 5L3CB 3RQUA 3BQIA 4WV9A 4DV7T 5JTGA 2ES0A 4HWCA 3OYZA 2JIWA 3CK6A 5AFNA 3PURA 2XQAA 3RKOA 4DMVA 1ZV4X 3UFGA 2K24A 3UUMA 3RLFF 2X9YA 2CE7A 3OJAA 3RF1A 2CLYC 1J1JA 3RYHE 4N78D 4HKAA 2VKDA 1JNZA 1MIYA 3ZSSA 2V26A 3J9X1 3WTLA 2LM2A 1XWMA 2QYWA 1HNWT 4ILBA 2Y58A 5JVDE 5JQGE 4P0BA 3EABA 4BAYB 3GN5A 2W67A 4ANJA 4PIRA 5FY7A 1XDOA 1OWAA 2BKNA 4X64T 1OEDC 2M6BA 3GUAA 3FZFB 4KBMB 4UR9A 2WZIA 3CQGB 3CMLA 3OBVE 3HKDE 2Q9QC 2X68A 4P0AA 2YU2A 4H9SE 2X9XA 2XYTA 4C91A 3HKBE 2CXLA 4JI0T 5LBMA 2BR7A 5BW2A 3ZDGA 2CHOA 4O2AE 4XHEA 5LNKA 5AQTB 4HGAA 5LA6E 4YY3T 2HPJA 4O4IE 5AFMA 4PK5A 4CXXA 5BMVE 3C50A 4O4HE 3AE9A 2SPCA 2V8SV 3C84A 1OEDB 3N9MA 2E8IA 3AE5A 3ABVA 2DWKA 5EZYE 4DBMA 1UX2A 2XAQB 1N33T 3PMZA 1BR0A 3WTIA 2C5JA 5IYZE 5HEGA 1S35A 3FBLA 2CXDA 3K3OA 2Y56A 1UCUA 2CPTA 4DO0A 1ZHCA 2XQYA 4IE0A 4TN7B 3PU3A 5KDMC 1WYCA 2C5KT 2UXXB 4DNDA 2P9BA 1AJ3A 3VR8A 1GQEA 2LHNA 3PV0F 4IE7A 2W4XA 3EDVA 5HXHA 5JDQA 3AAIA 4DMWA 3P4RA 1H7CA 2ZM8A 2VVNA 4DR6T 3BQLA 2XSBA 1UK5A 1W9RA 3ZJ1A 4NIQA 3RC3A 2QRXA 2L9QA 3OYXA 5J2UE 3KV9A 2LSIA 4MHCA 4CI3B 3WTOA 4E7ZA 4UXNB 2W8GA 2KT9A 5AFHA 3QB5A 3N5LA 4IIJE 5HEHA 4P1NA 1WR6A 2JQ9A 5BR8T 3EUHA 3IGQA 2W61A 1B7TA 1G8XA 2MTQA 3RIUC 3AEGA 2YMEA 1VCSA 2HPLA 1LKXA 3AAAB 2WNLA 3RX6A 2WQYA 4COFA 4FRRA 3P8CD 5AQSB 3L3PA 4UV9B 3VKHA 1T8BA 3ZN1B 2D5UA 2V7KA 1WLXA 3I1AA 4TUYE 4I50E 2XHEB 1NENA 4YSZA 3AA6B 5LXBA 5AINA 3CPZA 3KVBA 4HFCA 5J2TE 1YKEB 2Y57A 4MBQA 4EOZB 4X1YE 4HFEA 2WU5A 1V9DA 3K1SA 2I59A 4JI7T 2YN6A 2KWHA 2IC6A 5A1LA 5KXJA 5LMUT 4IDZA 4DUZT 5HXEA 3UQ7A 4UV8B 5JR9B 3K8PC 5JRCB 2NOXA 3N9PA 4IL4A 5SYOA 5L47A 4LMJA 4TX5A 3N9LA 4U74A 3QUJA 1XNRT 2WP9A 4CN4A 2N9DA 4JBWF 3M65A 5J5GA 2V5DA 3FZMB 2CBIA 3IBPA 2BYPA 2C5IT 4F6RC 3V5SA 1QLBA 5LYJE 5HAXA 1E2AA 4JV5T 4UIGA 2N1GA 4ASKA 5JDMA 1KNRA 5L3DB 2X00A 4LF5T 3O1IA 3VRAA 3I0OA 3AVRA 2VVSA 2ODVA 3Q2MA 4NXNT 5FL1A 5AFMB 4U2ZA 3UU5A 4XAXB 1YD8G 1IBLT 4DR3T 1S94A 3SWHA 4YTMA 5KZUA 2K3WA 2X51A 3RPUA 4ZS3A 4CXYA 4K0UA 5AFKA 2XJ7A 2PTFA 5AQGB 1R8IA 1IZNB 5CA0E 5HEJA 3LG7A 2MYSA 4H9RC 2DNXA 3NRXA 4QX7B 4GYRA 5AQJB 4HWDA 1XNQT 2WS3A 5M4YA 3JAFA 3A8YC 2AXDS 4H63V 4ZJTA 2FJDA 4HWFA 4YJ2E 1HX1B 1OEDA 3N2OA 3G06A 2XQ3A 4ZJSA 4XZCA 1IJ6A 5CB4E 3SS1A 3ZYLA 3VHLA 1YKHB 2X9WA 4M1PA 4MLKA 4EV6A 1D1AA 2UU9T 3E08A 2XQ5A 3AEFA 2B76A 1QUUA 2W0GA 1MMAA 1D0XA 3QK6A 2JQKA 2M67A 3SFEA 1UV6A 1N36T 3PJAA 5KE4A 2MPKA 2BG9E 1NAFA 2JJ9A 3LK42 4TWHA 3JCFA 2UUAT 2CMRA 1MNEA 5J1GA 3PU8A 3AEDA 3ZPOA 4H9QC 2JQQA 4LF4T 3SRZA 4HFHA 4PJMA 2FJAA 3KBTA 1HCIA 4ZRUA 4KX6A 4UELA 3T1YT 2W66A 3D0TA 4NZBA 2OLTA 3MK7C 4ILUA 3T1HT 3PUAA 1X9BA 3MACA 3N9NA 3PUWF 2YKSA 5FMNA 2ZM6T 4AI6A 3HR0A 5BP0A 1MNDA 3AE3A 2H3RA 1W0BA 2AE9A 2MAWA 4KHPT 2VKJA 4QAAA 3NWIA 3AE2A 5FY0A 1N34T 3PUYF 3NZPA 3RRWA 4EYYR 2G0UA 4HWHA 1E1HB 2KZ7B 5JH7E 4IDOA 2WNJA 4EGWA 5ABEA 4KI0F 4AXPA 2J1DG 1Y01A 1KFYA 4AKGA 2X0HA 5LHGB 4LF8T 2WU2A 5AQUB 2LLYA 3I9WA 1T98A 3LDQB 4AISA 4LF7T 5AQOB 4EB6E 1ZOYA 2K5BB 2LSKA 3ZYKA 2DI4A 1W0AA 2WAUA 4GKJT 5HYAA 4ISSA 2LOPA 2UZ6A 4FI5A 2X0LB 1M62A 2LOSA 1VOMA 2LSGA 2DL1A 2EHOD 3RIUA 2FJEA 4QACA 1WR0A 5L3EB 3RC8A 4YLHA 3C51A 4X66T 4JI6T 1I94T 4AKRB 2V7MA 5IWAT 2CA5A 3ANWB 4AQGA 2B1EA 4EYUA 2LT3A 2DWGA 3L09A 4JI3T 3CKDA 3ONLC 3E22E 4ILAA 2WZHA 3U8JA 4Q25A 4F8HA 3KVAA 5JR9A 3IEEA 3LFMA 5JRCA 2PBIA 3WI3A 5HXSA 2HH7A 1LVFA 3PJAJ 4XK9A 3UT5E 3TLTA 3WTHA 1HTJF 2XZ6A 1T72A 4JUYA 5AQPB 4QXHB 4TNWA 5EK3A 4IE6A 4YHJA 3X1DA 4KMCA 2WCAA 1I9BA 3P4QA 2KWIB 4ZR6A 3PUGA 4HWIB 1YQ3A 3SIOA 3CQXC 4A5XA 4QXCB 2VKOA 3FBZA 2Z6EA 4EZHA 1D0YA 1MMDA 2LRKA 2KMFA 2VK9A 3V5UA 3TLSA 5LG4A 4I55E 4AFHA 1FMWA 2XUEA 4H9OC 2YDSA 3AECA 2ZM2A 5HEUA 5L2LA 3NRYA 4DV4T 5FYMA 1ZEEA 2K48A 4O4LE 5HXCA 4LFCT 3UULA 3SFDA 4O8SA 5IUXA 5ABHA 5HWXA 3QC9A 3RHWA 3N2KE 3B5MA 4X1KE 2CRBA 3I9YA 3ZLIA 4B5DA 3OTOT 2K9AA 2BS3A 2XPKA 3C64A 5GONE 1I6ZA 3LJCA 3RYFE 2KINB 2LHRA 4B3TT 4ZI3C 5LGTB 4I0UA 5EK4A 2XNVA 5FXZA 4FJOA 2XQ9A 2IMLA 2DCFA 3UFEA 2Y54A 4JI2T 4ZOLE 3P50A 3AE1A 1HF8A 5ABFB 5JMEA 4BFQA 2VL0A 4OFZA 5CA1E 4HFVA 4JI4T 2BDEA 3OKQA 2OV9A 5L4EA 4TZ4C 2PGZA 3FXDB 2EHOC 2RP4A 2YEVC 1Z0PA 2N2NA 4ZK1A 2VKHA 1HX8A 3EVYA 2BJ0A 1E7PA 1WRDA 4DV6T 2LJLA 1KNZA 3B13A 3H3AA 4U7IA 3EDUA 3P4SA 2A2FX 1YXRA 4LFBT 3M3ZB 3SQ6A 2MBGA 5H6QB 5HCMA 5LHHB 3CQCB 1YW0A 2WNCA 4DV1T 3RRCA 3KINB 4I4TE 4IREA 1D1CA 2LEHA 2UXCT 5CO5A 5JR9C 1JNRA 1IBMT 1KNPA 5JREA 4DR2T 5LJMA 2EHOB 3U8MA 5J5FA 3ONJA 1FJGT 1LVKA 3RYCE 4WNKA 2XM1A 3TLWA 3IHRA 5L3BB 4QXBB 4YJ3E 5AQRB 3ZMSB 3N9OA 2V6YB 5LJNA 5LCYA 2H88A 4B6XA 2VL8A 4U72A 4JEHB 3WAJA 4BA9A 3WIPA 2NTXA 3QB5K 1N32T 4CQIA 2NR4A 5LHIB 1HFAA 3GWHA 2X67A 3PE0A 3MXZA 4HFIA 4E7SA 4CI1B 5J5HA 5KMGP 4ZZBA 4EZ1A 4G63A 2X0YA 1HNZT 4IT4A 1IAPA 2JRKA 2IC9A 5AFLA 3KV5A 2VQET 3DJBA 1J5WA 2BVLA 2JMKA 3CVRA 1BR4A 2YDRA 3NVOA 5AQQB 3ANWA 5LOVE 2CHNA 5C8YE 2IAKA 1EZ3A 4PJNA 2UUCT 3ZMZB 4HN9A 2WY2A 2UUBT 4ALXA 1US7B 2IW5B 5AQKB 2JPFA 3WTMA 2D2SA 3P4PA 5C2TA 3HKCE 3KV6A 2YK0A 2WDVA 4CZZB 4HE8A 5HCJA 2XQ7A 1KK7A 4EEDA 2V6XA 4IDNA 3VU7H 1T7SA 1U5PA 4OHFA 4NUVA 1OEDE 2XAHB 2ZM0A 2IDOB 1UW6A 4OK0A 3QNUA 1SHZC 3Q5WA 3AE4A 4V1Av 2LKGA 2D0TA 2NW7A 4HTEA 5LBQB 1KEYA 3TLUA 4QABA 2FBWA 3WTKA 1HS7A 2R6GF 3E0ZA 3ZKRA 3O9XA 2FUPA 4QWNB 5CGMA 2XY8B 3KBUA 3LBXA 1OXZA 3ZCIA 2H7OA 2KXPB 2XNTA 4ZK4A 2X9HA 3ZDHA 2E5VA 1U4QA 5AQNB 3NKZA 2C9TA 4YTPA 1HG2A 2XM2A 4ISTA 4PJJA 3R84B 2BKPA 1SA0E 3GA8A 5LMNT 2BBJA 3AVSA 4TV8E 3CIRA 1IJ5A 5HXRA 5DJQC 2WWVA 4IGUA 1BR2A 2Q9QD 2BS4A 3AXJA 4OYJA 1NEKA 3O1HA 2H7VC 4DR5T 3PUZF 2F4VT 2WMOA 5C3JA 5ABFA 4UVAB 3ZMTB 2E2AA 4AFTA 2QGSA 4TWFA 4X5TA 2XYSA 4GOUA 4LF6T 3VKGA 5CFBA 4ZXLA 2XAGB 3JC6D 4EAHA 3AA0B 1XDPA 3KV4A 3AEBA 4HFBA 3A7MA 4ZHQE 3K3QC 4J2CA 3P4WA 2CEAA 3FZLB 3MZKB 3FXEB 2M6IA 3C98B 3ZT7A 2LRLA 4PFPA 4DR4T 5AQMB 5HEOA 3U78A 3OVUA 2ZJUA 4EEBA 3Q5EA 1CUNA 4WBOA 3Q5XA 2VASA 4PK4A 2D0UA 2E9XD 5FXVA 2BYQA 2YOEA 3EHZA 4MALA 3RIFA 2CWOA 3EI0A 3C4WA 2EHOA 2A9UA 1M7KA 2UXNB 2CWYA 4KP3C 2KLQA 1NWMX 4I43B 2A72A 1MIVA 2WDRA 1FEWA 2QA7A 2V6YA 3OPCA 4AFGA 1LRZA 3Q5DA 5JDHA 4NXMT 2X66A 3SH1A 3UU6A 3AE8A 4WZXA 3O4XE 5F5WA 4ILCA 4A56A 2YDQA 2ODUA 4LMKA 2WZYA 4ZS2A 4GKKT 3W15B 4WYVA 2ACXA 4YXDA 4AKLA 4U33A 3BQKA 2XAFB 3NBXX 3FB2A 2MOZA 2QC1B 4UY2A 3UTKA 1XMQT 4NPPA 4UM3A 2OA5A 4AIUA 4QH4A 5CJ5A 4DUYT 4BJMA 2WM9A 1XZYA 3LK3B 2IUBA 4O2BE 5FNVE 4PAGA 2NP9A 4U3CA 4ZEYA 4YSYA 2XAJB 2Y6XA 2J62A 4QKNA 5FXWA 2CLYB 1D1BA 3SQ9A 3U8KA 2VWAA 4CI2B 3FZHB 4LFAT 5E0OA 3DP7A 5LG3A 5FVKA 5FVLA 2E5LT 4GK5E 1SUMB 1MIWA 3ZJ2A 4Z91A 3B57A 2LE8A 5LGNB 1XMOT 2H89A 1Z8UA 2C0SA 3U3IA 2BYNA 2VURA 3JC6C 5J5IA 3ZC1A 4CN6A 2BYSA 1Y64B 5LGUB 2XZEA 4XBFB 4GIWA 3WTNA 3LBXB 3ZSTA 3FHNA 5KX5E 4YFSA 5AQHB 1UUSA 4DR1T 4DV3T 4X1IE 2XZ5A 2A3DA 2ZLYA 3A5XA 2VQFT 2YU1A 2ZJVA 2Q9QB 4X65T 4U31A 2BG9C 4JYAT 3AB3B 2NW8A 3UUBA 3Q9DA 2L3LA 1UURA 4QH5A 3VR9A 1WFDA 3UU8A 4CXWA 5AQLB 4QHOA 2E9XC 5J0ZA 1DU2A 4LF9T 3EAMA 3AXJB 4K0KT 5L3GB 2HHHT 4IDQA 3CX8B 3U8LA 3ZMVB 4L0RA 5DQVA 4BJNA 1MMNA 3SOLA 4Z90A 3RYIE 1ZP0A 4U7YA 3T4MA 1J5ET 3TLVA 3JAEA 4P09A 4DR7T 4AQFC 5AFUL 3AEAA 2BG9B 3ETVA 4DV0T 2RPAA 4PJLA 3F2EA 3AA1B 3ONXA 5AQIB 4NUUA 1MMGA 2E9XB 2UXDT 4ZI7E 2ACZA 2XSAA 3FZKB 3JADA 2IIUA 2DLRA 2BVMA 2DHRA 3UUXB 4H63H 5FJVA 4UVBB 2PJQA 2CBJA 4TV9E 4UF0B 2RA1A 3HI2A 3ZEFB 3PUQA 4KUMB 1SE7A 4TNVA 4PW8A 3GMIA 1WYBA 3L8RA 4GK0E 5L3FB 2WMNA 3BK9A 5L4HA 3ZT6A 1VRBA 5HWYA 1CHUA 1FMVA 2XQ4A 2HN1A 2LSYA 4B3RT 4D01A 5LB7B 1YQ4A 3VRBA 4WBNE 3ETUA 4C90A 2WWUA 3ZYMA 4Z8XA 3RKGA 4A97A 3CX6B 5FKYA 2L8KA 5JDLA 2LSJA 5JDFA 2ZMAA 4UM3S 4DVDA 4YSXA 2KSRA 4MFRA 4AQYT 5LXTE 3TKLB 4ZI2D 3L39A 3PDYA 3PUXF 2KNDA 3RH3A 4OYKA 4L5GA 4OX9T 4DBQA 2V7JA 2V1DB 3LSVA 3J7Yq
chains in the Genus database with same CATH topology
3U8JA 4HFCA 4F8HA 2BYNA 3U8MA 2MAWA 5HEJA 2Y57A 2WN9A 5TVCA 5J5FA 3JADA 4IL9A 5HCJA 2PH9A 5J5IA 4QAAA 2XQ7A 3WTJA 2BYSA 4QH1A 5FJVA 3U8NA 4HFEA 3TLWA 2W8FA 3WTNA 4LMLA 2XYTA 3C79A 4XK9A 2YN6A 4AFGA 3TLTA 3WTHA 3JAFA 3SH1A 1OEDE 3UU6A 4HQPA 4ZJTA 2XNVA 4AFTA 3RQUA 3UQ7A 4ILCA 2XZ6A 4WV9A 2XYSA 4TWFA 4X5TA 2BR7A 4LMKA 2XQ9A 2WNJA 2WZYA 3WTOA 5BW2A 4UXUA 3ZDGA 2XZ5A 4IL4A 5CFBA 1OEDA 1UW6A 2W8GA 4XHEA 5SYOA 5AFNA 2Y54A 5L47A 2XQAA 4TNWA 4LMJA 4UM1A 2XQ3A 4ZJSA 5AFHA 4TNVA 3P50A 4HFBA 2ZJVA 5AFMA 5HEHA 2BG9C 1I9BA 3UUBA 4ZR6A 3WIPA 2YMDA 2LKHA 2XQ5A 3IGQA 5L4HA 5J5GA 3SIOA 5JMEA 2QC1B 4BFQA 4UY2A 3P4WA 4UM3P 2VL0A 4NPPA 2LLYA 3C84A 2BYPA 4QH5A 1OEDB 2YMEA 4UM3A 2LKGA 4QH4A 5L4EA 3UU8A 4BQTA 2M6IA 4HFIA 2PGZA 2XQ4A 3TLUA 3UU3A 4D01A 5J0ZA 1UV6A 4QABA 3EAMA 2X00D 3WTKA 3PEOA 3UQ4A 2BYRA 3TLSA 3UU4A 1UX2A 4DBMA 5J5HA 5HEOA 4AFHA 4ZZBA 4EZ1A 5KE4A 2ZJUA 4ZK1A 2WNLA 3ZKRA 3U8LA 2BG9E 5HEUA 5AFJA 3PMZA 3WTLA 5AFLA 4A97A 2X00A 2Y7YA 3WTIA 4COFA 4FRRA 4HFDA 2XQ8A 2LM2A 2BJ0A 2UZ6A 4Z90A 2BR8A 4ILBA 3RQWA 4TWHA 2BG9A 5HEGA 3RI5A 2Y56A 2Y58A 4UM3S 3SQ9A 3U8KA 3T4MA 3TLVA 2XNTA 3JAEA 4ZK4A 4HFHA 3ZDHA 2BYQA 2KSRA 4QACA 2YOEA 4ZRUA 5AFMB 3UU5A 2XQ6A 3EHZA 3RIFA 3EI0A 5LG3A 4NZBA 3SQ6A 4ZZCA 4A98A 2C9TA 5HCMA 2BG9B 4PIRA 5IUXA 2WNCA 5BRXA 3RHWA 4Z91A 5KZUA 2XNUA 4ALXA 4TWDA 4IREA 5LXBA 3RIAA 1OEDC 5AINA 3WTMA 2YKSA 4B5DA 2M6BA 5AFKA 3GUAA 5CO5A 3LSVA 5BP0A 4ILAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8J A;  4HFC A;  4F8H A;  2BYN A;  3U8M A;  2MAW A;  5HEJ A;  2Y57 A;  2WN9 A;  5TVC A;  5J5F A;  3JAD A;  4IL9 A;  5HCJ A;  2PH9 A;  5J5I A;  4QAA A;  2XQ7 A;  3WTJ A;  2BYS A;  4QH1 A;  5FJV A;  3U8N A;  4HFE A;  3TLW A;  2W8F A;  3WTN A;  4LML A;  2XYT A;  3C79 A;  4XK9 A;  2YN6 A;  4AFG A;  3TLT A;  3WTH A;  3JAF A;  3SH1 A;  1OED E;  3UU6 A;  4HQP A;  4ZJT A;  2XNV A;  4AFT A;  3RQU A;  3UQ7 A;  4ILC A;  2XZ6 A;  4WV9 A;  2XYS A;  4TWF A;  4X5T A;  2BR7 A;  4LMK A;  2XQ9 A;  2WNJ A;  2WZY A;  3WTO A;  5BW2 A;  4UXU A;  3ZDG A;  2XZ5 A;  4IL4 A;  5CFB A;  1OED A;  1UW6 A;  2W8G A;  4XHE A;  5SYO A;  5AFN A;  2Y54 A;  5L47 A;  2XQA A;  4TNW A;  4LMJ A;  4UM1 A;  2XQ3 A;  4ZJS A;  5AFH A;  4TNV A;  3P50 A;  4HFB A;  2ZJV A;  5AFM A;  5HEH A;  2BG9 C;  1I9B A;  3UUB A;  4ZR6 A;  3WIP A;  2YMD A;  2LKH A;  2XQ5 A;  3IGQ A;  5L4H A;  5J5G A;  3SIO A;  5JME A;  2QC1 B;  4BFQ A;  4UY2 A;  3P4W A;  4UM3 P;  2VL0 A;  4NPP A;  2LLY A;  3C84 A;  2BYP A;  4QH5 A;  1OED B;  2YME A;  4UM3 A;  2LKG A;  4QH4 A;  5L4E A;  3UU8 A;  4BQT A;  2M6I A;  4HFI A;  2PGZ A;  2XQ4 A;  3TLU A;  3UU3 A;  4D01 A;  5J0Z A;  1UV6 A;  4QAB A;  3EAM A;  2X00 D;  3WTK A;  3PEO A;  3UQ4 A;  2BYR A;  3TLS A;  3UU4 A;  1UX2 A;  4DBM A;  5J5H A;  5HEO A;  4AFH A;  4ZZB A;  4EZ1 A;  5KE4 A;  2ZJU A;  4ZK1 A;  2WNL A;  3ZKR A;  3U8L A;  2BG9 E;  5HEU A;  5AFJ A;  3PMZ A;  3WTL A;  5AFL A;  4A97 A;  2X00 A;  2Y7Y A;  3WTI A;  4COF A;  4FRR A;  4HFD A;  2XQ8 A;  2LM2 A;  2BJ0 A;  2UZ6 A;  4Z90 A;  2BR8 A;  4ILB A;  3RQW A;  4TWH A;  2BG9 A;  5HEG A;  3RI5 A;  2Y56 A;  2Y58 A;  4UM3 S;  3SQ9 A;  3U8K A;  3T4M A;  3TLV A;  2XNT A;  3JAE A;  4ZK4 A;  4HFH A;  3ZDH A;  2BYQ A;  2KSR A;  4QAC A;  2YOE A;  4ZRU A;  5AFM B;  3UU5 A;  2XQ6 A;  3EHZ A;  3RIF A;  3EI0 A;  5LG3 A;  4NZB A;  3SQ6 A;  4ZZC A;  4A98 A;  2C9T A;  5HCM A;  2BG9 B;  4PIR A;  5IUX A;  2WNC A;  5BRX A;  3RHW A;  4Z91 A;  5KZU A;  2XNU A;  4ALX A;  4TWD A;  4IRE A;  5LXB A;  3RIA A;  1OED C;  5AIN A;  3WTM A;  2YKS A;  4B5D A;  2M6B A;  5AFK A;  3GUA A;  5CO5 A;  3LSV A;  5BP0 A;  4ILA A; 
#chains in the Genus database with same CATH topology
 3GN5 B;  5FY1 A;  2J47 A;  5EK2 A;  2W63 A;  4IL9 A;  4DV5 T;  3U8N A;  3H37 A;  3ZMU B;  5AQF B;  1HG5 A;  3HA4 A;  4LML A;  3C79 A;  4H9P C;  5DAB A;  4HQP A;  2QVA A;  4U2Y A;  2CCQ A;  4H9N C;  5JDG A;  3R6N A;  2GK9 A;  2V7I A;  1VCT A;  3S4U A;  2PG8 A;  4WW0 A;  2YMD A;  4GYS A;  3P7I A;  4IHJ E;  5ETW A;  1HNX T;  4AKI A;  3F31 A;  3KFW X;  3ZT5 A;  5DQW A;  3UU3 A;  1O3X A;  4EIW A;  2CXF A;  2X00 D;  3PEO A;  3UQ4 A;  2BYR A;  3UU4 A;  3MJX A;  3AAE B;  4B3M T;  1D0Z A;  3PUV F;  1QSD A;  2XTL A;  5AFJ A;  4YTN A;  1BR1 A;  5JDN A;  4HFD A;  1WCR A;  4UVC B;  3HL6 A;  5FXX A;  2BR8 A;  2JMH A;  3RQW A;  3RI5 A;  2IHR 1;  3AA7 B;  1UGO A;  3I0Q A;  4L9I A;  2WDQ A;  1UX5 A;  2LM9 A;  3HKE E;  2XQ6 A;  3K3N A;  4AKH A;  3ZN0 B;  3CWZ B;  3KDS E;  4B3S T;  4ERR A;  2BZB A;  4YT0 A;  2FJB A;  2XAS B;  2YIN A;  2XNU A;  2W62 A;  4TWD A;  4EZ4 A;  3RIA A;  3ZCJ A;  2WB5 A;  4KHZ F;  2BBH A;  3C4Z A;  2WSS V;  3NZQ A;  2I6H A;  3MKD A;  4HEA A;  1W09 A;  5TVC A;  2PH9 A;  5FL0 A;  1KF6 A;  3WTJ A;  2PFV A;  4JLE A;  3UUN A;  4DBR A;  5ABG A;  4QH1 A;  4QX8 B;  4EXT A;  2W8F A;  4DID B;  4JEU B;  3O1J A;  2Q9Q A;  3AEE A;  3ZC0 A;  1UX4 A;  5FP3 A;  3DTO A;  3T8O A;  2HN2 A;  4UXU A;  3ESL A;  3WAK A;  2VB6 A;  3PUS A;  4UM1 A;  4PFO A;  5IHY A;  4PNI A;  2BS2 A;  1IBK T;  3C4X A;  5AQV B;  2LKH A;  2I0M A;  4JI8 T;  3IA3 A;  4UM3 P;  2Y8D A;  5LP6 E;  5TAO A;  4G2A A;  4BQT A;  3N9Q A;  1ZKE A;  5F8P A;  3IF8 B;  1FIO A;  5ADX L;  4ZI2 C;  2Y7Y A;  2XQ8 A;  3F57 A;  4YHH T;  2BG9 A;  1G73 A;  1X79 A;  2WBL A;  2CM0 A;  2NWB A;  2NTY A;  2Y48 B;  4PK6 A;  3H3M A;  4JI1 T;  3QOF A;  4CN1 A;  2E9X A;  2NW9 A;  4X20 E;  4ZZC A;  2W00 A;  1HR0 T;  4A98 A;  4DV2 T;  2D9D A;  5BRX A;  2W2U A;  5F3J A;  4IE4 A;  2V5C A;  4IE5 A;  4UF0 A;  3LK2 B;  5H6R B;  2JQH A;  1L0V A;  3AE7 A;  4O4J E;  3N2G E;  4UEM A;  2WN9 A;  3RGL A;  4JI5 T;  2BKO A;  4IDP A;  4ZI3 D;  4ADZ A;  2UXB T;  3CX7 B;  2J4G A;  4AQF A;  3MA9 A;  4X62 T;  3AE6 A;  2V7L A;  3PTR B;  5L3C B;  3RQU A;  3BQI A;  4WV9 A;  4DV7 T;  5JTG A;  2ES0 A;  4HWC A;  3OYZ A;  2JIW A;  3CK6 A;  5AFN A;  3PUR A;  2XQA A;  3RKO A;  4DMV A;  1ZV4 X;  3UFG A;  2K24 A;  3UUM A;  3RLF F;  2X9Y A;  2CE7 A;  3OJA A;  3RF1 A;  2CLY C;  1J1J A;  3RYH E;  4N78 D;  4HKA A;  2VKD A;  1JNZ A;  1MIY A;  3ZSS A;  2V26 A;  3J9X 1;  3WTL A;  2LM2 A;  1XWM A;  2QYW A;  1HNW T;  4ILB A;  2Y58 A;  5JVD E;  5JQG E;  4P0B A;  3EAB A;  4BAY B;  3GN5 A;  2W67 A;  4ANJ A;  4PIR A;  5FY7 A;  1XDO A;  1OWA A;  2BKN A;  4X64 T;  1OED C;  2M6B A;  3GUA A;  3FZF B;  4KBM B;  4UR9 A;  2WZI A;  3CQG B;  3CML A;  3OBV E;  3HKD E;  2Q9Q C;  2X68 A;  4P0A A;  2YU2 A;  4H9S E;  2X9X A;  2XYT A;  4C91 A;  3HKB E;  2CXL A;  4JI0 T;  5LBM A;  2BR7 A;  5BW2 A;  3ZDG A;  2CHO A;  4O2A E;  4XHE A;  5LNK A;  5AQT B;  4HGA A;  5LA6 E;  4YY3 T;  2HPJ A;  4O4I E;  5AFM A;  4PK5 A;  4CXX A;  5BMV E;  3C50 A;  4O4H E;  3AE9 A;  2SPC A;  2V8S V;  3C84 A;  1OED B;  3N9M A;  2E8I A;  3AE5 A;  3ABV A;  2DWK A;  5EZY E;  4DBM A;  1UX2 A;  2XAQ B;  1N33 T;  3PMZ A;  1BR0 A;  3WTI A;  2C5J A;  5IYZ E;  5HEG A;  1S35 A;  3FBL A;  2CXD A;  3K3O A;  2Y56 A;  1UCU A;  2CPT A;  4DO0 A;  1ZHC A;  2XQY A;  4IE0 A;  4TN7 B;  3PU3 A;  5KDM C;  1WYC A;  2C5K T;  2UXX B;  4DND A;  2P9B A;  1AJ3 A;  3VR8 A;  1GQE A;  2LHN A;  3PV0 F;  4IE7 A;  2W4X A;  3EDV A;  5HXH A;  5JDQ A;  3AAI A;  4DMW A;  3P4R A;  1H7C A;  2ZM8 A;  2VVN A;  4DR6 T;  3BQL A;  2XSB A;  1UK5 A;  1W9R A;  3ZJ1 A;  4NIQ A;  3RC3 A;  2QRX A;  2L9Q A;  3OYX A;  5J2U E;  3KV9 A;  2LSI A;  4MHC A;  4CI3 B;  3WTO A;  4E7Z A;  4UXN B;  2W8G A;  2KT9 A;  5AFH A;  3QB5 A;  3N5L A;  4IIJ E;  5HEH A;  4P1N A;  1WR6 A;  2JQ9 A;  5BR8 T;  3EUH A;  3IGQ A;  2W61 A;  1B7T A;  1G8X A;  2MTQ A;  3RIU C;  3AEG A;  2YME A;  1VCS A;  2HPL A;  1LKX A;  3AAA B;  2WNL A;  3RX6 A;  2WQY A;  4COF A;  4FRR A;  3P8C D;  5AQS B;  3L3P A;  4UV9 B;  3VKH A;  1T8B A;  3ZN1 B;  2D5U A;  2V7K A;  1WLX A;  3I1A A;  4TUY E;  4I50 E;  2XHE B;  1NEN A;  4YSZ A;  3AA6 B;  5LXB A;  5AIN A;  3CPZ A;  3KVB A;  4HFC A;  5J2T E;  1YKE B;  2Y57 A;  4MBQ A;  4EOZ B;  4X1Y E;  4HFE A;  2WU5 A;  1V9D A;  3K1S A;  2I59 A;  4JI7 T;  2YN6 A;  2KWH A;  2IC6 A;  5A1L A;  5KXJ A;  5LMU T;  4IDZ A;  4DUZ T;  5HXE A;  3UQ7 A;  4UV8 B;  5JR9 B;  3K8P C;  5JRC B;  2NOX A;  3N9P A;  4IL4 A;  5SYO A;  5L47 A;  4LMJ A;  4TX5 A;  3N9L A;  4U74 A;  3QUJ A;  1XNR T;  2WP9 A;  4CN4 A;  2N9D A;  4JBW F;  3M65 A;  5J5G A;  2V5D A;  3FZM B;  2CBI A;  3IBP A;  2BYP A;  2C5I T;  4F6R C;  3V5S A;  1QLB A;  5LYJ E;  5HAX A;  1E2A A;  4JV5 T;  4UIG A;  2N1G A;  4ASK A;  5JDM A;  1KNR A;  5L3D B;  2X00 A;  4LF5 T;  3O1I A;  3VRA A;  3I0O A;  3AVR A;  2VVS A;  2ODV A;  3Q2M A;  4NXN T;  5FL1 A;  5AFM B;  4U2Z A;  3UU5 A;  4XAX B;  1YD8 G;  1IBL T;  4DR3 T;  1S94 A;  3SWH A;  4YTM A;  5KZU A;  2K3W A;  2X51 A;  3RPU A;  4ZS3 A;  4CXY A;  4K0U A;  5AFK A;  2XJ7 A;  2PTF A;  5AQG B;  1R8I A;  1IZN B;  5CA0 E;  5HEJ A;  3LG7 A;  2MYS A;  4H9R C;  2DNX A;  3NRX A;  4QX7 B;  4GYR A;  5AQJ B;  4HWD A;  1XNQ T;  2WS3 A;  5M4Y A;  3JAF A;  3A8Y C;  2AXD S;  4H63 V;  4ZJT A;  2FJD A;  4HWF A;  4YJ2 E;  1HX1 B;  1OED A;  3N2O A;  3G06 A;  2XQ3 A;  4ZJS A;  4XZC A;  1IJ6 A;  5CB4 E;  3SS1 A;  3ZYL A;  3VHL A;  1YKH B;  2X9W A;  4M1P A;  4MLK A;  4EV6 A;  1D1A A;  2UU9 T;  3E08 A;  2XQ5 A;  3AEF A;  2B76 A;  1QUU A;  2W0G A;  1MMA A;  1D0X A;  3QK6 A;  2JQK A;  2M67 A;  3SFE A;  1UV6 A;  1N36 T;  3PJA A;  5KE4 A;  2MPK A;  2BG9 E;  1NAF A;  2JJ9 A;  3LK4 2;  4TWH A;  3JCF A;  2UUA T;  2CMR A;  1MNE A;  5J1G A;  3PU8 A;  3AED A;  3ZPO A;  4H9Q C;  2JQQ A;  4LF4 T;  3SRZ A;  4HFH A;  4PJM A;  2FJA A;  3KBT A;  1HCI A;  4ZRU A;  4KX6 A;  4UEL A;  3T1Y T;  2W66 A;  3D0T A;  4NZB A;  2OLT A;  3MK7 C;  4ILU A;  3T1H T;  3PUA A;  1X9B A;  3MAC A;  3N9N A;  3PUW F;  2YKS A;  5FMN A;  2ZM6 T;  4AI6 A;  3HR0 A;  5BP0 A;  1MND A;  3AE3 A;  2H3R A;  1W0B A;  2AE9 A;  2MAW A;  4KHP T;  2VKJ A;  4QAA A;  3NWI A;  3AE2 A;  5FY0 A;  1N34 T;  3PUY F;  3NZP A;  3RRW A;  4EYY R;  2G0U A;  4HWH A;  1E1H B;  2KZ7 B;  5JH7 E;  4IDO A;  2WNJ A;  4EGW A;  5ABE A;  4KI0 F;  4AXP A;  2J1D G;  1Y01 A;  1KFY A;  4AKG A;  2X0H A;  5LHG B;  4LF8 T;  2WU2 A;  5AQU B;  2LLY A;  3I9W A;  1T98 A;  3LDQ B;  4AIS A;  4LF7 T;  5AQO B;  4EB6 E;  1ZOY A;  2K5B B;  2LSK A;  3ZYK A;  2DI4 A;  1W0A A;  2WAU A;  4GKJ T;  5HYA A;  4ISS A;  2LOP A;  2UZ6 A;  4FI5 A;  2X0L B;  1M62 A;  2LOS A;  1VOM A;  2LSG A;  2DL1 A;  2EHO D;  3RIU A;  2FJE A;  4QAC A;  1WR0 A;  5L3E B;  3RC8 A;  4YLH A;  3C51 A;  4X66 T;  4JI6 T;  1I94 T;  4AKR B;  2V7M A;  5IWA T;  2CA5 A;  3ANW B;  4AQG A;  2B1E A;  4EYU A;  2LT3 A;  2DWG A;  3L09 A;  4JI3 T;  3CKD A;  3ONL C;  3E22 E;  4ILA A;  2WZH A;  3U8J A;  4Q25 A;  4F8H A;  3KVA A;  5JR9 A;  3IEE A;  3LFM A;  5JRC A;  2PBI A;  3WI3 A;  5HXS A;  2HH7 A;  1LVF A;  3PJA J;  4XK9 A;  3UT5 E;  3TLT A;  3WTH A;  1HTJ F;  2XZ6 A;  1T72 A;  4JUY A;  5AQP B;  4QXH B;  4TNW A;  5EK3 A;  4IE6 A;  4YHJ A;  3X1D A;  4KMC A;  2WCA A;  1I9B A;  3P4Q A;  2KWI B;  4ZR6 A;  3PUG A;  4HWI B;  1YQ3 A;  3SIO A;  3CQX C;  4A5X A;  4QXC B;  2VKO A;  3FBZ A;  2Z6E A;  4EZH A;  1D0Y A;  1MMD A;  2LRK A;  2KMF A;  2VK9 A;  3V5U A;  3TLS A;  5LG4 A;  4I55 E;  4AFH A;  1FMW A;  2XUE A;  4H9O C;  2YDS A;  3AEC A;  2ZM2 A;  5HEU A;  5L2L A;  3NRY A;  4DV4 T;  5FYM A;  1ZEE A;  2K48 A;  4O4L E;  5HXC A;  4LFC T;  3UUL A;  3SFD A;  4O8S A;  5IUX A;  5ABH A;  5HWX A;  3QC9 A;  3RHW A;  3N2K E;  3B5M A;  4X1K E;  2CRB A;  3I9Y A;  3ZLI A;  4B5D A;  3OTO T;  2K9A A;  2BS3 A;  2XPK A;  3C64 A;  5GON E;  1I6Z A;  3LJC A;  3RYF E;  2KIN B;  2LHR A;  4B3T T;  4ZI3 C;  5LGT B;  4I0U A;  5EK4 A;  2XNV A;  5FXZ A;  4FJO A;  2XQ9 A;  2IML A;  2DCF A;  3UFE A;  2Y54 A;  4JI2 T;  4ZOL E;  3P50 A;  3AE1 A;  1HF8 A;  5ABF B;  5JME A;  4BFQ A;  2VL0 A;  4OFZ A;  5CA1 E;  4HFV A;  4JI4 T;  2BDE A;  3OKQ A;  2OV9 A;  5L4E A;  4TZ4 C;  2PGZ A;  3FXD B;  2EHO C;  2RP4 A;  2YEV C;  1Z0P A;  2N2N A;  4ZK1 A;  2VKH A;  1HX8 A;  3EVY A;  2BJ0 A;  1E7P A;  1WRD A;  4DV6 T;  2LJL A;  1KNZ A;  3B13 A;  3H3A A;  4U7I A;  3EDU A;  3P4S A;  2A2F X;  1YXR A;  4LFB T;  3M3Z B;  3SQ6 A;  2MBG A;  5H6Q B;  5HCM A;  5LHH B;  3CQC B;  1YW0 A;  2WNC A;  4DV1 T;  3RRC A;  3KIN B;  4I4T E;  4IRE A;  1D1C A;  2LEH A;  2UXC T;  5CO5 A;  5JR9 C;  1JNR A;  1IBM T;  1KNP A;  5JRE A;  4DR2 T;  5LJM A;  2EHO B;  3U8M A;  5J5F A;  3ONJ A;  1FJG T;  1LVK A;  3RYC E;  4WNK A;  2XM1 A;  3TLW A;  3IHR A;  5L3B B;  4QXB B;  4YJ3 E;  5AQR B;  3ZMS B;  3N9O A;  2V6Y B;  5LJN A;  5LCY A;  2H88 A;  4B6X A;  2VL8 A;  4U72 A;  4JEH B;  3WAJ A;  4BA9 A;  3WIP A;  2NTX A;  3QB5 K;  1N32 T;  4CQI A;  2NR4 A;  5LHI B;  1HFA A;  3GWH A;  2X67 A;  3PE0 A;  3MXZ A;  4HFI A;  4E7S A;  4CI1 B;  5J5H A;  5KMG P;  4ZZB A;  4EZ1 A;  4G63 A;  2X0Y A;  1HNZ T;  4IT4 A;  1IAP A;  2JRK A;  2IC9 A;  5AFL A;  3KV5 A;  2VQE T;  3DJB A;  1J5W A;  2BVL A;  2JMK A;  3CVR A;  1BR4 A;  2YDR A;  3NVO A;  5AQQ B;  3ANW A;  5LOV E;  2CHN A;  5C8Y E;  2IAK A;  1EZ3 A;  4PJN A;  2UUC T;  3ZMZ B;  4HN9 A;  2WY2 A;  2UUB T;  4ALX A;  1US7 B;  2IW5 B;  5AQK B;  2JPF A;  3WTM A;  2D2S A;  3P4P A;  5C2T A;  3HKC E;  3KV6 A;  2YK0 A;  2WDV A;  4CZZ B;  4HE8 A;  5HCJ A;  2XQ7 A;  1KK7 A;  4EED A;  2V6X A;  4IDN A;  3VU7 H;  1T7S A;  1U5P A;  4OHF A;  4NUV A;  1OED E;  2XAH B;  2ZM0 A;  2IDO B;  1UW6 A;  4OK0 A;  3QNU A;  1SHZ C;  3Q5W A;  3AE4 A;  4V1A v;  2LKG A;  2D0T A;  2NW7 A;  4HTE A;  5LBQ B;  1KEY A;  3TLU A;  4QAB A;  2FBW A;  3WTK A;  1HS7 A;  2R6G F;  3E0Z A;  3ZKR A;  3O9X A;  2FUP A;  4QWN B;  5CGM A;  2XY8 B;  3KBU A;  3LBX A;  1OXZ A;  3ZCI A;  2H7O A;  2KXP B;  2XNT A;  4ZK4 A;  2X9H A;  3ZDH A;  2E5V A;  1U4Q A;  5AQN B;  3NKZ A;  2C9T A;  4YTP A;  1HG2 A;  2XM2 A;  4IST A;  4PJJ A;  3R84 B;  2BKP A;  1SA0 E;  3GA8 A;  5LMN T;  2BBJ A;  3AVS A;  4TV8 E;  3CIR A;  1IJ5 A;  5HXR A;  5DJQ C;  2WWV A;  4IGU A;  1BR2 A;  2Q9Q D;  2BS4 A;  3AXJ A;  4OYJ A;  1NEK A;  3O1H A;  2H7V C;  4DR5 T;  3PUZ F;  2F4V T;  2WMO A;  5C3J A;  5ABF A;  4UVA B;  3ZMT B;  2E2A A;  4AFT A;  2QGS A;  4TWF A;  4X5T A;  2XYS A;  4GOU A;  4LF6 T;  3VKG A;  5CFB A;  4ZXL A;  2XAG B;  3JC6 D;  4EAH A;  3AA0 B;  1XDP A;  3KV4 A;  3AEB A;  4HFB A;  3A7M A;  4ZHQ E;  3K3Q C;  4J2C A;  3P4W A;  2CEA A;  3FZL B;  3MZK B;  3FXE B;  2M6I A;  3C98 B;  3ZT7 A;  2LRL A;  4PFP A;  4DR4 T;  5AQM B;  5HEO A;  3U78 A;  3OVU A;  2ZJU A;  4EEB A;  3Q5E A;  1CUN A;  4WBO A;  3Q5X A;  2VAS A;  4PK4 A;  2D0U A;  2E9X D;  5FXV A;  2BYQ A;  2YOE A;  3EHZ A;  4MAL A;  3RIF A;  2CWO A;  3EI0 A;  3C4W A;  2EHO A;  2A9U A;  1M7K A;  2UXN B;  2CWY A;  4KP3 C;  2KLQ A;  1NWM X;  4I43 B;  2A72 A;  1MIV A;  2WDR A;  1FEW A;  2QA7 A;  2V6Y A;  3OPC A;  4AFG A;  1LRZ A;  3Q5D A;  5JDH A;  4NXM T;  2X66 A;  3SH1 A;  3UU6 A;  3AE8 A;  4WZX A;  3O4X E;  5F5W A;  4ILC A;  4A56 A;  2YDQ A;  2ODU A;  4LMK A;  2WZY A;  4ZS2 A;  4GKK T;  3W15 B;  4WYV A;  2ACX A;  4YXD A;  4AKL A;  4U33 A;  3BQK A;  2XAF B;  3NBX X;  3FB2 A;  2MOZ A;  2QC1 B;  4UY2 A;  3UTK A;  1XMQ T;  4NPP A;  4UM3 A;  2OA5 A;  4AIU A;  4QH4 A;  5CJ5 A;  4DUY T;  4BJM A;  2WM9 A;  1XZY A;  3LK3 B;  2IUB A;  4O2B E;  5FNV E;  4PAG A;  2NP9 A;  4U3C A;  4ZEY A;  4YSY A;  2XAJ B;  2Y6X A;  2J62 A;  4QKN A;  5FXW A;  2CLY B;  1D1B A;  3SQ9 A;  3U8K A;  2VWA A;  4CI2 B;  3FZH B;  4LFA T;  5E0O A;  3DP7 A;  5LG3 A;  5FVK A;  5FVL A;  2E5L T;  4GK5 E;  1SUM B;  1MIW A;  3ZJ2 A;  4Z91 A;  3B57 A;  2LE8 A;  5LGN B;  1XMO T;  2H89 A;  1Z8U A;  2C0S A;  3U3I A;  2BYN A;  2VUR A;  3JC6 C;  5J5I A;  3ZC1 A;  4CN6 A;  2BYS A;  1Y64 B;  5LGU B;  2XZE A;  4XBF B;  4GIW A;  3WTN A;  3LBX B;  3ZST A;  3FHN A;  5KX5 E;  4YFS A;  5AQH B;  1UUS A;  4DR1 T;  4DV3 T;  4X1I E;  2XZ5 A;  2A3D A;  2ZLY A;  3A5X A;  2VQF T;  2YU1 A;  2ZJV A;  2Q9Q B;  4X65 T;  4U31 A;  2BG9 C;  4JYA T;  3AB3 B;  2NW8 A;  3UUB A;  3Q9D A;  2L3L A;  1UUR A;  4QH5 A;  3VR9 A;  1WFD A;  3UU8 A;  4CXW A;  5AQL B;  4QHO A;  2E9X C;  5J0Z A;  1DU2 A;  4LF9 T;  3EAM A;  3AXJ B;  4K0K T;  5L3G B;  2HHH T;  4IDQ A;  3CX8 B;  3U8L A;  3ZMV B;  4L0R A;  5DQV A;  4BJN A;  1MMN A;  3SOL A;  4Z90 A;  3RYI E;  1ZP0 A;  4U7Y A;  3T4M A;  1J5E T;  3TLV A;  3JAE A;  4P09 A;  4DR7 T;  4AQF C;  5AFU L;  3AEA A;  2BG9 B;  3ETV A;  4DV0 T;  2RPA A;  4PJL A;  3F2E A;  3AA1 B;  3ONX A;  5AQI B;  4NUU A;  1MMG A;  2E9X B;  2UXD T;  4ZI7 E;  2ACZ A;  2XSA A;  3FZK B;  3JAD A;  2IIU A;  2DLR A;  2BVM A;  2DHR A;  3UUX B;  4H63 H;  5FJV A;  4UVB B;  2PJQ A;  2CBJ A;  4TV9 E;  4UF0 B;  2RA1 A;  3HI2 A;  3ZEF B;  3PUQ A;  4KUM B;  1SE7 A;  4TNV A;  4PW8 A;  3GMI A;  1WYB A;  3L8R A;  4GK0 E;  5L3F B;  2WMN A;  3BK9 A;  5L4H A;  3ZT6 A;  1VRB A;  5HWY A;  1CHU A;  1FMV A;  2XQ4 A;  2HN1 A;  2LSY A;  4B3R T;  4D01 A;  5LB7 B;  1YQ4 A;  3VRB A;  4WBN E;  3ETU A;  4C90 A;  2WWU A;  3ZYM A;  4Z8X A;  3RKG A;  4A97 A;  3CX6 B;  5FKY A;  2L8K A;  5JDL A;  2LSJ A;  5JDF A;  2ZMA A;  4UM3 S;  4DVD A;  4YSX A;  2KSR A;  4MFR A;  4AQY T;  5LXT E;  3TKL B;  4ZI2 D;  3L39 A;  3PDY A;  3PUX F;  2KND A;  3RH3 A;  4OYK A;  4L5G A;  4OX9 T;  4DBQ A;  2V7J A;  2V1D B;  3LSV A;  3J7Y q; 
#chains in the Genus database with same CATH homology
 3U8J A;  4HFC A;  4F8H A;  2BYN A;  3U8M A;  2MAW A;  5HEJ A;  2Y57 A;  2WN9 A;  5TVC A;  5J5F A;  3JAD A;  4IL9 A;  5HCJ A;  2PH9 A;  5J5I A;  4QAA A;  2XQ7 A;  3WTJ A;  2BYS A;  4QH1 A;  5FJV A;  3U8N A;  4HFE A;  3TLW A;  2W8F A;  3WTN A;  4LML A;  2XYT A;  3C79 A;  4XK9 A;  2YN6 A;  4AFG A;  3TLT A;  3WTH A;  3JAF A;  3SH1 A;  1OED E;  3UU6 A;  4HQP A;  4ZJT A;  2XNV A;  4AFT A;  3RQU A;  3UQ7 A;  4ILC A;  2XZ6 A;  4WV9 A;  2XYS A;  4TWF A;  4X5T A;  2BR7 A;  4LMK A;  2XQ9 A;  2WNJ A;  2WZY A;  3WTO A;  5BW2 A;  4UXU A;  3ZDG A;  2XZ5 A;  4IL4 A;  5CFB A;  1OED A;  1UW6 A;  2W8G A;  4XHE A;  5SYO A;  5AFN A;  2Y54 A;  5L47 A;  2XQA A;  4TNW A;  4LMJ A;  4UM1 A;  2XQ3 A;  4ZJS A;  5AFH A;  4TNV A;  3P50 A;  4HFB A;  2ZJV A;  5AFM A;  5HEH A;  2BG9 C;  1I9B A;  3UUB A;  4ZR6 A;  3WIP A;  2YMD A;  2LKH A;  2XQ5 A;  3IGQ A;  5L4H A;  5J5G A;  3SIO A;  5JME A;  2QC1 B;  4BFQ A;  4UY2 A;  3P4W A;  4UM3 P;  2VL0 A;  4NPP A;  2LLY A;  3C84 A;  2BYP A;  4QH5 A;  1OED B;  2YME A;  4UM3 A;  2LKG A;  4QH4 A;  5L4E A;  3UU8 A;  4BQT A;  2M6I A;  4HFI A;  2PGZ A;  2XQ4 A;  3TLU A;  3UU3 A;  4D01 A;  5J0Z A;  1UV6 A;  4QAB A;  3EAM A;  2X00 D;  3WTK A;  3PEO A;  3UQ4 A;  2BYR A;  3TLS A;  3UU4 A;  1UX2 A;  4DBM A;  5J5H A;  5HEO A;  4AFH A;  4ZZB A;  4EZ1 A;  5KE4 A;  2ZJU A;  4ZK1 A;  2WNL A;  3ZKR A;  3U8L A;  2BG9 E;  5HEU A;  5AFJ A;  3PMZ A;  3WTL A;  5AFL A;  4A97 A;  2X00 A;  2Y7Y A;  3WTI A;  4COF A;  4FRR A;  4HFD A;  2XQ8 A;  2LM2 A;  2BJ0 A;  2UZ6 A;  4Z90 A;  2BR8 A;  4ILB A;  3RQW A;  4TWH A;  2BG9 A;  5HEG A;  3RI5 A;  2Y56 A;  2Y58 A;  4UM3 S;  3SQ9 A;  3U8K A;  3T4M A;  3TLV A;  2XNT A;  3JAE A;  4ZK4 A;  4HFH A;  3ZDH A;  2BYQ A;  2KSR A;  4QAC A;  2YOE A;  4ZRU A;  5AFM B;  3UU5 A;  2XQ6 A;  3EHZ A;  3RIF A;  3EI0 A;  5LG3 A;  4NZB A;  3SQ6 A;  4ZZC A;  4A98 A;  2C9T A;  5HCM A;  2BG9 B;  4PIR A;  5IUX A;  2WNC A;  5BRX A;  3RHW A;  4Z91 A;  5KZU A;  2XNU A;  4ALX A;  4TWD A;  4IRE A;  5LXB A;  3RIA A;  1OED C;  5AIN A;  3WTM A;  2YKS A;  4B5D A;  2M6B A;  5AFK A;  3GUA A;  5CO5 A;  3LSV A;  5BP0 A;  4ILA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...