4ILCA

The glic pentameric ligand-gated ion channel in complex with sulfates
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ilcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ilcA01
2W8GA 4ZRUA 3U8NA 2XQ6A 4HFDA 2YMDA 3WIPA 4ZK1A 3EI0A 5AFMB 5HEOA 5BW2A 2BR8A 4PIRA 2Y54A 5FJVA 4DBMA 2W8FA 2YMEA 4XK9A 4ZZCA 2BG9E 3RIFA 2X00A 2BJ0A 1OEDA 1UV6A 5JMEA 4HFEA 3ZDGA 2BYPA 3C79A 4EZ1A 1OEDC 3U8LA 5AFLA 3WTOA 5TVCA 4ALXA 3WTNA 5HCMA 4LMKA 3U8JA 4BFQA 4X5TA 4UM3S 4LMLA 2XQ8A 1OEDB 3P4WA 2XYSA 2MAWA 2XQ5A 2ZJVA 2LKGA 2XNVA 3RIAA 2YN6A 3TLSA 3RHWA 4HFBA 2XYTA 3ZDHA 2YOEA 4HFHA 3RQUA 3WTMA 2XNUA 2PGZA 3UQ4A 4TWDA 4TWHA 2WNCA 5AINA 4HFIA 5LG3A 3P50A 3ZKRA 3GUAA 3WTIA 4D01A 2BYQA 3RI5A 4ZZBA 5CO5A 2XQ7A 2M6IA 5L4EA 2X00D 1UW6A 5J5GA 1UX2A 3SH1A 3WTKA 2BYSA 4Z91A 4COFA 4UXUA 5KE4A 4ILAA 2C9TA 4TWFA 5L47A 3SIOA 4B5DA 3WTJA 4A97A 5J0ZA 4HFCA 2XZ5A 5J5IA 5J5FA 4IL9A 4AFGA 3C84A 3LSVA 2WNLA 4QABA 3SQ9A 2BG9A 2UZ6A 2WN9A 4IL4A 1OEDE 3UU4A 4QAAA 5AFMA 3JAFA 2QC1B 4BQTA 4A98A 2XZ6A 2BG9B 5AFNA 4HQPA 5SYOA 4UM3P 3SQ6A 4FRRA 3IGQA 3PMZA 4UM1A 4UY2A 4ZK4A 2BYNA 2XQAA 3U8MA 2PH9A 5BP0A 2BG9C 3TLUA 5CFBA 4NZBA 3EHZA 4ZJTA 2Y56A 4QACA 2LKHA 2XQ4A 3UUBA 4XHEA 5HEHA 4QH1A 3UU8A 3TLWA 2LM2A 4IREA 3UU5A 4UM3A 5AFKA 3PEOA 5KZUA 2KSRA 2WNJA 3TLTA 2Y7YA 3JADA 3U8KA 3UQ7A 5AFJA 2M6BA 5LXBA 4QH4A 4QH5A 4F8HA 4NPPA 3TLVA 2WZYA 3UU3A 3JAEA 2ZJUA 4ZR6A 3WTLA 4ILBA 2Y58A 5HCJA 1I9BA 2XQ9A 3EAMA 2VL0A 5HEUA 4WV9A 2BYRA 5IUXA 3WTHA 4TNVA 4ZJSA 5J5HA 2XNTA 2XQ3A 3RQWA 5HEGA 2YKSA 3T4MA 4AFHA 2LLYA 5BRXA 5L4HA 5HEJA 3UU6A 4ILCA 4LMJA 2Y57A 5AFHA 4AFTA 2BR7A 4TNWA 4Z90A
chains in the Genus database with same CATH superfamily
1UCUA 5HEOA 2X51A 3ZYMA 1UURA 2V7MA 3V5UA 3U8LA 1MIVA 3S4UA 3WTNA 3RYFE 4LMKA 4H9RC 1IZNB 2J47A 2VURA 4XAXB 5BR8T 2XQ5A 3RKOA 2V6XA 2CLYC 1X9BA 4YLHA 3CKDA 3Q5EA 3CWZB 1L0VA 3SH1A 3C4WA 4BJNA 3ZSTA 4ILAA 4EZ4A 2AE9A 3K3OA 4KUMB 4ZI2D 4XBFB 2VKJA 1VCSA 2IAKA 5DABA 2IUBA 2XZ6A 3ONXA 2CHOA 3N2OA 3PMZA 2BYNA 2G0UA 3B57A 3EHZA 4P1NA 4AQYT 4EB6E 1HX1B 5AQIB 3TLWA 5F3JA 1Y64B 5LB7B 4H63H 2M6BA 2Y8DA 1HS7A 4NPPA 2WZYA 3EABA 2VKDA 4IDPA 4PK5A 2N9DA 5AQHB 1FMWA 4LFCT 2JMHA 4DBRA 5HEGA 4I4TE 2ACXA 4AFTA 4TN7B 3VRBA 4Z90A 4K0UA 4LF9T 2I59A 3O4XE 5BW2A 2FJBA 5LXTE 2JQQA 4N78D 4XK9A 3F57A 4X1KE 2BJ0A 3R84B 3O1IA 4HFEA 1HFAA 1HR0T 3HKDE 3M65A 4HKAA 4YT0A 2FJAA 2VL8A 3NKZA 3RIUA 1SE7A 2MOZA 3H3AA 3ABVA 2UXNB 2KT9A 4YTMA 4GK0E 2X67A 5CGMA 4UVBB 4D01A 3RI5A 1BR4A 3UFGA 2LEHA 2LSKA 3K3NA 5FY1A 1UW6A 4WNKA 4H9SE 2C9TA 5L47A 5J5FA 1M62A 3C84A 1IAPA 5LMNT 2XAJB 2OA5A 5AQFB 4HN9A 2WP9A 4BQTA 5J2UE 4J2CA 4NXNT 2KZ7B 1XDOA 2C0SA 4MALA 4ZK4A 4DMVA 4HGAA 4FI5A 3TLUA 2H89A 3NVOA 3RYHE 3UUBA 1J5ET 4HFVA 2ACZA 1MIYA 1HF8A 3AE7A 4OYJA 2YEVC 2CXLA 2PBIA 5HXCA 4PW8A 3WTLA 1HG5A 3EVYA 2VL0A 4P09A 4I50E 4U7IA 2WY2A 5LA6E 2CRBA 4NXMT 1G8XA 4ZRUA 2DWGA 4ZS3A 2E9XC 1FEWA 4X66T 3OYZA 3VKGA 2BS3A 4UIGA 3HI2A 1OEDA 2NWBA 1MMNA 4PNIA 5FXVA 2WWVA 2K48A 3AB3B 5LMUT 2WZHA 3FZLB 2V6YA 3TLSA 4YJ2E 3I9WA 4TWDA 3PUZF 2CE7A 3P50A 3PDYA 1XWMA 1CHUA 3KVBA 4YTNA 3JCFA 4EXTA 2H3RA 3T8OA 4B5DA 1E2AA 2JIWA 2JRKA 3F31A 4H9QC 1I6ZA 5AFNA 5J1GA 5L3DB 4UM3P 3SQ6A 3FB2A 2Q9QA 2XQYA 3IGQA 2Y6XA 3N9MA 2HN2A 3KV6A 3UU5A 2W0GA 3NRYA 2E8IA 4OYKA 3L8RA 3MJXA 2E9XB 3E22E 5FXXA 3LJCA 4EOZB 4JI6T 2KINB 3ZT5A 5HYAA 3KV4A 5JDNA 3RQWA 4WW0A 2Q9QB 3U8NA 2XQ6A 3N9QA 4ZI3C 5EK3A 4IE7A 4KX6A 2VK9A 4GYSA 4DBQA 3P4WA 1B7TA 3RX6A 2BDEA 2PJQA 5CA0E 2WMNA 2YOEA 4JYAT 3ZDHA 3C50A 4CI3B 5J2TE 3FZFB 4V1Av 4B3MT 5LCYA 3WTIA 4DV3T 2Z6EA 3J9X1 3CX8B 4UF0B 3UUNA 1S94A 1UX2A 4Z91A 4COFA 5J0ZA 1KNZA 2XZ5A 2H7OA 2WNLA 2V7JA 2I6HA 1ZOYA 3ZJ1A 3ESLA 2E5LT 1AJ3A 4DV2T 5BP0A 5JDFA 4ANJA 4O4JE 4HTEA 4DV5T 5L3GB 1I94T 2NR4A 3U8KA 3UQ7A 5LXBA 2K24A 3PURA 3WAKA 4C91A 2UXCT 5C8YE 3ZEFB 1W9RA 2IC9A 2LHNA 3GMIA 4X65T 2B1EA 4TX5A 4AISA 2Y57A 3HR0A 5IWAT 2BKPA 2OLTA 3A8YC 3IEEA 4JEHB 3O1JA 4UV9B 3SFDA 1KNPA 5KX5E 5FY7A 3PUQA 3AE1A 2B76A 1QLBA 3U8JA 3N9OA 2V7IA 2LKGA 3U78A 2XYTA 2MYSA 3DJBA 2WNCA 5LG3A 5FKYA 2CA5A 2HN1A 1OWAA 5KE4A 2LSIA 4IDOA 3SIOA 4A97A 2NP9A 5FYMA 3FHNA 3LSVA 4QABA 3RRCA 4DV6T 2DI4A 2CEAA 3OPCA 1T98A 3RYIE 2JQKA 5H6RB 4HQPA 2E5VA 2BZBA 1YQ3A 2VKHA 4CXXA 4JI3T 4UY2A 3GA8A 2PH9A 4YSXA 2UUBT 3QOFA 2Q9QD 1NWMX 1KK7A 2CBJA 4UM3A 1LRZA 3ZN0B 1V9DA 4JI2T 3AEFA 4KP3C 4QH4A 3ZYLA 5DQWA 4L5GA 1VOMA 4X64T 3F2EA 3SS1A 3RC8A 1JNZA 3MKDA 1NEKA 3ONJA 4WBNE 4HWHA 2W63A 3T1YT 5M4YA 3PUSA 2WZIA 2X9YA 1YKEB 4PIRA 4DR1T 2C5JA 4YSYA 5E0OA 5AQRB 4PFPA 5HXSA 4H9OC 4PJNA 4YSZA 3M3ZB 2CHNA 3LBXA 3FBLA 4DR5T 4X62T 2XQ8A 2XYSA 2MAWA 1WR0A 4AKGA 2ODVA 2V6YB 2WBLA 3HKCE 5L3EB 2X9XA 2A3DA 3AE6A 4E7ZA 4JEUB 5L4EA 2X00D 3GN5A 5JR9A 3WTJA 2C5IT 4IL9A 3SQ9A 3DP7A 2V1DB 4ZI3D 4YHHT 3UULA 3JAFA 4BJMA 2V8SV 2N1GA 4IE4A 2Q9QC 4YHJA 1WRDA 2LJLA 2JMKA 2LRLA 2LRKA 2BVLA 2NW9A 4DO0A 3SWHA 5LGNB 3LK3B 5CA1E 5KDMC 1J1JA 4ZHQE 4KHZF 1E7PA 2EHOD 4DV0T 2UUAT 3O1HA 3C4ZA 2QGSA 4KI0F 5JDQA 3EUHA 2BBJA 3JC6C 1BR0A 4AKHA 4O4IE 4ASKA 3AE9A 3DTOA 3AEGA 2I0MA 3UU6A 2X9HA 5JRCB 4ADZA 4PJMA 3PUAA 2A72A 4PJJA 1XZYA 3E0ZA 5AQSB 3MK7C 4PFOA 4ZOLE 5JTGA 2XAQB 5AQTB 4CQIA 3AXJB 1XMQT 1OEDC 5AFLA 2KXPB 3SRZA 4PAGA 4X5TA 3AE2A 4UM3S 3QB5K 3G06A 1S35A 1FIOA 3PJAA 2YN6A 4CN1A 3KBTA 3AE3A 3AEAA 4KBMB 4OX9T 2CXFA 4IHJE 2FUPA 4HFIA 3C98B 1ZHCA 3N5LA 3HA4A 5JDMA 2BYSA 4B3TT 5AQKB 3K1SA 2WN9A 4QAAA 4YFSA 2XAFB 4O8SA 5KMGP 5SYOA 1QUUA 4JI7T 2RP4A 4M1PA 3B5MA 4X1YE 4WBOA 4JUYA 5AQJB 4ZJTA 3EDUA 4UEMA 2AXDS 5DJQC 5FVKA 2LT3A 2IW5B 3IF8B 4I55E 3AAEB 4QH5A 5FNVE 2LOSA 3NWIA 4CI1B 2XSBA 3JC6D 3FZHB 3OKQA 4TNVA 5L3CB 1WYBA 5LGTB 5AQOB 2KMFA 1MIWA 5JH7E 3AXJA 2W4XA 4HWCA 4AFHA 2LLYA 4ILCA 5ABHA 4ZK1A 3RRWA 3N9NA 2CBIA 3SOLA 4ZI7E 5TVCA 4ALXA 2ZM8A 1NENA 2DNXA 3EDVA 5CJ5A 2LE8A 2KNDA 3RIAA 3ZLIA 4ZI2C 4LF5T 3RHWA 3SFEA 3RQUA 4YTPA 3AA7B 2XZEA 3QC9A 2YU1A 2YINA 3U3IA 1MMGA 3ZC1A 1N36T 2D2SA 2CCQA 5AQPB 4JLEA 5LHGB 4UXUA 4TV8E 2NTYA 1T72A 4UVAB 5F5WA 3WI3A 2WDVA 4IL4A 1WLXA 2QC1B 2X0YA 3KFWX 1IJ5A 3AE4A 3VRAA 5CFBA 4H63V 2Y56A 4XHEA 5FXZA 4DR4T 2LM2A 2R6GF 4E7SA 3ETVA 4AQFC 2F4VT 1KF6A 2WWUA 2ZLYA 2ZM0A 3TLVA 1KEYA 5FY0A 5LP6E 1N32T 2W61A 4ILBA 4B3ST 5HCJA 2W62A 2VKOA 3EAMA 4IE0A 5J5HA 1UUSA 4TZ4C 3VKHA 2YKSA 3CVRA 2MBGA 4U3CA 3WIPA 3OBVE 5FJVA 3O9XA 3P8CD 5HXEA 1LVKA 2BYPA 2LSYA 3RYCE 3P4QA 4LMLA 4QKNA 4CZZB 3RF1A 2EHOA 2WMOA 5GONE 4TWHA 2MPKA 2HH7A 2V5DA 1FMVA 5LYJE 4Z8XA 2J4GA 3W15B 1SHZC 2XM2A 3AVSA 3B13A 3D0TA 4EAHA 4L9IA 3ETUA 1Y01A 3Q9DA 2WDQA 5AQGB 3N2GE 2X0LB 2XTLA 5JVDE 2VB6A 4QWNB 2W2UA 4O2BE 3LK2B 4IREA 5AFKA 4ZS2A 3ZCJA 1WYCA 1XMOT 3X1DA 3ZMTB 1WFDA 3PUVF 5AFJA 4F8HA 5BMVE 3JAEA 1MMDA 4LFBT 3UTKA 5HEUA 2BKOA 2EHOC 1E1HB 2OV9A 2C5KT 3T4MA 3ZCIA 1R8IA 3ZN1B 5EK4A 4DMWA 2Y7YA 2W67A 2Y54A 4GOUA 3V5SA 1T8BA 4EGWA 2X00A 5JR9B 5HWXA 4NIQA 4BAYB 4U7YA 1MNEA 3N9LA 3BQIA 4JV5T 3ZSSA 2J1DG 2CWYA 3PUYF 3ZMZB 4EYYR 2JQ9A 4DV4T 4IE6A 4TUYE 5A1LA 4HWFA 2LSJA 3PU3A 4IGUA 4JI8T 2BS4A 1IBKT 5AINA 3E08A 2BYQA 4GKKT 2BS2A 2BBHA 4QXHB 5FXWA 1HTJF 3IA3A 2UU9T 3L3PA 2BG9A 2UZ6A 1OEDE 4YXDA 4CN4A 2L3LA 2HPLA 3ZPOA 1SA0E 2BG9B 3ZJ2A 4ZXLA 3U8MA 4EV6A 2QRXA 4ISTA 4QH1A 2IMLA 2VVNA 3CQXC 3TLTA 4A5XA 2ODUA 4O4HE 3A5XA 4UELA 2WU2A 1FJGT 3UU3A 2KWHA 3KINB 4DUZT 5FVLA 5JR9C 5HXHA 2VWAA 2LHRA 3AE5A 4ZJSA 4F6RC 2XNTA 1UK5A 2DL1A 3T1HT 4YY3T 1HNXT 3AA1B 2ES0A 4L0RA 5LJNA 4HFDA 1KFYA 1Z8UA 5FL0A 4AXPA 3KBUA 4PK6A 2E9XA 3L09A 2E2AA 4OFZA 3KV9A 4OK0A 3ZDGA 3C79A 3WTOA 4MFRA 5HCMA 3AEEA 2SPCA 4IDQA 5H6QB 3WAJA 2WAUA 4ISSA 3QUJA 3AAIA 4U74A 4JBWF 4AI6A 2RPAA 4KHPT 3RPUA 1W0BA 3ZKRA 2JJ9A 4AKLA 4ZZBA 3LDQB 1YQ4A 2D9DA 2NW7A 3HKEE 4HWIB 2X66A 3I0QA 2CM0A 1US7B 2A9UA 1UGOA 3UU4A 4HE8A 2D5UA 4DR6T 3ZMUB 3H3MA 4LF6T 3MZKB 4DR7T 4JI5T 2XPKA 5LHHB 2GK9A 1D0ZA 3QB5A 3ANWB 5AQUB 3LBXB 2KWIB 1VCTA 5ABEA 2X0HA 4EEDA 2UUCT 2UXBT 1JNRA 2WQYA 5FP3A 3RC3A 2WNJA 4LF4T 5JDLA 2D0TA 1I9BA 4CXWA 5FL1A 1N34T 3PUGA 4B6XA 3P4RA 5AQVB 1WR6A 3VHLA 2YDSA 4DVDA 5BRXA 1IBLT 2D0UA 2V7LA 5ABGA 2XJ7A 4TNWA 5ABFA 1LVFA 2YMDA 3CMLA 4P0BA 4DBMA 5ABFB 2XSAA 4U72A 1UV6A 1XDPA 4U2ZA 2V7KA 3ZT6A 4DNDA 4P0AA 2YU2A 3LFMA 3FXEB 3QK6A 5TAOA 2XM1A 3ZYKA 3CK6A 3UFEA 4U33A 3CQCB 3ZT7A 5AQNB 5LGUB 5HAXA 2YDQA 4JI4T 4AKIA 3N2KE 2V5CA 2K3WA 3P4PA 2CWOA 2RA1A 4H9PC 2VVSA 1MNDA 2XAHB 2EHOB 4AQGA 1XNRT 2FJEA 1YD8G 4QXBB 4LFAT 2QVAA 2H88A 5FMNA 1O3XA 3LG7A 3FZMB 2YDRA 3Q2MA 4UR9A 3UT5E 2XY8B 5HEHA 1U4QA 2QYWA 4AIUA 5ADXL 1YW0A 5DQVA 4A56A 3ZMSB 1J5WA 4JI1T 4MHCA 2LM9A 2XUEA 3PU8A 3WTHA 2V26A 3N9PA 2Y48B 4O4LE 4GIWA 3J7Yq 2VASA 3C4XA 1YKHB 5L4HA 2JPFA 5AFHA 2DCFA 2IC6A 4ZZCA 3CX6B 3ZMVB 1LKXA 2N2NA 3FZKB 4IE5A 1D1CA 3BK9A 5JREA 1OEDB 4QXCB 4QHOA 3OVUA 2X9WA 3P4SA 4HFBA 4X20E 4UXNB 4G2AA 4ILUA 5LG4A 1D1BA 3UQ4A 2WM9A 3QNUA 2IHR1 3IHRA 3FXDB 4U31A 3L39A 4WYVA 3AAAB 4GKJT 2YK0A 4OHFA 5L2LA 5AFMA 3K8PC 1UX4A 4A98A 5C2TA 5JDGA 3PV0F 2VQFT 1ZP0A 4UM1A 5AQQB 4CI2B 2LKHA 3LK42 2IDOB 4FJOA 2CMRA 3UU8A 5CB4E 1SUMB 3UUMA 4DV7T 5IYZE 3HL6A 5ETWA 3K3QC 2E9XD 3CPZA 2Y58A 2DLRA 5IUXA 2P9BA 4DIDB 2BVMA 3VR9A 4CXYA 3CX7B 3Q5DA 2BR7A 3BQLA 5KXJA 1MMAA 4QX7B 2K9AA 3MXZA 3RIFA 4ZEYA 2BKNA 4EZ1A 2HPJA 4HWDA 2WU5A 5F8PA 3MA9A 4H9NC 2NTXA 3Q5WA 4EIWA 2XNVA 3AA6B 4BA9A 4XZCA 4K0KT 4EZHA 2XNUA 2PGZA 3CQGB 1CUNA 4PJLA 4DR3T 1W09A 2A2FX 4QX8B 3HKBE 2J62A 5CO5A 3NBXX 4Q25A 3C51A 2PFVA 2HHHT 1U5PA 4I0UA 5C3JA 4TWFA 5HXRA 1W0AA 4TV9E 1NAFA 1ZV4X 1T7SA 2CLYB 2M67A 5JQGE 3AEDA 2L9QA 4UVCB 4JI0T 4LF8T 3I1AA 3JADA 3RLFF 1D0YA 4NUUA 3H37A 2NOXA 4DR2T 2ZJUA 2XQ9A 3AEBA 3CIRA 4IDZA 4WV9A 2BYRA 1HG2A 5LJMA 4PK4A 4X1IE 2WSSV 2XQ3A 3AVRA 4UF0A 2XASB 2XAGB 4NUVA 2PTFA 2W8GA 4DUYT 2QA7A 1KNRA 3EI0A 2H7VC 2BR8A 2ZM2A 3PUWF 5JRCA 3FBZA 2ZM6T 3VR8A 2W8FA 2YMEA 4UV8B 1IJ6A 2BG9E 3OTOT 1XNQT 4YJ3E 3RGLA 3IBPA 4BFQA 2MTQA 3UUXB 2ZJVA 1VRBA 1OXZA 3KVAA 3GWHA 4EEBA 3C64A 3ZC0A 3WTMA 4GYRA 2DHRA 5IHYA 4EYUA 2KLQA 1D1AA 2L8KA 3I9YA 2FBWA 5LOVE 1HCIA 2FJDA 2XQ7A 1HNWT 3GN5B 3WTKA 4IT4A 1WCRA 4AKRB 2WDRA 4AFGA 5LBMA 3Q5XA 3BQKA 2K5BB 3NZQA 3ONLC 5L3BB 2W66A 3PTRB 4IDNA 3KDSE 1YXRA 2LSGA 4NZBA 2XQ4A 1N33T 3PEOA 5KZUA 1BR1A 5AQMB 3NRXA 1H7CA 2NW8A 3MACA 1X79A 5LHIB 4MLKA 4AQFA 2LOPA 1QSDA 3OJAA 3OYXA 4U2YA 4G63A 1M7KA 5JDHA 3TKLB 3PUXF 5HEJA 4GK5E 3KV5A 3AE8A 2W00A 5AFMB 3P7IA 4O2AE 2WB5A 3RKGA 2WCAA 4KMCA 5JMEA 2XHEB 1Z0PA 3I0OA 3ANWA 1BR2A 5L3FB 1HX8A 4IIJE 5AQLB 5EK2A 2DWKA 4HFHA 2JQHA 1ZEEA 1IBMT 4ERRA 2VQET 4B3RT 3VU7H 3GUAA 3AA0B 2M6IA 5J5GA 3PJAJ 3NZPA 1EZ3A 4HEAA 4HFCA 3A7MA 5J5IA 4CN6A 5AFUL 2UXXB 4LF7T 2CPTA 1G73A 2IIUA 4FRRA 3PE0A 4MBQA 2XQAA 3AECA 4DV1T 2PG8A 2BG9C 3RH3A 4QACA 2CXDA 1UX5A 2UXDT 2KSRA 5EZYE 3RIUC 3R6NA 5HWYA 4ZR6A 1D0XA 4WZXA 2WS3A 1DU2A 1GQEA 4I43B 1HNZT 1ZKEA 5LNKA 5LBQB 4LMJA 2ZMAA 2X68A 4C90A
chains in the Genus database with same CATH topology
2W8GA 4ZRUA 3U8NA 2XQ6A 4HFDA 2YMDA 3WIPA 4ZK1A 3EI0A 5AFMB 5HEOA 5BW2A 2BR8A 4PIRA 2Y54A 5FJVA 4DBMA 2W8FA 2YMEA 4XK9A 4ZZCA 2BG9E 3RIFA 2X00A 2BJ0A 1OEDA 1UV6A 5JMEA 4HFEA 3ZDGA 2BYPA 3C79A 4EZ1A 1OEDC 3U8LA 5AFLA 3WTOA 5TVCA 4ALXA 3WTNA 5HCMA 4LMKA 3U8JA 4BFQA 4X5TA 4UM3S 4LMLA 2XQ8A 1OEDB 3P4WA 2XYSA 2MAWA 2XQ5A 2ZJVA 2LKGA 2XNVA 3RIAA 2YN6A 3TLSA 3RHWA 4HFBA 2XYTA 3ZDHA 2YOEA 4HFHA 3RQUA 3WTMA 2XNUA 2PGZA 3UQ4A 4TWDA 4TWHA 2WNCA 5AINA 4HFIA 5LG3A 3P50A 3ZKRA 3GUAA 3WTIA 4D01A 2BYQA 3RI5A 4ZZBA 5CO5A 2XQ7A 2M6IA 5L4EA 2X00D 1UW6A 5J5GA 1UX2A 3SH1A 3WTKA 2BYSA 4Z91A 4COFA 4UXUA 5KE4A 4ILAA 2C9TA 4TWFA 5L47A 3SIOA 4B5DA 3WTJA 4A97A 5J0ZA 4HFCA 2XZ5A 5J5IA 5J5FA 4IL9A 4AFGA 3C84A 3LSVA 2WNLA 4QABA 3SQ9A 2BG9A 2UZ6A 2WN9A 4IL4A 1OEDE 3UU4A 4QAAA 5AFMA 3JAFA 2QC1B 4BQTA 4A98A 2XZ6A 2BG9B 5AFNA 4HQPA 5SYOA 4UM3P 3SQ6A 4FRRA 3IGQA 3PMZA 4UM1A 4UY2A 4ZK4A 2BYNA 2XQAA 3U8MA 2PH9A 5BP0A 2BG9C 3TLUA 5CFBA 4NZBA 3EHZA 4ZJTA 2Y56A 4QACA 2LKHA 2XQ4A 3UUBA 4XHEA 5HEHA 4QH1A 3UU8A 3TLWA 2LM2A 4IREA 3UU5A 4UM3A 5AFKA 3PEOA 5KZUA 2KSRA 2WNJA 3TLTA 2Y7YA 3JADA 3U8KA 3UQ7A 5AFJA 2M6BA 5LXBA 4QH4A 4QH5A 4F8HA 4NPPA 3TLVA 2WZYA 3UU3A 3JAEA 2ZJUA 4ZR6A 3WTLA 4ILBA 2Y58A 5HCJA 1I9BA 2XQ9A 3EAMA 2VL0A 5HEUA 4WV9A 2BYRA 5IUXA 3WTHA 4TNVA 4ZJSA 5J5HA 2XNTA 2XQ3A 3RQWA 5HEGA 2YKSA 3T4MA 4AFHA 2LLYA 5BRXA 5L4HA 5HEJA 3UU6A 4ILCA 4LMJA 2Y57A 5AFHA 4AFTA 2BR7A 4TNWA 4Z90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8G A;  4ZRU A;  3U8N A;  2XQ6 A;  4HFD A;  2YMD A;  3WIP A;  4ZK1 A;  3EI0 A;  5AFM B;  5HEO A;  5BW2 A;  2BR8 A;  4PIR A;  2Y54 A;  5FJV A;  4DBM A;  2W8F A;  2YME A;  4XK9 A;  4ZZC A;  2BG9 E;  3RIF A;  2X00 A;  2BJ0 A;  1OED A;  1UV6 A;  5JME A;  4HFE A;  3ZDG A;  2BYP A;  3C79 A;  4EZ1 A;  1OED C;  3U8L A;  5AFL A;  3WTO A;  5TVC A;  4ALX A;  3WTN A;  5HCM A;  4LMK A;  3U8J A;  4BFQ A;  4X5T A;  4UM3 S;  4LML A;  2XQ8 A;  1OED B;  3P4W A;  2XYS A;  2MAW A;  2XQ5 A;  2ZJV A;  2LKG A;  2XNV A;  3RIA A;  2YN6 A;  3TLS A;  3RHW A;  4HFB A;  2XYT A;  3ZDH A;  2YOE A;  4HFH A;  3RQU A;  3WTM A;  2XNU A;  2PGZ A;  3UQ4 A;  4TWD A;  4TWH A;  2WNC A;  5AIN A;  4HFI A;  5LG3 A;  3P50 A;  3ZKR A;  3GUA A;  3WTI A;  4D01 A;  2BYQ A;  3RI5 A;  4ZZB A;  5CO5 A;  2XQ7 A;  2M6I A;  5L4E A;  2X00 D;  1UW6 A;  5J5G A;  1UX2 A;  3SH1 A;  3WTK A;  2BYS A;  4Z91 A;  4COF A;  4UXU A;  5KE4 A;  4ILA A;  2C9T A;  4TWF A;  5L47 A;  3SIO A;  4B5D A;  3WTJ A;  4A97 A;  5J0Z A;  4HFC A;  2XZ5 A;  5J5I A;  5J5F A;  4IL9 A;  4AFG A;  3C84 A;  3LSV A;  2WNL A;  4QAB A;  3SQ9 A;  2BG9 A;  2UZ6 A;  2WN9 A;  4IL4 A;  1OED E;  3UU4 A;  4QAA A;  5AFM A;  3JAF A;  2QC1 B;  4BQT A;  4A98 A;  2XZ6 A;  2BG9 B;  5AFN A;  4HQP A;  5SYO A;  4UM3 P;  3SQ6 A;  4FRR A;  3IGQ A;  3PMZ A;  4UM1 A;  4UY2 A;  4ZK4 A;  2BYN A;  2XQA A;  3U8M A;  2PH9 A;  5BP0 A;  2BG9 C;  3TLU A;  5CFB A;  4NZB A;  3EHZ A;  4ZJT A;  2Y56 A;  4QAC A;  2LKH A;  2XQ4 A;  3UUB A;  4XHE A;  5HEH A;  4QH1 A;  3UU8 A;  3TLW A;  2LM2 A;  4IRE A;  3UU5 A;  4UM3 A;  5AFK A;  3PEO A;  5KZU A;  2KSR A;  2WNJ A;  3TLT A;  2Y7Y A;  3JAD A;  3U8K A;  3UQ7 A;  5AFJ A;  2M6B A;  5LXB A;  4QH4 A;  4QH5 A;  4F8H A;  4NPP A;  3TLV A;  2WZY A;  3UU3 A;  3JAE A;  2ZJU A;  4ZR6 A;  3WTL A;  4ILB A;  2Y58 A;  5HCJ A;  1I9B A;  2XQ9 A;  3EAM A;  2VL0 A;  5HEU A;  4WV9 A;  2BYR A;  5IUX A;  3WTH A;  4TNV A;  4ZJS A;  5J5H A;  2XNT A;  2XQ3 A;  3RQW A;  5HEG A;  2YKS A;  3T4M A;  4AFH A;  2LLY A;  5BRX A;  5L4H A;  5HEJ A;  3UU6 A;  4ILC A;  4LMJ A;  2Y57 A;  5AFH A;  4AFT A;  2BR7 A;  4TNW A;  4Z90 A; 
#chains in the Genus database with same CATH topology
 1UCU A;  5HEO A;  2X51 A;  3ZYM A;  1UUR A;  2V7M A;  3V5U A;  3U8L A;  1MIV A;  3S4U A;  3WTN A;  3RYF E;  4LMK A;  4H9R C;  1IZN B;  2J47 A;  2VUR A;  4XAX B;  5BR8 T;  2XQ5 A;  3RKO A;  2V6X A;  2CLY C;  1X9B A;  4YLH A;  3CKD A;  3Q5E A;  3CWZ B;  1L0V A;  3SH1 A;  3C4W A;  4BJN A;  3ZST A;  4ILA A;  4EZ4 A;  2AE9 A;  3K3O A;  4KUM B;  4ZI2 D;  4XBF B;  2VKJ A;  1VCS A;  2IAK A;  5DAB A;  2IUB A;  2XZ6 A;  3ONX A;  2CHO A;  3N2O A;  3PMZ A;  2BYN A;  2G0U A;  3B57 A;  3EHZ A;  4P1N A;  4AQY T;  4EB6 E;  1HX1 B;  5AQI B;  3TLW A;  5F3J A;  1Y64 B;  5LB7 B;  4H63 H;  2M6B A;  2Y8D A;  1HS7 A;  4NPP A;  2WZY A;  3EAB A;  2VKD A;  4IDP A;  4PK5 A;  2N9D A;  5AQH B;  1FMW A;  4LFC T;  2JMH A;  4DBR A;  5HEG A;  4I4T E;  2ACX A;  4AFT A;  4TN7 B;  3VRB A;  4Z90 A;  4K0U A;  4LF9 T;  2I59 A;  3O4X E;  5BW2 A;  2FJB A;  5LXT E;  2JQQ A;  4N78 D;  4XK9 A;  3F57 A;  4X1K E;  2BJ0 A;  3R84 B;  3O1I A;  4HFE A;  1HFA A;  1HR0 T;  3HKD E;  3M65 A;  4HKA A;  4YT0 A;  2FJA A;  2VL8 A;  3NKZ A;  3RIU A;  1SE7 A;  2MOZ A;  3H3A A;  3ABV A;  2UXN B;  2KT9 A;  4YTM A;  4GK0 E;  2X67 A;  5CGM A;  4UVB B;  4D01 A;  3RI5 A;  1BR4 A;  3UFG A;  2LEH A;  2LSK A;  3K3N A;  5FY1 A;  1UW6 A;  4WNK A;  4H9S E;  2C9T A;  5L47 A;  5J5F A;  1M62 A;  3C84 A;  1IAP A;  5LMN T;  2XAJ B;  2OA5 A;  5AQF B;  4HN9 A;  2WP9 A;  4BQT A;  5J2U E;  4J2C A;  4NXN T;  2KZ7 B;  1XDO A;  2C0S A;  4MAL A;  4ZK4 A;  4DMV A;  4HGA A;  4FI5 A;  3TLU A;  2H89 A;  3NVO A;  3RYH E;  3UUB A;  1J5E T;  4HFV A;  2ACZ A;  1MIY A;  1HF8 A;  3AE7 A;  4OYJ A;  2YEV C;  2CXL A;  2PBI A;  5HXC A;  4PW8 A;  3WTL A;  1HG5 A;  3EVY A;  2VL0 A;  4P09 A;  4I50 E;  4U7I A;  2WY2 A;  5LA6 E;  2CRB A;  4NXM T;  1G8X A;  4ZRU A;  2DWG A;  4ZS3 A;  2E9X C;  1FEW A;  4X66 T;  3OYZ A;  3VKG A;  2BS3 A;  4UIG A;  3HI2 A;  1OED A;  2NWB A;  1MMN A;  4PNI A;  5FXV A;  2WWV A;  2K48 A;  3AB3 B;  5LMU T;  2WZH A;  3FZL B;  2V6Y A;  3TLS A;  4YJ2 E;  3I9W A;  4TWD A;  3PUZ F;  2CE7 A;  3P50 A;  3PDY A;  1XWM A;  1CHU A;  3KVB A;  4YTN A;  3JCF A;  4EXT A;  2H3R A;  3T8O A;  4B5D A;  1E2A A;  2JIW A;  2JRK A;  3F31 A;  4H9Q C;  1I6Z A;  5AFN A;  5J1G A;  5L3D B;  4UM3 P;  3SQ6 A;  3FB2 A;  2Q9Q A;  2XQY A;  3IGQ A;  2Y6X A;  3N9M A;  2HN2 A;  3KV6 A;  3UU5 A;  2W0G A;  3NRY A;  2E8I A;  4OYK A;  3L8R A;  3MJX A;  2E9X B;  3E22 E;  5FXX A;  3LJC A;  4EOZ B;  4JI6 T;  2KIN B;  3ZT5 A;  5HYA A;  3KV4 A;  5JDN A;  3RQW A;  4WW0 A;  2Q9Q B;  3U8N A;  2XQ6 A;  3N9Q A;  4ZI3 C;  5EK3 A;  4IE7 A;  4KX6 A;  2VK9 A;  4GYS A;  4DBQ A;  3P4W A;  1B7T A;  3RX6 A;  2BDE A;  2PJQ A;  5CA0 E;  2WMN A;  2YOE A;  4JYA T;  3ZDH A;  3C50 A;  4CI3 B;  5J2T E;  3FZF B;  4V1A v;  4B3M T;  5LCY A;  3WTI A;  4DV3 T;  2Z6E A;  3J9X 1;  3CX8 B;  4UF0 B;  3UUN A;  1S94 A;  1UX2 A;  4Z91 A;  4COF A;  5J0Z A;  1KNZ A;  2XZ5 A;  2H7O A;  2WNL A;  2V7J A;  2I6H A;  1ZOY A;  3ZJ1 A;  3ESL A;  2E5L T;  1AJ3 A;  4DV2 T;  5BP0 A;  5JDF A;  4ANJ A;  4O4J E;  4HTE A;  4DV5 T;  5L3G B;  1I94 T;  2NR4 A;  3U8K A;  3UQ7 A;  5LXB A;  2K24 A;  3PUR A;  3WAK A;  4C91 A;  2UXC T;  5C8Y E;  3ZEF B;  1W9R A;  2IC9 A;  2LHN A;  3GMI A;  4X65 T;  2B1E A;  4TX5 A;  4AIS A;  2Y57 A;  3HR0 A;  5IWA T;  2BKP A;  2OLT A;  3A8Y C;  3IEE A;  4JEH B;  3O1J A;  4UV9 B;  3SFD A;  1KNP A;  5KX5 E;  5FY7 A;  3PUQ A;  3AE1 A;  2B76 A;  1QLB A;  3U8J A;  3N9O A;  2V7I A;  2LKG A;  3U78 A;  2XYT A;  2MYS A;  3DJB A;  2WNC A;  5LG3 A;  5FKY A;  2CA5 A;  2HN1 A;  1OWA A;  5KE4 A;  2LSI A;  4IDO A;  3SIO A;  4A97 A;  2NP9 A;  5FYM A;  3FHN A;  3LSV A;  4QAB A;  3RRC A;  4DV6 T;  2DI4 A;  2CEA A;  3OPC A;  1T98 A;  3RYI E;  2JQK A;  5H6R B;  4HQP A;  2E5V A;  2BZB A;  1YQ3 A;  2VKH A;  4CXX A;  4JI3 T;  4UY2 A;  3GA8 A;  2PH9 A;  4YSX A;  2UUB T;  3QOF A;  2Q9Q D;  1NWM X;  1KK7 A;  2CBJ A;  4UM3 A;  1LRZ A;  3ZN0 B;  1V9D A;  4JI2 T;  3AEF A;  4KP3 C;  4QH4 A;  3ZYL A;  5DQW A;  4L5G A;  1VOM A;  4X64 T;  3F2E A;  3SS1 A;  3RC8 A;  1JNZ A;  3MKD A;  1NEK A;  3ONJ A;  4WBN E;  4HWH A;  2W63 A;  3T1Y T;  5M4Y A;  3PUS A;  2WZI A;  2X9Y A;  1YKE B;  4PIR A;  4DR1 T;  2C5J A;  4YSY A;  5E0O A;  5AQR B;  4PFP A;  5HXS A;  4H9O C;  4PJN A;  4YSZ A;  3M3Z B;  2CHN A;  3LBX A;  3FBL A;  4DR5 T;  4X62 T;  2XQ8 A;  2XYS A;  2MAW A;  1WR0 A;  4AKG A;  2ODV A;  2V6Y B;  2WBL A;  3HKC E;  5L3E B;  2X9X A;  2A3D A;  3AE6 A;  4E7Z A;  4JEU B;  5L4E A;  2X00 D;  3GN5 A;  5JR9 A;  3WTJ A;  2C5I T;  4IL9 A;  3SQ9 A;  3DP7 A;  2V1D B;  4ZI3 D;  4YHH T;  3UUL A;  3JAF A;  4BJM A;  2V8S V;  2N1G A;  4IE4 A;  2Q9Q C;  4YHJ A;  1WRD A;  2LJL A;  2JMK A;  2LRL A;  2LRK A;  2BVL A;  2NW9 A;  4DO0 A;  3SWH A;  5LGN B;  3LK3 B;  5CA1 E;  5KDM C;  1J1J A;  4ZHQ E;  4KHZ F;  1E7P A;  2EHO D;  4DV0 T;  2UUA T;  3O1H A;  3C4Z A;  2QGS A;  4KI0 F;  5JDQ A;  3EUH A;  2BBJ A;  3JC6 C;  1BR0 A;  4AKH A;  4O4I E;  4ASK A;  3AE9 A;  3DTO A;  3AEG A;  2I0M A;  3UU6 A;  2X9H A;  5JRC B;  4ADZ A;  4PJM A;  3PUA A;  2A72 A;  4PJJ A;  1XZY A;  3E0Z A;  5AQS B;  3MK7 C;  4PFO A;  4ZOL E;  5JTG A;  2XAQ B;  5AQT B;  4CQI A;  3AXJ B;  1XMQ T;  1OED C;  5AFL A;  2KXP B;  3SRZ A;  4PAG A;  4X5T A;  3AE2 A;  4UM3 S;  3QB5 K;  3G06 A;  1S35 A;  1FIO A;  3PJA A;  2YN6 A;  4CN1 A;  3KBT A;  3AE3 A;  3AEA A;  4KBM B;  4OX9 T;  2CXF A;  4IHJ E;  2FUP A;  4HFI A;  3C98 B;  1ZHC A;  3N5L A;  3HA4 A;  5JDM A;  2BYS A;  4B3T T;  5AQK B;  3K1S A;  2WN9 A;  4QAA A;  4YFS A;  2XAF B;  4O8S A;  5KMG P;  5SYO A;  1QUU A;  4JI7 T;  2RP4 A;  4M1P A;  3B5M A;  4X1Y E;  4WBO A;  4JUY A;  5AQJ B;  4ZJT A;  3EDU A;  4UEM A;  2AXD S;  5DJQ C;  5FVK A;  2LT3 A;  2IW5 B;  3IF8 B;  4I55 E;  3AAE B;  4QH5 A;  5FNV E;  2LOS A;  3NWI A;  4CI1 B;  2XSB A;  3JC6 D;  3FZH B;  3OKQ A;  4TNV A;  5L3C B;  1WYB A;  5LGT B;  5AQO B;  2KMF A;  1MIW A;  5JH7 E;  3AXJ A;  2W4X A;  4HWC A;  4AFH A;  2LLY A;  4ILC A;  5ABH A;  4ZK1 A;  3RRW A;  3N9N A;  2CBI A;  3SOL A;  4ZI7 E;  5TVC A;  4ALX A;  2ZM8 A;  1NEN A;  2DNX A;  3EDV A;  5CJ5 A;  2LE8 A;  2KND A;  3RIA A;  3ZLI A;  4ZI2 C;  4LF5 T;  3RHW A;  3SFE A;  3RQU A;  4YTP A;  3AA7 B;  2XZE A;  3QC9 A;  2YU1 A;  2YIN A;  3U3I A;  1MMG A;  3ZC1 A;  1N36 T;  2D2S A;  2CCQ A;  5AQP B;  4JLE A;  5LHG B;  4UXU A;  4TV8 E;  2NTY A;  1T72 A;  4UVA B;  5F5W A;  3WI3 A;  2WDV A;  4IL4 A;  1WLX A;  2QC1 B;  2X0Y A;  3KFW X;  1IJ5 A;  3AE4 A;  3VRA A;  5CFB A;  4H63 V;  2Y56 A;  4XHE A;  5FXZ A;  4DR4 T;  2LM2 A;  2R6G F;  4E7S A;  3ETV A;  4AQF C;  2F4V T;  1KF6 A;  2WWU A;  2ZLY A;  2ZM0 A;  3TLV A;  1KEY A;  5FY0 A;  5LP6 E;  1N32 T;  2W61 A;  4ILB A;  4B3S T;  5HCJ A;  2W62 A;  2VKO A;  3EAM A;  4IE0 A;  5J5H A;  1UUS A;  4TZ4 C;  3VKH A;  2YKS A;  3CVR A;  2MBG A;  4U3C A;  3WIP A;  3OBV E;  5FJV A;  3O9X A;  3P8C D;  5HXE A;  1LVK A;  2BYP A;  2LSY A;  3RYC E;  3P4Q A;  4LML A;  4QKN A;  4CZZ B;  3RF1 A;  2EHO A;  2WMO A;  5GON E;  4TWH A;  2MPK A;  2HH7 A;  2V5D A;  1FMV A;  5LYJ E;  4Z8X A;  2J4G A;  3W15 B;  1SHZ C;  2XM2 A;  3AVS A;  3B13 A;  3D0T A;  4EAH A;  4L9I A;  3ETU A;  1Y01 A;  3Q9D A;  2WDQ A;  5AQG B;  3N2G E;  2X0L B;  2XTL A;  5JVD E;  2VB6 A;  4QWN B;  2W2U A;  4O2B E;  3LK2 B;  4IRE A;  5AFK A;  4ZS2 A;  3ZCJ A;  1WYC A;  1XMO T;  3X1D A;  3ZMT B;  1WFD A;  3PUV F;  5AFJ A;  4F8H A;  5BMV E;  3JAE A;  1MMD A;  4LFB T;  3UTK A;  5HEU A;  2BKO A;  2EHO C;  1E1H B;  2OV9 A;  2C5K T;  3T4M A;  3ZCI A;  1R8I A;  3ZN1 B;  5EK4 A;  4DMW A;  2Y7Y A;  2W67 A;  2Y54 A;  4GOU A;  3V5S A;  1T8B A;  4EGW A;  2X00 A;  5JR9 B;  5HWX A;  4NIQ A;  4BAY B;  4U7Y A;  1MNE A;  3N9L A;  3BQI A;  4JV5 T;  3ZSS A;  2J1D G;  2CWY A;  3PUY F;  3ZMZ B;  4EYY R;  2JQ9 A;  4DV4 T;  4IE6 A;  4TUY E;  5A1L A;  4HWF A;  2LSJ A;  3PU3 A;  4IGU A;  4JI8 T;  2BS4 A;  1IBK T;  5AIN A;  3E08 A;  2BYQ A;  4GKK T;  2BS2 A;  2BBH A;  4QXH B;  5FXW A;  1HTJ F;  3IA3 A;  2UU9 T;  3L3P A;  2BG9 A;  2UZ6 A;  1OED E;  4YXD A;  4CN4 A;  2L3L A;  2HPL A;  3ZPO A;  1SA0 E;  2BG9 B;  3ZJ2 A;  4ZXL A;  3U8M A;  4EV6 A;  2QRX A;  4IST A;  4QH1 A;  2IML A;  2VVN A;  3CQX C;  3TLT A;  4A5X A;  2ODU A;  4O4H E;  3A5X A;  4UEL A;  2WU2 A;  1FJG T;  3UU3 A;  2KWH A;  3KIN B;  4DUZ T;  5FVL A;  5JR9 C;  5HXH A;  2VWA A;  2LHR A;  3AE5 A;  4ZJS A;  4F6R C;  2XNT A;  1UK5 A;  2DL1 A;  3T1H T;  4YY3 T;  1HNX T;  3AA1 B;  2ES0 A;  4L0R A;  5LJN A;  4HFD A;  1KFY A;  1Z8U A;  5FL0 A;  4AXP A;  3KBU A;  4PK6 A;  2E9X A;  3L09 A;  2E2A A;  4OFZ A;  3KV9 A;  4OK0 A;  3ZDG A;  3C79 A;  3WTO A;  4MFR A;  5HCM A;  3AEE A;  2SPC A;  4IDQ A;  5H6Q B;  3WAJ A;  2WAU A;  4ISS A;  3QUJ A;  3AAI A;  4U74 A;  4JBW F;  4AI6 A;  2RPA A;  4KHP T;  3RPU A;  1W0B A;  3ZKR A;  2JJ9 A;  4AKL A;  4ZZB A;  3LDQ B;  1YQ4 A;  2D9D A;  2NW7 A;  3HKE E;  4HWI B;  2X66 A;  3I0Q A;  2CM0 A;  1US7 B;  2A9U A;  1UGO A;  3UU4 A;  4HE8 A;  2D5U A;  4DR6 T;  3ZMU B;  3H3M A;  4LF6 T;  3MZK B;  4DR7 T;  4JI5 T;  2XPK A;  5LHH B;  2GK9 A;  1D0Z A;  3QB5 A;  3ANW B;  5AQU B;  3LBX B;  2KWI B;  1VCT A;  5ABE A;  2X0H A;  4EED A;  2UUC T;  2UXB T;  1JNR A;  2WQY A;  5FP3 A;  3RC3 A;  2WNJ A;  4LF4 T;  5JDL A;  2D0T A;  1I9B A;  4CXW A;  5FL1 A;  1N34 T;  3PUG A;  4B6X A;  3P4R A;  5AQV B;  1WR6 A;  3VHL A;  2YDS A;  4DVD A;  5BRX A;  1IBL T;  2D0U A;  2V7L A;  5ABG A;  2XJ7 A;  4TNW A;  5ABF A;  1LVF A;  2YMD A;  3CML A;  4P0B A;  4DBM A;  5ABF B;  2XSA A;  4U72 A;  1UV6 A;  1XDP A;  4U2Z A;  2V7K A;  3ZT6 A;  4DND A;  4P0A A;  2YU2 A;  3LFM A;  3FXE B;  3QK6 A;  5TAO A;  2XM1 A;  3ZYK A;  3CK6 A;  3UFE A;  4U33 A;  3CQC B;  3ZT7 A;  5AQN B;  5LGU B;  5HAX A;  2YDQ A;  4JI4 T;  4AKI A;  3N2K E;  2V5C A;  2K3W A;  3P4P A;  2CWO A;  2RA1 A;  4H9P C;  2VVS A;  1MND A;  2XAH B;  2EHO B;  4AQG A;  1XNR T;  2FJE A;  1YD8 G;  4QXB B;  4LFA T;  2QVA A;  2H88 A;  5FMN A;  1O3X A;  3LG7 A;  3FZM B;  2YDR A;  3Q2M A;  4UR9 A;  3UT5 E;  2XY8 B;  5HEH A;  1U4Q A;  2QYW A;  4AIU A;  5ADX L;  1YW0 A;  5DQV A;  4A56 A;  3ZMS B;  1J5W A;  4JI1 T;  4MHC A;  2LM9 A;  2XUE A;  3PU8 A;  3WTH A;  2V26 A;  3N9P A;  2Y48 B;  4O4L E;  4GIW A;  3J7Y q;  2VAS A;  3C4X A;  1YKH B;  5L4H A;  2JPF A;  5AFH A;  2DCF A;  2IC6 A;  4ZZC A;  3CX6 B;  3ZMV B;  1LKX A;  2N2N A;  3FZK B;  4IE5 A;  1D1C A;  3BK9 A;  5JRE A;  1OED B;  4QXC B;  4QHO A;  3OVU A;  2X9W A;  3P4S A;  4HFB A;  4X20 E;  4UXN B;  4G2A A;  4ILU A;  5LG4 A;  1D1B A;  3UQ4 A;  2WM9 A;  3QNU A;  2IHR 1;  3IHR A;  3FXD B;  4U31 A;  3L39 A;  4WYV A;  3AAA B;  4GKJ T;  2YK0 A;  4OHF A;  5L2L A;  5AFM A;  3K8P C;  1UX4 A;  4A98 A;  5C2T A;  5JDG A;  3PV0 F;  2VQF T;  1ZP0 A;  4UM1 A;  5AQQ B;  4CI2 B;  2LKH A;  3LK4 2;  2IDO B;  4FJO A;  2CMR A;  3UU8 A;  5CB4 E;  1SUM B;  3UUM A;  4DV7 T;  5IYZ E;  3HL6 A;  5ETW A;  3K3Q C;  2E9X D;  3CPZ A;  2Y58 A;  2DLR A;  5IUX A;  2P9B A;  4DID B;  2BVM A;  3VR9 A;  4CXY A;  3CX7 B;  3Q5D A;  2BR7 A;  3BQL A;  5KXJ A;  1MMA A;  4QX7 B;  2K9A A;  3MXZ A;  3RIF A;  4ZEY A;  2BKN A;  4EZ1 A;  2HPJ A;  4HWD A;  2WU5 A;  5F8P A;  3MA9 A;  4H9N C;  2NTX A;  3Q5W A;  4EIW A;  2XNV A;  3AA6 B;  4BA9 A;  4XZC A;  4K0K T;  4EZH A;  2XNU A;  2PGZ A;  3CQG B;  1CUN A;  4PJL A;  4DR3 T;  1W09 A;  2A2F X;  4QX8 B;  3HKB E;  2J62 A;  5CO5 A;  3NBX X;  4Q25 A;  3C51 A;  2PFV A;  2HHH T;  1U5P A;  4I0U A;  5C3J A;  4TWF A;  5HXR A;  1W0A A;  4TV9 E;  1NAF A;  1ZV4 X;  1T7S A;  2CLY B;  2M67 A;  5JQG E;  3AED A;  2L9Q A;  4UVC B;  4JI0 T;  4LF8 T;  3I1A A;  3JAD A;  3RLF F;  1D0Y A;  4NUU A;  3H37 A;  2NOX A;  4DR2 T;  2ZJU A;  2XQ9 A;  3AEB A;  3CIR A;  4IDZ A;  4WV9 A;  2BYR A;  1HG2 A;  5LJM A;  4PK4 A;  4X1I E;  2WSS V;  2XQ3 A;  3AVR A;  4UF0 A;  2XAS B;  2XAG B;  4NUV A;  2PTF A;  2W8G A;  4DUY T;  2QA7 A;  1KNR A;  3EI0 A;  2H7V C;  2BR8 A;  2ZM2 A;  3PUW F;  5JRC A;  3FBZ A;  2ZM6 T;  3VR8 A;  2W8F A;  2YME A;  4UV8 B;  1IJ6 A;  2BG9 E;  3OTO T;  1XNQ T;  4YJ3 E;  3RGL A;  3IBP A;  4BFQ A;  2MTQ A;  3UUX B;  2ZJV A;  1VRB A;  1OXZ A;  3KVA A;  3GWH A;  4EEB A;  3C64 A;  3ZC0 A;  3WTM A;  4GYR A;  2DHR A;  5IHY A;  4EYU A;  2KLQ A;  1D1A A;  2L8K A;  3I9Y A;  2FBW A;  5LOV E;  1HCI A;  2FJD A;  2XQ7 A;  1HNW T;  3GN5 B;  3WTK A;  4IT4 A;  1WCR A;  4AKR B;  2WDR A;  4AFG A;  5LBM A;  3Q5X A;  3BQK A;  2K5B B;  3NZQ A;  3ONL C;  5L3B B;  2W66 A;  3PTR B;  4IDN A;  3KDS E;  1YXR A;  2LSG A;  4NZB A;  2XQ4 A;  1N33 T;  3PEO A;  5KZU A;  1BR1 A;  5AQM B;  3NRX A;  1H7C A;  2NW8 A;  3MAC A;  1X79 A;  5LHI B;  4MLK A;  4AQF A;  2LOP A;  1QSD A;  3OJA A;  3OYX A;  4U2Y A;  4G63 A;  1M7K A;  5JDH A;  3TKL B;  3PUX F;  5HEJ A;  4GK5 E;  3KV5 A;  3AE8 A;  2W00 A;  5AFM B;  3P7I A;  4O2A E;  2WB5 A;  3RKG A;  2WCA A;  4KMC A;  5JME A;  2XHE B;  1Z0P A;  3I0O A;  3ANW A;  1BR2 A;  5L3F B;  1HX8 A;  4IIJ E;  5AQL B;  5EK2 A;  2DWK A;  4HFH A;  2JQH A;  1ZEE A;  1IBM T;  4ERR A;  2VQE T;  4B3R T;  3VU7 H;  3GUA A;  3AA0 B;  2M6I A;  5J5G A;  3PJA J;  3NZP A;  1EZ3 A;  4HEA A;  4HFC A;  3A7M A;  5J5I A;  4CN6 A;  5AFU L;  2UXX B;  4LF7 T;  2CPT A;  1G73 A;  2IIU A;  4FRR A;  3PE0 A;  4MBQ A;  2XQA A;  3AEC A;  4DV1 T;  2PG8 A;  2BG9 C;  3RH3 A;  4QAC A;  2CXD A;  1UX5 A;  2UXD T;  2KSR A;  5EZY E;  3RIU C;  3R6N A;  5HWY A;  4ZR6 A;  1D0X A;  4WZX A;  2WS3 A;  1DU2 A;  1GQE A;  4I43 B;  1HNZ T;  1ZKE A;  5LNK A;  5LBQ B;  4LMJ A;  2ZMA A;  2X68 A;  4C90 A; 
#chains in the Genus database with same CATH homology
 2W8G A;  4ZRU A;  3U8N A;  2XQ6 A;  4HFD A;  2YMD A;  3WIP A;  4ZK1 A;  3EI0 A;  5AFM B;  5HEO A;  5BW2 A;  2BR8 A;  4PIR A;  2Y54 A;  5FJV A;  4DBM A;  2W8F A;  2YME A;  4XK9 A;  4ZZC A;  2BG9 E;  3RIF A;  2X00 A;  2BJ0 A;  1OED A;  1UV6 A;  5JME A;  4HFE A;  3ZDG A;  2BYP A;  3C79 A;  4EZ1 A;  1OED C;  3U8L A;  5AFL A;  3WTO A;  5TVC A;  4ALX A;  3WTN A;  5HCM A;  4LMK A;  3U8J A;  4BFQ A;  4X5T A;  4UM3 S;  4LML A;  2XQ8 A;  1OED B;  3P4W A;  2XYS A;  2MAW A;  2XQ5 A;  2ZJV A;  2LKG A;  2XNV A;  3RIA A;  2YN6 A;  3TLS A;  3RHW A;  4HFB A;  2XYT A;  3ZDH A;  2YOE A;  4HFH A;  3RQU A;  3WTM A;  2XNU A;  2PGZ A;  3UQ4 A;  4TWD A;  4TWH A;  2WNC A;  5AIN A;  4HFI A;  5LG3 A;  3P50 A;  3ZKR A;  3GUA A;  3WTI A;  4D01 A;  2BYQ A;  3RI5 A;  4ZZB A;  5CO5 A;  2XQ7 A;  2M6I A;  5L4E A;  2X00 D;  1UW6 A;  5J5G A;  1UX2 A;  3SH1 A;  3WTK A;  2BYS A;  4Z91 A;  4COF A;  4UXU A;  5KE4 A;  4ILA A;  2C9T A;  4TWF A;  5L47 A;  3SIO A;  4B5D A;  3WTJ A;  4A97 A;  5J0Z A;  4HFC A;  2XZ5 A;  5J5I A;  5J5F A;  4IL9 A;  4AFG A;  3C84 A;  3LSV A;  2WNL A;  4QAB A;  3SQ9 A;  2BG9 A;  2UZ6 A;  2WN9 A;  4IL4 A;  1OED E;  3UU4 A;  4QAA A;  5AFM A;  3JAF A;  2QC1 B;  4BQT A;  4A98 A;  2XZ6 A;  2BG9 B;  5AFN A;  4HQP A;  5SYO A;  4UM3 P;  3SQ6 A;  4FRR A;  3IGQ A;  3PMZ A;  4UM1 A;  4UY2 A;  4ZK4 A;  2BYN A;  2XQA A;  3U8M A;  2PH9 A;  5BP0 A;  2BG9 C;  3TLU A;  5CFB A;  4NZB A;  3EHZ A;  4ZJT A;  2Y56 A;  4QAC A;  2LKH A;  2XQ4 A;  3UUB A;  4XHE A;  5HEH A;  4QH1 A;  3UU8 A;  3TLW A;  2LM2 A;  4IRE A;  3UU5 A;  4UM3 A;  5AFK A;  3PEO A;  5KZU A;  2KSR A;  2WNJ A;  3TLT A;  2Y7Y A;  3JAD A;  3U8K A;  3UQ7 A;  5AFJ A;  2M6B A;  5LXB A;  4QH4 A;  4QH5 A;  4F8H A;  4NPP A;  3TLV A;  2WZY A;  3UU3 A;  3JAE A;  2ZJU A;  4ZR6 A;  3WTL A;  4ILB A;  2Y58 A;  5HCJ A;  1I9B A;  2XQ9 A;  3EAM A;  2VL0 A;  5HEU A;  4WV9 A;  2BYR A;  5IUX A;  3WTH A;  4TNV A;  4ZJS A;  5J5H A;  2XNT A;  2XQ3 A;  3RQW A;  5HEG A;  2YKS A;  3T4M A;  4AFH A;  2LLY A;  5BRX A;  5L4H A;  5HEJ A;  3UU6 A;  4ILC A;  4LMJ A;  2Y57 A;  5AFH A;  4AFT A;  2BR7 A;  4TNW A;  4Z90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...