4ILCA

The glic pentameric ligand-gated ion channel in complex with sulfates
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ilcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ilcA01
3C79A 3TLWA 4ZJTA 3UU5A 3UU3A 3EHZA 2LLYA 3RQUA 2YMDA 2MAWA 5J5GA 3EI0A 2X00A 5FJVA 3WTIA 4TWDA 2BYQA 5BRXA 3ZKRA 2BG9B 2XNVA 3PMZA 5HEHA 2WZYA 2ZJUA 2YMEA 4HFHA 5AFLA 4LMLA 3RI5A 4DBMA 4HFEA 4B5DA 1OEDC 2XQ5A 3UU6A 5AFJA 4BFQA 5AFMB 1OEDA 3WTMA 5IUXA 2BR8A 4FRRA 2XZ5A 3SIOA 2YOEA 3WTOA 2WNJA 3P50A 5AFHA 2W8FA 5AFKA 4NPPA 3U8JA 4EZ1A 5LG3A 4A97A 2BYRA 2ZJVA 3SQ6A 5J5HA 2PGZA 2XNUA 2QC1B 5HCMA 3UUBA 3JAEA 1UW6A 2LKGA 2XNTA 3RQWA 4IL9A 3U8LA 2BJ0A 4IREA 2Y56A 1OEDE 3C84A 3GUAA 4HFDA 5HCJA 4ZR6A 4ZZBA 3RIAA 4AFGA 1I9BA 2VL0A 2BYNA 4D01A 4XK9A 4ILBA 3ZDGA 4UY2A 4ZK4A 1UX2A 5BW2A 4QACA 3RHWA 2M6BA 4LMJA 4TWFA 5CFBA 4ILAA 2W8GA 3IGQA 4WV9A 5CO5A 4ZK1A 5AFMA 2Y57A 4HFIA 4F8HA 5HEJA 3EAMA 4ZJSA 4UM3P 4HFBA 4XHEA 2PH9A 2XQ3A 3JAFA 2YKSA 4ILCA 3SQ9A 3P4WA 4QH1A 4TNVA 3ZDHA 4QAAA 4Z91A 4NZBA 2WNCA 2XYSA 2X00D 5AINA 3LSVA 5J5IA 4COFA 5HEGA 2YN6A 2Y54A 3JADA 2BYPA 2BG9E 4A98A 2WNLA 3WTJA 3UQ4A 2KSRA 5L47A 5AFNA 3PEOA 2XYTA 2BG9C 3TLTA 5HEUA 3WTKA 4ZRUA 4BQTA 2BG9A 2BR7A 3UQ7A 2XQ4A 4QH5A 5L4HA 3TLVA 4Z90A 4HQPA 3U8NA 2Y58A 3WTLA 2XQAA 2Y7YA 5BP0A 3WIPA 4LMKA 3TLSA 4TWHA 3UU8A 5JMEA 2WN9A 4AFHA 5J0ZA 4PIRA 2BYSA 5TVCA 3SH1A 2XQ8A 4UM1A 3U8KA 5HEOA 1OEDB 2LM2A 4TNWA 4X5TA 4ALXA 3T4MA 4AFTA 4UM3S 2C9TA 3RIFA 3UU4A 5L4EA 4QABA 2XZ6A 5KZUA 5SYOA 2XQ7A 4QH4A 3WTHA 2XQ6A 5J5FA 4HFCA 1UV6A 2LKHA 3TLUA 4UM3A 4UXUA 2XQ9A 5KE4A 4IL4A 4ZZCA 2M6IA 3U8MA 2UZ6A 5LXBA 3WTNA
chains in the Genus database with same CATH superfamily
4DV7T 4G63A 3KV5A 4QWNB 2WZHA 1T7SA 1FIOA 4JBWF 2A2FX 2H88A 2PG8A 5HEHA 4KX6A 5ABFB 2IIUA 3L39A 1QLBA 1OEDA 3H3AA 1LRZA 5IUXA 2QGSA 3LFMA 3OYZA 5JDHA 2XNUA 3T1YT 1V9DA 4EEBA 1UW6A 3RPUA 2K24A 3ONJA 4YSZA 4NXNT 3RH3A 2JQKA 2CBJA 4OHFA 2WU5A 4UR9A 3MXZA 2R6GF 1L0VA 4KBMB 3ZN0B 5HWXA 2WSSV 5AQQB 5HEJA 4JLEA 3CX6B 4XHEA 2WDRA 3LG7A 3CQGB 2EHOA 4DR5T 1G73A 2FJDA 1XMOT 2XYSA 2X00D 3LSVA 2IAKA 4EYYR 4IT4A 3AEFA 3N9NA 4A98A 1R8IA 4WYVA 2XYTA 1CUNA 2JMKA 4Z90A 5FYMA 2X9HA 2K9AA 2VQFT 1X79A 3CX8B 3C4ZA 4CN4A 4LF5T 1IJ5A 3RYFE 5HEOA 3NZQA 3PUQA 2XJ7A 1KK7A 2XQ6A 5JR9A 4X62T 4GKKT 3WTNA 2LLYA 3RQUA 2L8KA 3ZLIA 4CI3B 2B1EA 5FY7A 3NWIA 3WAJA 1D0ZA 5FXXA 4DNDA 2WB5A 2WNJA 1WYBA 3SFEA 3I0QA 4NPPA 3EABA 2E5VA 1WR6A 3FBLA 1M62A 4DR1T 2BS3A 4ZHQE 4AKGA 2W2UA 1I9BA 3RIUC 3RYCE 3ZDGA 2Y8DA 2BDEA 3AAAB 5CFBA 3ETUA 3FZHB 2HN2A 4FJOA 3E0ZA 4DR7T 4H9RC 3H37A 5FXVA 4DR4T 4UM3P 4QH1A 4NZBA 2WNCA 4U33A 3KVBA 4U72A 2ZM8A 4ZRUA 4A56A 4CI1B 3KINB 3R6NA 3TLVA 4KI0F 3ZC1A 3AEBA 2VQET 1AJ3A 2X68A 3A5XA 1BR1A 4ISTA 2YDQA 3T4MA 1XDOA 4JI0T 2BVMA 1UV6A 1MIVA 4H9OC 3TLWA 3QB5K 4DV0T 4HWFA 4CN6A 2WBLA 2X00A 3ZKRA 2WZYA 4I50E 3O9XA 3E22E 3N2OA 2CLYB 2XAFB 3EDVA 2I59A 3AEGA 4A97A 2BYRA 3SQ6A 2PGZA 5LGNB 4IDPA 2VKOA 2XZEA 4UEMA 5CGMA 3WAKA 2LE8A 1EZ3A 1UK5A 2W0GA 4HWIB 5AQVB 4LF8T 2NWBA 2DI4A 4UY2A 3CQCB 3HKDE 1NENA 2M6BA 4ZK1A 2LOPA 3IGQA 2CE7A 1E1HB 1J5ET 3JAFA 3NKZA 4O4JE 1CHUA 3NRYA 5HXRA 4P0AA 2PJQA 3N9PA 1WLXA 1HX8A 2X0HA 3CKDA 5HWYA 4JUYA 2IC6A 2BG9C 2D0UA 3AXJB 4L0RA 4BA9A 2QYWA 4HQPA 3U8NA 3FZMB 1HNZT 3OTOT 3CMLA 1LKXA 5AQKB 2CCQA 2KZ7B 3ZC0A 4DV5T 4X5TA 5AQHB 4GK5E 5KDMC 2FJAA 4EEDA 5SYOA 2CXLA 1T8BA 4JEHB 3VKGA 3FXEB 1YQ4A 5AQIB 5LMNT 3IBPA 3FBZA 1HG2A 3EHZA 3N2GE 5JREA 5ADXL 5J2UE 3G06A 2MAWA 3ZSSA 3UTKA 5BRXA 2XNVA 1NWMX 4H9NC 4Z8XA 1HG5A 3Q5DA 2MOZA 2VKHA 4JI2T 2IDOB 3U8JA 1NAFA 2X9XA 2PTFA 3UUBA 3A7MA 2X9WA 4QXBB 3ANWA 4UF0A 3FHNA 3R84B 2JIWA 4TV8E 3RIAA 3RRCA 3AE1A 2J62A 2WQYA 4LF9T 5AQJB 1YKHB 3CK6A 3I0OA 2YINA 2H7OA 3NVOA 1HF8A 3HR0A 3U3IA 2K5BB 5BMVE 2A72A 3K3QC 4WNKA 4ZS3A 3TLTA 4OYKA 2UXDT 3PUWF 5HXEA 3PJAJ 1B7TA 4EYUA 2WCAA 3TLSA 4TWHA 4YFSA 5ABGA 2XTLA 1LVKA 2CRBA 2CHOA 4ASKA 4C91A 1N36T 2YDSA 4U7IA 4UXUA 3PUGA 3U8MA 4DIDB 1LVFA 1HX1B 4IDZA 2Q9QD 4MALA 2N1GA 2RPAA 2X0YA 3PUAA 4XZCA 3WTIA 4X65T 1Z0PA 2UUCT 3ZYKA 5AFJA 1JNZA 1IBLT 2YOEA 5AQNB 4OX9T 4EB6E 3ZT6A 5AQLB 3K3NA 4ZI2D 5LBQB 4A5XA 3JAEA 4MBQA 5AQSB 3BQLA 3N9LA 3SOLA 3B13A 2K3WA 3JC6D 3AEAA 2N9DA 4WV9A 3LDQB 2Y57A 4F8HA 2IUBA 2W63A 2YKSA 4ILCA 5FVKA 3KV9A 3MZKB 2IMLA 2KINB 3IEEA 3VRBA 3MKDA 3UQ4A 5JRCA 1XMQT 1FMVA 2I6HA 2XQ4A 4QH5A 1D1AA 2E5LT 3MA9A 3ZEFB 2Y58A 1T72A 1YXRA 1IZNB 4HFVA 5JDNA 3WIPA 4LMKA 3QC9A 3AA6B 4AFHA 3ONLC 1MMGA 3ESLA 3AAIA 4YHHT 3NRXA 1KFYA 2KLQA 2L3LA 5FMNA 3OYXA 2D9DA 3C79A 4ZJTA 2W61A 2CMRA 3AE2A 2X51A 3HKEE 3J9X1 2ACZA 2HN1A 2KXPB 2WS3A 5EK4A 1JNRA 2XZ5A 5LG4A 3WTOA 4P0BA 4PK5A 2DWKA 4AQYT 2M67A 1N33T 1XNQT 5LB7B 3AEDA 2CPTA 5EZYE 3ZMZB 2BYNA 3ZMSB 2YK0A 4QACA 3ONXA 2W8GA 4JI5T 2YU1A 5AQTB 3EAMA 3CPZA 3P4WA 3AA1B 2RP4A 4UVBB 3JADA 2ZMAA 1US7B 2Q9QA 4HTEA 2WNLA 4WZXA 1IJ6A 4DBQA 4BQTA 3LBXB 3KBTA 3UUNA 2MBGA 5FY0A 2LSYA 3O1JA 2Y7YA 3AE7A 4PK6A 2ZM6T 1IAPA 4JV5T 2XSBA 2E9XD 3F2EA 1HTJF 4TX5A 4AISA 2PFVA 3UU4A 1UGOA 1X9BA 3MJXA 3AE5A 4DV3T 2LSKA 5KE4A 4OK0A 3F57A 5LXBA 1ZV4X 1YQ3A 3J7Yq 2CXDA 2JMHA 2YMDA 3K8PC 3HA4A 2VB6A 1ZEEA 2K48A 3ZMVB 4HWHA 4AI6A 3LK42 4BFQA 5KXJA 2HPJA 2BR8A 3AA0B 3GN5A 4U2YA 1HNXT 3L09A 2LT3A 4HGAA 2ES0A 3SRZA 4YTNA 2BZBA 3ZMUB 2Y56A 1OEDE 3FXDB 4EV6A 3ZMTB 3CWZB 5DJQC 3HKCE 3RHWA 4DR3T 2H3RA 1VCSA 2P9BA 3S4UA 5LA6E 2X9YA 2WZIA 1OWAA 3SQ9A 4Z91A 4DUZT 3DP7A 5AINA 4WW0A 5J5IA 4UXNB 5HEGA 2DL1A 4B3RT 3WTJA 5AFNA 2YDRA 2VURA 4TUYE 3M3ZB 4ZXLA 2CLYC 1U5PA 4HWCA 4AQFC 1DU2A 5JQGE 2D0TA 2BBJA 3AEEA 3U8KA 4ALXA 4IE4A 1YKEB 4UM3S 5FXZA 3AVRA 5E0OA 4HFCA 4I4TE 3VR8A 4LFBT 2V6YB 5HYAA 2V7IA 5F5WA 5JDQA 4CI2B 3V5SA 3FB2A 2OA5A 4ERRA 3NZPA 5GONE 1KF6A 5J5GA 2NTXA 3PMZA 1SUMB 2NW8A 5FXWA 2WWVA 4B5DA 4DUYT 3UU6A 5IWAT 3RRWA 2CA5A 3P8CD 4CN1A 3VKHA 3X1DA 4JI7T 4JYAT 4K0KT 4UELA 5L3EB 4IE0A 2W62A 1MNDA 2MPKA 1ZKEA 1UX5A 4NXMT 2DLRA 4X20E 2E9XA 3BK9A 4ILBA 2CWOA 5ABFA 4HFIA 4ZI3C 1WCRA 3N5LA 2OLTA 2PH9A 3RKGA 4EOZB 5JDGA 2V7KA 2YN6A 5AQUB 2VWAA 3GWHA 5AQMB 2XUEA 3O4XE 5FP3A 4MHCA 4OFZA 2NW7A 4OYJA 2F4VT 2CM0A 3BQKA 4DVDA 5BP0A 2FBWA 1KEYA 2LOSA 3EVYA 4DMVA 4UM1A 2C9TA 2IC9A 2XQ7A 5J5FA 3T8OA 2W66A 4TZ4C 2M6IA 4KMCA 4WBOA 1XWMA 5JDLA 1VRBA 4GOUA 5JRCB 3HKBE 4B3ST 2YMEA 3PUYF 3RI5A 4HFEA 1OEDC 5AFMB 1J5WA 3FZLB 3AE9A 3QNUA 5AFKA 3PDYA 2ZJVA 4CZZB 2BKPA 3P4RA 4IL9A 3U8LA 3ZPOA 4EXTA 5L3CB 4CXYA 2BS4A 5FY1A 4DMWA 2ACXA 1UX2A 2WDVA 5FNVE 1W0AA 3RYHE 1S94A 2WM9A 4ANJA 2W67A 3N9OA 2EHOC 4NUVA 3UFEA 4QAAA 1HR0T 2JRKA 3IA3A 1W09A 4K0UA 5LNKA 2VK9A 3KVAA 4TN7B 3UFGA 5L47A 2VASA 1HCIA 2GK9A 5HEUA 3VRAA 2BR7A 3P4PA 2KMFA 4PJLA 5C8YE 2L9QA 5ABEA 3T1HT 3EUHA 3WTLA 3HI2A 5LP6E 3KV4A 4LF4T 5J0ZA 1O3XA 4YTMA 1ZOYA 4O4LE 2UUBT 1S35A 2WY2A 1OEDB 4KHZF 2NOXA 5IHYA 5IYZE 3K3OA 2OV9A 4GK0E 2WDQA 1ZHCA 5JR9C 2LJLA 4AXPA 3AB3B 3AA7B 2LRLA 2KWIB 5J1GA 3V5UA 1FJGT 5EK2A 3RC3A 3OVUA 2ZLYA 2XM1A 2W8FA 2EHOB 2NR4A 1YD8G 4EZ1A 2YEVC 3UUXB 4J2CA 2LRKA 5JDMA 4B3TT 4QX8B 4ZZBA 2V26A 3RIUA 4PK4A 4V1Av 1VCTA 2KNDA 1G8XA 3L8RA 3O1IA 4DV1T 5L3GB 4H63H 5ABHA 5HAXA 5KMGP 4HN9A 3LK2B 3AE3A 4AKHA 2XAJB 3C64A 3P7IA 4Q25A 3GN5B 1I94T 3ZCJA 1IBKT 4H9QC 5JR9B 1E7PA 3VU7H 3C50A 2NP9A 2DHRA 3LK3B 5CJ5A 2LM9A 5F8PA 1GQEA 2PBIA 1MMDA 5HXSA 5TVCA 2JQ9A 4PW8A 4TNWA 1IBMT 4PJJA 2W00A 5DQVA 2KT9A 4GKJT 4YJ3E 3ETVA 4I43B 4IL4A 2XPKA 4DV4T 4IIJE 3UU5A 3AE8A 4UIGA 2BKOA 3M65A 2CWYA 5LJNA 3SFDA 2Z6EA 4TWDA 2DCFA 2X0LB 3W15B 3CX7B 1NEKA 5AFLA 2VVNA 1WR0A 5LYJE 3PUVF 5A1LA 3P4SA 1MMAA 4XAXB 1XZYA 4F6RC 2YU2A 2V5CA 5J5HA 1VOMA 4EGWA 2WP9A 5BR8T 3I9YA 4YJ2E 4G2AA 5CA0E 1UURA 4AFGA 4O4IE 2XAHB 3MK7C 2H89A 1KNPA 3Q2MA 4KUMB 4LMJA 4TWFA 2WAUA 5JVDE 1W9RA 3ZDHA 2JQQA 4GIWA 1WYCA 1WRDA 3ZCIA 3Q5EA 2XM2A 2XAGB 2KSRA 4EZHA 3PJAA 4AQGA 2BG9A 3B57A 4DR2T 5CB4E 3QUJA 2VVSA 2V7JA 3AE6A 4LF7T 3ZN1B 1UX4A 5FL0A 2E9XB 2UXCT 4M1PA 4PJNA 5L3DB 1I6ZA 3CQXC 5FL1A 5LGUB 1H7CA 4LF6T 5C3JA 2UUAT 4AFTA 2ZM0A 2XZ6A 4ILUA 4YXDA 3ZYMA 4IDQA 4PNIA 1SA0E 3O1HA 2NTYA 3ABVA 2RA1A 3UU3A 2AXDS 3WI3A 1HS7A 3UULA 3EI0A 2JPFA 1QSDA 5C2TA 2DWGA 4E7ZA 2KWHA 5J2TE 2A9UA 1HNWT 3DTOA 5AQOB 3VR9A 5DABA 2VL8A 3AECA 2QC1B 4EZ4A 2LKGA 2E8IA 3KBUA 3E08A 2LHNA 2BJ0A 4ZS2A 4H9PC 2UXNB 1D1BA 4U3CA 3HL6A 4ZK4A 3OJAA 4H9SE 2A3DA 4JEUB 1KNZA 1HFAA 2XQYA 1BR2A 2QA7A 2XQ3A 1YW0A 4MFRA 2ZM2A 2HHHT 4X1YE 2BG9E 4YY3T 5H6QB 2CEAA 4X66T 4IGUA 3RF1A 3SWHA 2XASB 2XQAA 3KDSE 5ETWA 2HH7A 3ZSTA 1D0YA 3KV6A 4U31A 2I0MA 2VKJA 3RIFA 4AKRB 4L9IA 5KZUA 2VKDA 3DJBA 2IW5B 3U78A 2C5JA 4QKNA 2X66A 3PTRB 2UZ6A 3ANWB 4IE6A 4UF0B 5FJVA 5LOVE 2NW9A 1MMNA 4I0UA 3PURA 2XQ5A 2BVLA 3CVRA 3IF8B 4DO0A 3SIOA 2QRXA 5LG3A 4P1NA 4O4HE 2C5IT 1D0XA 3RQWA 2BKNA 3UUMA 4O2AE 4ZR6A 4D01A 4XK9A 4PAGA 4YSYA 4AKLA 4AKIA 2D2SA 3QB5A 3KFWX 4BJNA 4B6XA 4QXCB 5LXTE 3N2KE 2V6XA 2W4XA 5HXHA 5CA1E 3RLFF 2FUPA 3P4QA 4EAHA 2BYPA 3A8YC 3D0TA 2X67A 3F31A 4IE7A 3H3MA 4XBFB 4FI5A 2WWUA 2C5KT 3LJCA 2ODUA 4EIWA 1MIYA 3VHLA 2C0SA 4P09A 1T98A 2BYSA 1SE7A 4B3MT 1Y01A 2V8SV 4E7SA 5LGTB 2MTQA 4ADZA 4WBNE 2V7MA 3WTHA 3UT5E 3FZFB 3LBXA 2XY8B 2E2AA 4ZZCA 4JI6T 3GMIA 3N9MA 5L3BB 3RKOA 4X64T 4LFCT 4N78D 4CXXA 4HFHA 3WTMA 3P50A 3ZYLA 2XHEB 4U74A 4DV6T 3Q9DA 5JH7E 4BAYB 3B5MA 3PU3A 2BS2A 5JTGA 3PUZF 3RX6A 4IREA 4JI4T 3GUAA 1SHZC 5HCJA 4LFAT 3AVSA 4JI3T 5BW2A 1QUUA 2H7VC 2V5DA 2CHNA 4UVAB 3ZJ1A 5L3FB 4O8SA 5LHIB 2XSAA 4I55E 3FZKB 3QK6A 4TV9E 2Q9QC 3PUSA 4DV2T 1BR0A 3N9QA 4UV8B 3PEOA 4IHJE 4IDNA 5LBMA 3PUXF 5M4YA 3UQ7A 5L4HA 2JQHA 1N32T 4X1KE 1KNRA 1UUSA 5LCYA 4PJMA 4ZI2C 4H63V 5JMEA 4PIRA 2B76A 5H6RB 5TAOA 4DR6T 3PV0F 2V1DB 2WU2A 5L4EA 4QABA 3JCFA 3RGLA 3QOFA 3JC6C 2LKHA 3TLUA 4ZI3D 4UM3A 4JI1T 1XNRT 4UV9B 1ZP0A 5KX5E 2WMNA 1D1CA 2JJ9A 3L3PA 4ZI7E 5JDFA 2BYQA 2BG9B 5AQGB 1N34T 1FEWA 2ZJUA 5LJMA 4DBMA 1W0BA 2J47A 2FJBA 3GA8A 3C4WA 4FRRA 2CBIA 2UXBT 3K1SA 5LMUT 3PU8A 2QVAA 4AIUA 2V6YA 2V7LA 2DNXA 2J1DG 2LHRA 2Q9QB 2XNTA 4PFOA 1MNEA 3C98B 3EDUA 1Y64B 5DQWA 3ZJ2A 2VL0A 5AQRB 4CQIA 5CO5A 4ILAA 4KHPT 5FKYA 2D5UA 4ZJSA 4HFBA 3I1AA 2HPLA 5AQFB 1XDPA 4YLHA 4COFA 5L2LA 4L5GA 4NIQA 3BQIA 5AQPB 3MACA 3Q5XA 3PE0A 2J4GA 4AQFA 2WN9A 5F3JA 4HEAA 3SH1A 2LSGA 2XAQB 5FVLA 5LHHB 4PFPA 2MYSA 3C51A 1J1JA 4QH4A 1OXZA 2XQ9A 2EHOD 1MIWA 1FMWA 2Y48B 1M7KA 3RC8A 3OBVE 4LMLA 3SS1A 4QHOA 2LSIA 4U7YA 4JI8T 3IHRA 1U4QA 4C90A 4BJMA 4GYRA 5AFHA 3NBXX 3AXJA 3TKLB 5HCMA 4YHJA 4HKAA 2UXXB 2LEHA 4QXHB 3ZT5A 4O2BE 2BBHA 2E9XC 3C84A 4HFDA 4ZOLE 4YT0A 4DBRA 2UU9T 2N2NA 2SPCA 4GYSA 4KP3C 5AFMA 3OPCA 2G0UA 3OKQA 4TNVA 3C4XA 3RYIE 4YTPA 4YSXA 2Y54A 5AFUL 1E2AA 5EK3A 3I9WA 3AAEB 3WTKA 4HE8A 2FJEA 2Y6XA 3AE4A 5LHGB 2CXFA 4NUUA 3UU8A 1BR4A 2AE9A 4IE5A 4ZEYA 4X1IE 4QX7B 2ODVA 1WFDA 2XQ8A 2WMOA 1UCUA 5HXCA 2LM2A 2IHR1 2LSJA 4MLKA 3ZT7A 4HWDA 3Q5WA 4IDOA 4CXWA 1Z8UA 4ISSA 4U2ZA 4UVCB 3CIRA
chains in the Genus database with same CATH topology
3C79A 3TLWA 4ZJTA 3UU5A 3UU3A 3EHZA 2LLYA 3RQUA 2YMDA 2MAWA 5J5GA 3EI0A 2X00A 5FJVA 3WTIA 4TWDA 2BYQA 5BRXA 3ZKRA 2BG9B 2XNVA 3PMZA 5HEHA 2WZYA 2ZJUA 2YMEA 4HFHA 5AFLA 4LMLA 3RI5A 4DBMA 4HFEA 4B5DA 1OEDC 2XQ5A 3UU6A 5AFJA 4BFQA 5AFMB 1OEDA 3WTMA 5IUXA 2BR8A 4FRRA 2XZ5A 3SIOA 2YOEA 3WTOA 2WNJA 3P50A 5AFHA 2W8FA 5AFKA 4NPPA 3U8JA 4EZ1A 5LG3A 4A97A 2BYRA 2ZJVA 3SQ6A 5J5HA 2PGZA 2XNUA 2QC1B 5HCMA 3UUBA 3JAEA 1UW6A 2LKGA 2XNTA 3RQWA 4IL9A 3U8LA 2BJ0A 4IREA 2Y56A 1OEDE 3C84A 3GUAA 4HFDA 5HCJA 4ZR6A 4ZZBA 3RIAA 4AFGA 1I9BA 2VL0A 2BYNA 4D01A 4XK9A 4ILBA 3ZDGA 4UY2A 4ZK4A 1UX2A 5BW2A 4QACA 3RHWA 2M6BA 4LMJA 4TWFA 5CFBA 4ILAA 2W8GA 3IGQA 4WV9A 5CO5A 4ZK1A 5AFMA 2Y57A 4HFIA 4F8HA 5HEJA 3EAMA 4ZJSA 4UM3P 4HFBA 4XHEA 2PH9A 2XQ3A 3JAFA 2YKSA 4ILCA 3SQ9A 3P4WA 4QH1A 4TNVA 3ZDHA 4QAAA 4Z91A 4NZBA 2WNCA 2XYSA 2X00D 5AINA 3LSVA 5J5IA 4COFA 5HEGA 2YN6A 2Y54A 3JADA 2BYPA 2BG9E 4A98A 2WNLA 3WTJA 3UQ4A 2KSRA 5L47A 5AFNA 3PEOA 2XYTA 2BG9C 3TLTA 5HEUA 3WTKA 4ZRUA 4BQTA 2BG9A 2BR7A 3UQ7A 2XQ4A 4QH5A 5L4HA 3TLVA 4Z90A 4HQPA 3U8NA 2Y58A 3WTLA 2XQAA 2Y7YA 5BP0A 3WIPA 4LMKA 3TLSA 4TWHA 3UU8A 5JMEA 2WN9A 4AFHA 5J0ZA 4PIRA 2BYSA 5TVCA 3SH1A 2XQ8A 4UM1A 3U8KA 5HEOA 1OEDB 2LM2A 4TNWA 4X5TA 4ALXA 3T4MA 4AFTA 4UM3S 2C9TA 3RIFA 3UU4A 5L4EA 4QABA 2XZ6A 5KZUA 5SYOA 2XQ7A 4QH4A 3WTHA 2XQ6A 5J5FA 4HFCA 1UV6A 2LKHA 3TLUA 4UM3A 4UXUA 2XQ9A 5KE4A 4IL4A 4ZZCA 2M6IA 3U8MA 2UZ6A 5LXBA 3WTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C79 A;  3TLW A;  4ZJT A;  3UU5 A;  3UU3 A;  3EHZ A;  2LLY A;  3RQU A;  2YMD A;  2MAW A;  5J5G A;  3EI0 A;  2X00 A;  5FJV A;  3WTI A;  4TWD A;  2BYQ A;  5BRX A;  3ZKR A;  2BG9 B;  2XNV A;  3PMZ A;  5HEH A;  2WZY A;  2ZJU A;  2YME A;  4HFH A;  5AFL A;  4LML A;  3RI5 A;  4DBM A;  4HFE A;  4B5D A;  1OED C;  2XQ5 A;  3UU6 A;  5AFJ A;  4BFQ A;  5AFM B;  1OED A;  3WTM A;  5IUX A;  2BR8 A;  4FRR A;  2XZ5 A;  3SIO A;  2YOE A;  3WTO A;  2WNJ A;  3P50 A;  5AFH A;  2W8F A;  5AFK A;  4NPP A;  3U8J A;  4EZ1 A;  5LG3 A;  4A97 A;  2BYR A;  2ZJV A;  3SQ6 A;  5J5H A;  2PGZ A;  2XNU A;  2QC1 B;  5HCM A;  3UUB A;  3JAE A;  1UW6 A;  2LKG A;  2XNT A;  3RQW A;  4IL9 A;  3U8L A;  2BJ0 A;  4IRE A;  2Y56 A;  1OED E;  3C84 A;  3GUA A;  4HFD A;  5HCJ A;  4ZR6 A;  4ZZB A;  3RIA A;  4AFG A;  1I9B A;  2VL0 A;  2BYN A;  4D01 A;  4XK9 A;  4ILB A;  3ZDG A;  4UY2 A;  4ZK4 A;  1UX2 A;  5BW2 A;  4QAC A;  3RHW A;  2M6B A;  4LMJ A;  4TWF A;  5CFB A;  4ILA A;  2W8G A;  3IGQ A;  4WV9 A;  5CO5 A;  4ZK1 A;  5AFM A;  2Y57 A;  4HFI A;  4F8H A;  5HEJ A;  3EAM A;  4ZJS A;  4UM3 P;  4HFB A;  4XHE A;  2PH9 A;  2XQ3 A;  3JAF A;  2YKS A;  4ILC A;  3SQ9 A;  3P4W A;  4QH1 A;  4TNV A;  3ZDH A;  4QAA A;  4Z91 A;  4NZB A;  2WNC A;  2XYS A;  2X00 D;  5AIN A;  3LSV A;  5J5I A;  4COF A;  5HEG A;  2YN6 A;  2Y54 A;  3JAD A;  2BYP A;  2BG9 E;  4A98 A;  2WNL A;  3WTJ A;  3UQ4 A;  2KSR A;  5L47 A;  5AFN A;  3PEO A;  2XYT A;  2BG9 C;  3TLT A;  5HEU A;  3WTK A;  4ZRU A;  4BQT A;  2BG9 A;  2BR7 A;  3UQ7 A;  2XQ4 A;  4QH5 A;  5L4H A;  3TLV A;  4Z90 A;  4HQP A;  3U8N A;  2Y58 A;  3WTL A;  2XQA A;  2Y7Y A;  5BP0 A;  3WIP A;  4LMK A;  3TLS A;  4TWH A;  3UU8 A;  5JME A;  2WN9 A;  4AFH A;  5J0Z A;  4PIR A;  2BYS A;  5TVC A;  3SH1 A;  2XQ8 A;  4UM1 A;  3U8K A;  5HEO A;  1OED B;  2LM2 A;  4TNW A;  4X5T A;  4ALX A;  3T4M A;  4AFT A;  4UM3 S;  2C9T A;  3RIF A;  3UU4 A;  5L4E A;  4QAB A;  2XZ6 A;  5KZU A;  5SYO A;  2XQ7 A;  4QH4 A;  3WTH A;  2XQ6 A;  5J5F A;  4HFC A;  1UV6 A;  2LKH A;  3TLU A;  4UM3 A;  4UXU A;  2XQ9 A;  5KE4 A;  4IL4 A;  4ZZC A;  2M6I A;  3U8M A;  2UZ6 A;  5LXB A;  3WTN A; 
#chains in the Genus database with same CATH topology
 4DV7 T;  4G63 A;  3KV5 A;  4QWN B;  2WZH A;  1T7S A;  1FIO A;  4JBW F;  2A2F X;  2H88 A;  2PG8 A;  5HEH A;  4KX6 A;  5ABF B;  2IIU A;  3L39 A;  1QLB A;  1OED A;  3H3A A;  1LRZ A;  5IUX A;  2QGS A;  3LFM A;  3OYZ A;  5JDH A;  2XNU A;  3T1Y T;  1V9D A;  4EEB A;  1UW6 A;  3RPU A;  2K24 A;  3ONJ A;  4YSZ A;  4NXN T;  3RH3 A;  2JQK A;  2CBJ A;  4OHF A;  2WU5 A;  4UR9 A;  3MXZ A;  2R6G F;  1L0V A;  4KBM B;  3ZN0 B;  5HWX A;  2WSS V;  5AQQ B;  5HEJ A;  4JLE A;  3CX6 B;  4XHE A;  2WDR A;  3LG7 A;  3CQG B;  2EHO A;  4DR5 T;  1G73 A;  2FJD A;  1XMO T;  2XYS A;  2X00 D;  3LSV A;  2IAK A;  4EYY R;  4IT4 A;  3AEF A;  3N9N A;  4A98 A;  1R8I A;  4WYV A;  2XYT A;  1CUN A;  2JMK A;  4Z90 A;  5FYM A;  2X9H A;  2K9A A;  2VQF T;  1X79 A;  3CX8 B;  3C4Z A;  4CN4 A;  4LF5 T;  1IJ5 A;  3RYF E;  5HEO A;  3NZQ A;  3PUQ A;  2XJ7 A;  1KK7 A;  2XQ6 A;  5JR9 A;  4X62 T;  4GKK T;  3WTN A;  2LLY A;  3RQU A;  2L8K A;  3ZLI A;  4CI3 B;  2B1E A;  5FY7 A;  3NWI A;  3WAJ A;  1D0Z A;  5FXX A;  4DND A;  2WB5 A;  2WNJ A;  1WYB A;  3SFE A;  3I0Q A;  4NPP A;  3EAB A;  2E5V A;  1WR6 A;  3FBL A;  1M62 A;  4DR1 T;  2BS3 A;  4ZHQ E;  4AKG A;  2W2U A;  1I9B A;  3RIU C;  3RYC E;  3ZDG A;  2Y8D A;  2BDE A;  3AAA B;  5CFB A;  3ETU A;  3FZH B;  2HN2 A;  4FJO A;  3E0Z A;  4DR7 T;  4H9R C;  3H37 A;  5FXV A;  4DR4 T;  4UM3 P;  4QH1 A;  4NZB A;  2WNC A;  4U33 A;  3KVB A;  4U72 A;  2ZM8 A;  4ZRU A;  4A56 A;  4CI1 B;  3KIN B;  3R6N A;  3TLV A;  4KI0 F;  3ZC1 A;  3AEB A;  2VQE T;  1AJ3 A;  2X68 A;  3A5X A;  1BR1 A;  4IST A;  2YDQ A;  3T4M A;  1XDO A;  4JI0 T;  2BVM A;  1UV6 A;  1MIV A;  4H9O C;  3TLW A;  3QB5 K;  4DV0 T;  4HWF A;  4CN6 A;  2WBL A;  2X00 A;  3ZKR A;  2WZY A;  4I50 E;  3O9X A;  3E22 E;  3N2O A;  2CLY B;  2XAF B;  3EDV A;  2I59 A;  3AEG A;  4A97 A;  2BYR A;  3SQ6 A;  2PGZ A;  5LGN B;  4IDP A;  2VKO A;  2XZE A;  4UEM A;  5CGM A;  3WAK A;  2LE8 A;  1EZ3 A;  1UK5 A;  2W0G A;  4HWI B;  5AQV B;  4LF8 T;  2NWB A;  2DI4 A;  4UY2 A;  3CQC B;  3HKD E;  1NEN A;  2M6B A;  4ZK1 A;  2LOP A;  3IGQ A;  2CE7 A;  1E1H B;  1J5E T;  3JAF A;  3NKZ A;  4O4J E;  1CHU A;  3NRY A;  5HXR A;  4P0A A;  2PJQ A;  3N9P A;  1WLX A;  1HX8 A;  2X0H A;  3CKD A;  5HWY A;  4JUY A;  2IC6 A;  2BG9 C;  2D0U A;  3AXJ B;  4L0R A;  4BA9 A;  2QYW A;  4HQP A;  3U8N A;  3FZM B;  1HNZ T;  3OTO T;  3CML A;  1LKX A;  5AQK B;  2CCQ A;  2KZ7 B;  3ZC0 A;  4DV5 T;  4X5T A;  5AQH B;  4GK5 E;  5KDM C;  2FJA A;  4EED A;  5SYO A;  2CXL A;  1T8B A;  4JEH B;  3VKG A;  3FXE B;  1YQ4 A;  5AQI B;  5LMN T;  3IBP A;  3FBZ A;  1HG2 A;  3EHZ A;  3N2G E;  5JRE A;  5ADX L;  5J2U E;  3G06 A;  2MAW A;  3ZSS A;  3UTK A;  5BRX A;  2XNV A;  1NWM X;  4H9N C;  4Z8X A;  1HG5 A;  3Q5D A;  2MOZ A;  2VKH A;  4JI2 T;  2IDO B;  3U8J A;  1NAF A;  2X9X A;  2PTF A;  3UUB A;  3A7M A;  2X9W A;  4QXB B;  3ANW A;  4UF0 A;  3FHN A;  3R84 B;  2JIW A;  4TV8 E;  3RIA A;  3RRC A;  3AE1 A;  2J62 A;  2WQY A;  4LF9 T;  5AQJ B;  1YKH B;  3CK6 A;  3I0O A;  2YIN A;  2H7O A;  3NVO A;  1HF8 A;  3HR0 A;  3U3I A;  2K5B B;  5BMV E;  2A72 A;  3K3Q C;  4WNK A;  4ZS3 A;  3TLT A;  4OYK A;  2UXD T;  3PUW F;  5HXE A;  3PJA J;  1B7T A;  4EYU A;  2WCA A;  3TLS A;  4TWH A;  4YFS A;  5ABG A;  2XTL A;  1LVK A;  2CRB A;  2CHO A;  4ASK A;  4C91 A;  1N36 T;  2YDS A;  4U7I A;  4UXU A;  3PUG A;  3U8M A;  4DID B;  1LVF A;  1HX1 B;  4IDZ A;  2Q9Q D;  4MAL A;  2N1G A;  2RPA A;  2X0Y A;  3PUA A;  4XZC A;  3WTI A;  4X65 T;  1Z0P A;  2UUC T;  3ZYK A;  5AFJ A;  1JNZ A;  1IBL T;  2YOE A;  5AQN B;  4OX9 T;  4EB6 E;  3ZT6 A;  5AQL B;  3K3N A;  4ZI2 D;  5LBQ B;  4A5X A;  3JAE A;  4MBQ A;  5AQS B;  3BQL A;  3N9L A;  3SOL A;  3B13 A;  2K3W A;  3JC6 D;  3AEA A;  2N9D A;  4WV9 A;  3LDQ B;  2Y57 A;  4F8H A;  2IUB A;  2W63 A;  2YKS A;  4ILC A;  5FVK A;  3KV9 A;  3MZK B;  2IML A;  2KIN B;  3IEE A;  3VRB A;  3MKD A;  3UQ4 A;  5JRC A;  1XMQ T;  1FMV A;  2I6H A;  2XQ4 A;  4QH5 A;  1D1A A;  2E5L T;  3MA9 A;  3ZEF B;  2Y58 A;  1T72 A;  1YXR A;  1IZN B;  4HFV A;  5JDN A;  3WIP A;  4LMK A;  3QC9 A;  3AA6 B;  4AFH A;  3ONL C;  1MMG A;  3ESL A;  3AAI A;  4YHH T;  3NRX A;  1KFY A;  2KLQ A;  2L3L A;  5FMN A;  3OYX A;  2D9D A;  3C79 A;  4ZJT A;  2W61 A;  2CMR A;  3AE2 A;  2X51 A;  3HKE E;  3J9X 1;  2ACZ A;  2HN1 A;  2KXP B;  2WS3 A;  5EK4 A;  1JNR A;  2XZ5 A;  5LG4 A;  3WTO A;  4P0B A;  4PK5 A;  2DWK A;  4AQY T;  2M67 A;  1N33 T;  1XNQ T;  5LB7 B;  3AED A;  2CPT A;  5EZY E;  3ZMZ B;  2BYN A;  3ZMS B;  2YK0 A;  4QAC A;  3ONX A;  2W8G A;  4JI5 T;  2YU1 A;  5AQT B;  3EAM A;  3CPZ A;  3P4W A;  3AA1 B;  2RP4 A;  4UVB B;  3JAD A;  2ZMA A;  1US7 B;  2Q9Q A;  4HTE A;  2WNL A;  4WZX A;  1IJ6 A;  4DBQ A;  4BQT A;  3LBX B;  3KBT A;  3UUN A;  2MBG A;  5FY0 A;  2LSY A;  3O1J A;  2Y7Y A;  3AE7 A;  4PK6 A;  2ZM6 T;  1IAP A;  4JV5 T;  2XSB A;  2E9X D;  3F2E A;  1HTJ F;  4TX5 A;  4AIS A;  2PFV A;  3UU4 A;  1UGO A;  1X9B A;  3MJX A;  3AE5 A;  4DV3 T;  2LSK A;  5KE4 A;  4OK0 A;  3F57 A;  5LXB A;  1ZV4 X;  1YQ3 A;  3J7Y q;  2CXD A;  2JMH A;  2YMD A;  3K8P C;  3HA4 A;  2VB6 A;  1ZEE A;  2K48 A;  3ZMV B;  4HWH A;  4AI6 A;  3LK4 2;  4BFQ A;  5KXJ A;  2HPJ A;  2BR8 A;  3AA0 B;  3GN5 A;  4U2Y A;  1HNX T;  3L09 A;  2LT3 A;  4HGA A;  2ES0 A;  3SRZ A;  4YTN A;  2BZB A;  3ZMU B;  2Y56 A;  1OED E;  3FXD B;  4EV6 A;  3ZMT B;  3CWZ B;  5DJQ C;  3HKC E;  3RHW A;  4DR3 T;  2H3R A;  1VCS A;  2P9B A;  3S4U A;  5LA6 E;  2X9Y A;  2WZI A;  1OWA A;  3SQ9 A;  4Z91 A;  4DUZ T;  3DP7 A;  5AIN A;  4WW0 A;  5J5I A;  4UXN B;  5HEG A;  2DL1 A;  4B3R T;  3WTJ A;  5AFN A;  2YDR A;  2VUR A;  4TUY E;  3M3Z B;  4ZXL A;  2CLY C;  1U5P A;  4HWC A;  4AQF C;  1DU2 A;  5JQG E;  2D0T A;  2BBJ A;  3AEE A;  3U8K A;  4ALX A;  4IE4 A;  1YKE B;  4UM3 S;  5FXZ A;  3AVR A;  5E0O A;  4HFC A;  4I4T E;  3VR8 A;  4LFB T;  2V6Y B;  5HYA A;  2V7I A;  5F5W A;  5JDQ A;  4CI2 B;  3V5S A;  3FB2 A;  2OA5 A;  4ERR A;  3NZP A;  5GON E;  1KF6 A;  5J5G A;  2NTX A;  3PMZ A;  1SUM B;  2NW8 A;  5FXW A;  2WWV A;  4B5D A;  4DUY T;  3UU6 A;  5IWA T;  3RRW A;  2CA5 A;  3P8C D;  4CN1 A;  3VKH A;  3X1D A;  4JI7 T;  4JYA T;  4K0K T;  4UEL A;  5L3E B;  4IE0 A;  2W62 A;  1MND A;  2MPK A;  1ZKE A;  1UX5 A;  4NXM T;  2DLR A;  4X20 E;  2E9X A;  3BK9 A;  4ILB A;  2CWO A;  5ABF A;  4HFI A;  4ZI3 C;  1WCR A;  3N5L A;  2OLT A;  2PH9 A;  3RKG A;  4EOZ B;  5JDG A;  2V7K A;  2YN6 A;  5AQU B;  2VWA A;  3GWH A;  5AQM B;  2XUE A;  3O4X E;  5FP3 A;  4MHC A;  4OFZ A;  2NW7 A;  4OYJ A;  2F4V T;  2CM0 A;  3BQK A;  4DVD A;  5BP0 A;  2FBW A;  1KEY A;  2LOS A;  3EVY A;  4DMV A;  4UM1 A;  2C9T A;  2IC9 A;  2XQ7 A;  5J5F A;  3T8O A;  2W66 A;  4TZ4 C;  2M6I A;  4KMC A;  4WBO A;  1XWM A;  5JDL A;  1VRB A;  4GOU A;  5JRC B;  3HKB E;  4B3S T;  2YME A;  3PUY F;  3RI5 A;  4HFE A;  1OED C;  5AFM B;  1J5W A;  3FZL B;  3AE9 A;  3QNU A;  5AFK A;  3PDY A;  2ZJV A;  4CZZ B;  2BKP A;  3P4R A;  4IL9 A;  3U8L A;  3ZPO A;  4EXT A;  5L3C B;  4CXY A;  2BS4 A;  5FY1 A;  4DMW A;  2ACX A;  1UX2 A;  2WDV A;  5FNV E;  1W0A A;  3RYH E;  1S94 A;  2WM9 A;  4ANJ A;  2W67 A;  3N9O A;  2EHO C;  4NUV A;  3UFE A;  4QAA A;  1HR0 T;  2JRK A;  3IA3 A;  1W09 A;  4K0U A;  5LNK A;  2VK9 A;  3KVA A;  4TN7 B;  3UFG A;  5L47 A;  2VAS A;  1HCI A;  2GK9 A;  5HEU A;  3VRA A;  2BR7 A;  3P4P A;  2KMF A;  4PJL A;  5C8Y E;  2L9Q A;  5ABE A;  3T1H T;  3EUH A;  3WTL A;  3HI2 A;  5LP6 E;  3KV4 A;  4LF4 T;  5J0Z A;  1O3X A;  4YTM A;  1ZOY A;  4O4L E;  2UUB T;  1S35 A;  2WY2 A;  1OED B;  4KHZ F;  2NOX A;  5IHY A;  5IYZ E;  3K3O A;  2OV9 A;  4GK0 E;  2WDQ A;  1ZHC A;  5JR9 C;  2LJL A;  4AXP A;  3AB3 B;  3AA7 B;  2LRL A;  2KWI B;  5J1G A;  3V5U A;  1FJG T;  5EK2 A;  3RC3 A;  3OVU A;  2ZLY A;  2XM1 A;  2W8F A;  2EHO B;  2NR4 A;  1YD8 G;  4EZ1 A;  2YEV C;  3UUX B;  4J2C A;  2LRK A;  5JDM A;  4B3T T;  4QX8 B;  4ZZB A;  2V26 A;  3RIU A;  4PK4 A;  4V1A v;  1VCT A;  2KND A;  1G8X A;  3L8R A;  3O1I A;  4DV1 T;  5L3G B;  4H63 H;  5ABH A;  5HAX A;  5KMG P;  4HN9 A;  3LK2 B;  3AE3 A;  4AKH A;  2XAJ B;  3C64 A;  3P7I A;  4Q25 A;  3GN5 B;  1I94 T;  3ZCJ A;  1IBK T;  4H9Q C;  5JR9 B;  1E7P A;  3VU7 H;  3C50 A;  2NP9 A;  2DHR A;  3LK3 B;  5CJ5 A;  2LM9 A;  5F8P A;  1GQE A;  2PBI A;  1MMD A;  5HXS A;  5TVC A;  2JQ9 A;  4PW8 A;  4TNW A;  1IBM T;  4PJJ A;  2W00 A;  5DQV A;  2KT9 A;  4GKJ T;  4YJ3 E;  3ETV A;  4I43 B;  4IL4 A;  2XPK A;  4DV4 T;  4IIJ E;  3UU5 A;  3AE8 A;  4UIG A;  2BKO A;  3M65 A;  2CWY A;  5LJN A;  3SFD A;  2Z6E A;  4TWD A;  2DCF A;  2X0L B;  3W15 B;  3CX7 B;  1NEK A;  5AFL A;  2VVN A;  1WR0 A;  5LYJ E;  3PUV F;  5A1L A;  3P4S A;  1MMA A;  4XAX B;  1XZY A;  4F6R C;  2YU2 A;  2V5C A;  5J5H A;  1VOM A;  4EGW A;  2WP9 A;  5BR8 T;  3I9Y A;  4YJ2 E;  4G2A A;  5CA0 E;  1UUR A;  4AFG A;  4O4I E;  2XAH B;  3MK7 C;  2H89 A;  1KNP A;  3Q2M A;  4KUM B;  4LMJ A;  4TWF A;  2WAU A;  5JVD E;  1W9R A;  3ZDH A;  2JQQ A;  4GIW A;  1WYC A;  1WRD A;  3ZCI A;  3Q5E A;  2XM2 A;  2XAG B;  2KSR A;  4EZH A;  3PJA A;  4AQG A;  2BG9 A;  3B57 A;  4DR2 T;  5CB4 E;  3QUJ A;  2VVS A;  2V7J A;  3AE6 A;  4LF7 T;  3ZN1 B;  1UX4 A;  5FL0 A;  2E9X B;  2UXC T;  4M1P A;  4PJN A;  5L3D B;  1I6Z A;  3CQX C;  5FL1 A;  5LGU B;  1H7C A;  4LF6 T;  5C3J A;  2UUA T;  4AFT A;  2ZM0 A;  2XZ6 A;  4ILU A;  4YXD A;  3ZYM A;  4IDQ A;  4PNI A;  1SA0 E;  3O1H A;  2NTY A;  3ABV A;  2RA1 A;  3UU3 A;  2AXD S;  3WI3 A;  1HS7 A;  3UUL A;  3EI0 A;  2JPF A;  1QSD A;  5C2T A;  2DWG A;  4E7Z A;  2KWH A;  5J2T E;  2A9U A;  1HNW T;  3DTO A;  5AQO B;  3VR9 A;  5DAB A;  2VL8 A;  3AEC A;  2QC1 B;  4EZ4 A;  2LKG A;  2E8I A;  3KBU A;  3E08 A;  2LHN A;  2BJ0 A;  4ZS2 A;  4H9P C;  2UXN B;  1D1B A;  4U3C A;  3HL6 A;  4ZK4 A;  3OJA A;  4H9S E;  2A3D A;  4JEU B;  1KNZ A;  1HFA A;  2XQY A;  1BR2 A;  2QA7 A;  2XQ3 A;  1YW0 A;  4MFR A;  2ZM2 A;  2HHH T;  4X1Y E;  2BG9 E;  4YY3 T;  5H6Q B;  2CEA A;  4X66 T;  4IGU A;  3RF1 A;  3SWH A;  2XAS B;  2XQA A;  3KDS E;  5ETW A;  2HH7 A;  3ZST A;  1D0Y A;  3KV6 A;  4U31 A;  2I0M A;  2VKJ A;  3RIF A;  4AKR B;  4L9I A;  5KZU A;  2VKD A;  3DJB A;  2IW5 B;  3U78 A;  2C5J A;  4QKN A;  2X66 A;  3PTR B;  2UZ6 A;  3ANW B;  4IE6 A;  4UF0 B;  5FJV A;  5LOV E;  2NW9 A;  1MMN A;  4I0U A;  3PUR A;  2XQ5 A;  2BVL A;  3CVR A;  3IF8 B;  4DO0 A;  3SIO A;  2QRX A;  5LG3 A;  4P1N A;  4O4H E;  2C5I T;  1D0X A;  3RQW A;  2BKN A;  3UUM A;  4O2A E;  4ZR6 A;  4D01 A;  4XK9 A;  4PAG A;  4YSY A;  4AKL A;  4AKI A;  2D2S A;  3QB5 A;  3KFW X;  4BJN A;  4B6X A;  4QXC B;  5LXT E;  3N2K E;  2V6X A;  2W4X A;  5HXH A;  5CA1 E;  3RLF F;  2FUP A;  3P4Q A;  4EAH A;  2BYP A;  3A8Y C;  3D0T A;  2X67 A;  3F31 A;  4IE7 A;  3H3M A;  4XBF B;  4FI5 A;  2WWU A;  2C5K T;  3LJC A;  2ODU A;  4EIW A;  1MIY A;  3VHL A;  2C0S A;  4P09 A;  1T98 A;  2BYS A;  1SE7 A;  4B3M T;  1Y01 A;  2V8S V;  4E7S A;  5LGT B;  2MTQ A;  4ADZ A;  4WBN E;  2V7M A;  3WTH A;  3UT5 E;  3FZF B;  3LBX A;  2XY8 B;  2E2A A;  4ZZC A;  4JI6 T;  3GMI A;  3N9M A;  5L3B B;  3RKO A;  4X64 T;  4LFC T;  4N78 D;  4CXX A;  4HFH A;  3WTM A;  3P50 A;  3ZYL A;  2XHE B;  4U74 A;  4DV6 T;  3Q9D A;  5JH7 E;  4BAY B;  3B5M A;  3PU3 A;  2BS2 A;  5JTG A;  3PUZ F;  3RX6 A;  4IRE A;  4JI4 T;  3GUA A;  1SHZ C;  5HCJ A;  4LFA T;  3AVS A;  4JI3 T;  5BW2 A;  1QUU A;  2H7V C;  2V5D A;  2CHN A;  4UVA B;  3ZJ1 A;  5L3F B;  4O8S A;  5LHI B;  2XSA A;  4I55 E;  3FZK B;  3QK6 A;  4TV9 E;  2Q9Q C;  3PUS A;  4DV2 T;  1BR0 A;  3N9Q A;  4UV8 B;  3PEO A;  4IHJ E;  4IDN A;  5LBM A;  3PUX F;  5M4Y A;  3UQ7 A;  5L4H A;  2JQH A;  1N32 T;  4X1K E;  1KNR A;  1UUS A;  5LCY A;  4PJM A;  4ZI2 C;  4H63 V;  5JME A;  4PIR A;  2B76 A;  5H6R B;  5TAO A;  4DR6 T;  3PV0 F;  2V1D B;  2WU2 A;  5L4E A;  4QAB A;  3JCF A;  3RGL A;  3QOF A;  3JC6 C;  2LKH A;  3TLU A;  4ZI3 D;  4UM3 A;  4JI1 T;  1XNR T;  4UV9 B;  1ZP0 A;  5KX5 E;  2WMN A;  1D1C A;  2JJ9 A;  3L3P A;  4ZI7 E;  5JDF A;  2BYQ A;  2BG9 B;  5AQG B;  1N34 T;  1FEW A;  2ZJU A;  5LJM A;  4DBM A;  1W0B A;  2J47 A;  2FJB A;  3GA8 A;  3C4W A;  4FRR A;  2CBI A;  2UXB T;  3K1S A;  5LMU T;  3PU8 A;  2QVA A;  4AIU A;  2V6Y A;  2V7L A;  2DNX A;  2J1D G;  2LHR A;  2Q9Q B;  2XNT A;  4PFO A;  1MNE A;  3C98 B;  3EDU A;  1Y64 B;  5DQW A;  3ZJ2 A;  2VL0 A;  5AQR B;  4CQI A;  5CO5 A;  4ILA A;  4KHP T;  5FKY A;  2D5U A;  4ZJS A;  4HFB A;  3I1A A;  2HPL A;  5AQF B;  1XDP A;  4YLH A;  4COF A;  5L2L A;  4L5G A;  4NIQ A;  3BQI A;  5AQP B;  3MAC A;  3Q5X A;  3PE0 A;  2J4G A;  4AQF A;  2WN9 A;  5F3J A;  4HEA A;  3SH1 A;  2LSG A;  2XAQ B;  5FVL A;  5LHH B;  4PFP A;  2MYS A;  3C51 A;  1J1J A;  4QH4 A;  1OXZ A;  2XQ9 A;  2EHO D;  1MIW A;  1FMW A;  2Y48 B;  1M7K A;  3RC8 A;  3OBV E;  4LML A;  3SS1 A;  4QHO A;  2LSI A;  4U7Y A;  4JI8 T;  3IHR A;  1U4Q A;  4C90 A;  4BJM A;  4GYR A;  5AFH A;  3NBX X;  3AXJ A;  3TKL B;  5HCM A;  4YHJ A;  4HKA A;  2UXX B;  2LEH A;  4QXH B;  3ZT5 A;  4O2B E;  2BBH A;  2E9X C;  3C84 A;  4HFD A;  4ZOL E;  4YT0 A;  4DBR A;  2UU9 T;  2N2N A;  2SPC A;  4GYS A;  4KP3 C;  5AFM A;  3OPC A;  2G0U A;  3OKQ A;  4TNV A;  3C4X A;  3RYI E;  4YTP A;  4YSX A;  2Y54 A;  5AFU L;  1E2A A;  5EK3 A;  3I9W A;  3AAE B;  3WTK A;  4HE8 A;  2FJE A;  2Y6X A;  3AE4 A;  5LHG B;  2CXF A;  4NUU A;  3UU8 A;  1BR4 A;  2AE9 A;  4IE5 A;  4ZEY A;  4X1I E;  4QX7 B;  2ODV A;  1WFD A;  2XQ8 A;  2WMO A;  1UCU A;  5HXC A;  2LM2 A;  2IHR 1;  2LSJ A;  4MLK A;  3ZT7 A;  4HWD A;  3Q5W A;  4IDO A;  4CXW A;  1Z8U A;  4ISS A;  4U2Z A;  4UVC B;  3CIR A; 
#chains in the Genus database with same CATH homology
 3C79 A;  3TLW A;  4ZJT A;  3UU5 A;  3UU3 A;  3EHZ A;  2LLY A;  3RQU A;  2YMD A;  2MAW A;  5J5G A;  3EI0 A;  2X00 A;  5FJV A;  3WTI A;  4TWD A;  2BYQ A;  5BRX A;  3ZKR A;  2BG9 B;  2XNV A;  3PMZ A;  5HEH A;  2WZY A;  2ZJU A;  2YME A;  4HFH A;  5AFL A;  4LML A;  3RI5 A;  4DBM A;  4HFE A;  4B5D A;  1OED C;  2XQ5 A;  3UU6 A;  5AFJ A;  4BFQ A;  5AFM B;  1OED A;  3WTM A;  5IUX A;  2BR8 A;  4FRR A;  2XZ5 A;  3SIO A;  2YOE A;  3WTO A;  2WNJ A;  3P50 A;  5AFH A;  2W8F A;  5AFK A;  4NPP A;  3U8J A;  4EZ1 A;  5LG3 A;  4A97 A;  2BYR A;  2ZJV A;  3SQ6 A;  5J5H A;  2PGZ A;  2XNU A;  2QC1 B;  5HCM A;  3UUB A;  3JAE A;  1UW6 A;  2LKG A;  2XNT A;  3RQW A;  4IL9 A;  3U8L A;  2BJ0 A;  4IRE A;  2Y56 A;  1OED E;  3C84 A;  3GUA A;  4HFD A;  5HCJ A;  4ZR6 A;  4ZZB A;  3RIA A;  4AFG A;  1I9B A;  2VL0 A;  2BYN A;  4D01 A;  4XK9 A;  4ILB A;  3ZDG A;  4UY2 A;  4ZK4 A;  1UX2 A;  5BW2 A;  4QAC A;  3RHW A;  2M6B A;  4LMJ A;  4TWF A;  5CFB A;  4ILA A;  2W8G A;  3IGQ A;  4WV9 A;  5CO5 A;  4ZK1 A;  5AFM A;  2Y57 A;  4HFI A;  4F8H A;  5HEJ A;  3EAM A;  4ZJS A;  4UM3 P;  4HFB A;  4XHE A;  2PH9 A;  2XQ3 A;  3JAF A;  2YKS A;  4ILC A;  3SQ9 A;  3P4W A;  4QH1 A;  4TNV A;  3ZDH A;  4QAA A;  4Z91 A;  4NZB A;  2WNC A;  2XYS A;  2X00 D;  5AIN A;  3LSV A;  5J5I A;  4COF A;  5HEG A;  2YN6 A;  2Y54 A;  3JAD A;  2BYP A;  2BG9 E;  4A98 A;  2WNL A;  3WTJ A;  3UQ4 A;  2KSR A;  5L47 A;  5AFN A;  3PEO A;  2XYT A;  2BG9 C;  3TLT A;  5HEU A;  3WTK A;  4ZRU A;  4BQT A;  2BG9 A;  2BR7 A;  3UQ7 A;  2XQ4 A;  4QH5 A;  5L4H A;  3TLV A;  4Z90 A;  4HQP A;  3U8N A;  2Y58 A;  3WTL A;  2XQA A;  2Y7Y A;  5BP0 A;  3WIP A;  4LMK A;  3TLS A;  4TWH A;  3UU8 A;  5JME A;  2WN9 A;  4AFH A;  5J0Z A;  4PIR A;  2BYS A;  5TVC A;  3SH1 A;  2XQ8 A;  4UM1 A;  3U8K A;  5HEO A;  1OED B;  2LM2 A;  4TNW A;  4X5T A;  4ALX A;  3T4M A;  4AFT A;  4UM3 S;  2C9T A;  3RIF A;  3UU4 A;  5L4E A;  4QAB A;  2XZ6 A;  5KZU A;  5SYO A;  2XQ7 A;  4QH4 A;  3WTH A;  2XQ6 A;  5J5F A;  4HFC A;  1UV6 A;  2LKH A;  3TLU A;  4UM3 A;  4UXU A;  2XQ9 A;  5KE4 A;  4IL4 A;  4ZZC A;  2M6I A;  3U8M A;  2UZ6 A;  5LXB A;  3WTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...