4ILCA

The glic pentameric ligand-gated ion channel in complex with sulfates
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ilcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ilcA01
4QH1A 5FJVA 3IGQA 1OEDA 5CFBA 5HEOA 5TVCA 5BW2A 2M6IA 4QAAA 4HFIA 4TWDA 5L47A 4HFDA 4IL4A 3C79A 3UU8A 2UZ6A 4A97A 2ZJVA 3U8KA 3ZDGA 1OEDE 3JAFA 2W8GA 4UM3S 3GUAA 3EHZA 3SQ6A 5AFHA 4HFEA 5HEGA 1UV6A 4ZJSA 4HFHA 4HFCA 4ZJTA 5J5IA 5BP0A 1OEDB 2YMEA 4FRRA 4ZR6A 1UW6A 4DBMA 3PMZA 2Y54A 2M6BA 3WTIA 3TLTA 2C9TA 4IREA 3WTOA 3UU3A 4ZZCA 5CO5A 5HCMA 5JMEA 2X00A 5LG3A 5BRXA 3ZKRA 2XQ7A 5HEHA 2X00D 3C84A 4AFTA 5J5HA 5AFKA 4WV9A 4Z91A 2Y7YA 4AFGA 1OEDC 2BYQA 3WTKA 2XQAA 2XQ4A 2WN9A 3WTHA 4ZRUA 4NPPA 3EI0A 2YMDA 4TNWA 3U8JA 4BFQA 2LLYA 3EAMA 5IUXA 3WTLA 4HFBA 5KZUA 2PGZA 5SYOA 2ZJUA 4COFA 4QABA 4ILBA 5LXBA 4QH5A 3JAEA 2BG9A 2KSRA 1I9BA 5HCJA 4HQPA 2MAWA 4TWHA 5AINA 2BR7A 5AFJA 3UQ4A 3WTNA 4ILAA 5J0ZA 2XYTA 2PH9A 3ZDHA 4UM3A 4UY2A 5J5GA 3U8NA 3TLUA 3P4WA 2QC1B 3UU5A 2XNUA 4UM3P 5HEJA 2BG9E 2BJ0A 3RQUA 3PEOA 4ZZBA 3U8LA 2XNTA 4XK9A 2YKSA 2BR8A 2BYPA 3UQ7A 3WTJA 5AFLA 3TLSA 4A98A 2BYRA 2XQ9A 3RIFA 2XQ6A 4B5DA 4D01A 5AFMA 4LMJA 4ZK4A 3RQWA 2LKGA 2YOEA 4ALXA 4X5TA 3UU4A 2BG9B 4XHEA 4AFHA 2YN6A 4EZ1A 5AFNA 3TLWA 3RHWA 4UXUA 2WZYA 2LM2A 3U8MA 3RIAA 4ZK1A 4QH4A 2WNLA 3WIPA 2XQ5A 2BYNA 4TNVA 4QACA 2XQ3A 2XQ8A 4IL9A 3TLVA 5L4EA 2Y57A 3SH1A 3WTMA 3SIOA 3SQ9A 3T4MA 5AFMB 4F8HA 2XNVA 2W8FA 2Y58A 2BG9C 5KE4A 3LSVA 5J5FA 4LMLA 4Z90A 4TWFA 1UX2A 3JADA 2XZ5A 4NZBA 2XZ6A 3RI5A 3UUBA 5L4HA 4LMKA 2WNJA 2BYSA 2Y56A 4ILCA 4PIRA 2VL0A 3P50A 5HEUA 2LKHA 2WNCA 4UM1A 2XYSA 4BQTA 3UU6A
chains in the Genus database with same CATH superfamily
4QH1A 1VOMA 4AQFA 4HFIA 2KMFA 4EYUA 4PK4A 4A97A 3ZDGA 5KMGP 4IT4A 5LMNT 2Y6XA 4QXCB 4HFEA 3O9XA 2KNDA 2LRKA 4HFHA 4ZJTA 2MTQA 2VQET 1OEDB 4ZR6A 4DO0A 3B57A 3V5UA 5AQRB 4EOZB 4U3CA 4O2AE 3C64A 4EAHA 3ZKRA 4AFTA 5DQVA 3K3OA 5HXCA 4JI8T 4YSYA 3EI0A 2XZEA 4CN6A 3GMIA 3NKZA 4KUMB 3WI3A 3JC6D 2BG9A 4LFAT 4GKKT 2E9XD 2GK9A 2KWIB 2YU2A 3AA7B 3B13A 3LK42 4UY2A 2CXLA 3I9WA 5FXVA 2LKGA 3NRYA 1FMWA 2CBIA 1S35A 5FL0A 2CLYB 1LVKA 4UXUA 2X0LB 3CQCB 4EV6A 4U2YA 4GOUA 4JI0T 4NXMT 1HCIA 5DABA 2DWGA 2ES0A 4O4LE 2V6YB 5AQHB 2BZBA 3A8YC 4Z90A 2XY8B 2WU5A 2Y48B 1N36T 3OTOT 3RIUC 2IHR1 3NZQA 2SPCA 3KVBA 2A3DA 5L2LA 5L3DB 3C79A 2KXPB 1E1HB 4ZI3C 5E0OA 2D0UA 3F57A 1Z0PA 4I43B 4YY3T 3VR9A 2WCAA 5BP0A 2WY2A 3HI2A 4JI7T 2QRXA 3WTIA 4ISSA 3ZMTB 3ZC1A 3HKEE 1W0BA 5BRXA 5IYZE 4LF4T 1YD8G 2V7LA 3ETUA 4DV3T 4JEHB 3AB3B 1WCRA 3T1HT 1MNDA 4O2BE 3JAEA 4O4IE 2HN2A 4HN9A 3PUAA 2ACZA 5L3CB 3BK9A 1D0XA 4NXNT 2XYTA 5JREA 2J47A 4AKLA 4UM3P 3FXEB 4XK9A 3ZJ1A 4TZ4C 5AFLA 2XQ9A 3AAAB 4D01A 1BR2A 1WR0A 4ZS3A 5AQNB 3OKQA 3PUXF 4DMWA 3EUHA 4CZZB 2FJDA 2DHRA 1Z8UA 2Q9QC 4EZHA 4TX5A 2YEVC 3GN5A 1D1BA 4HQPA 3UU6A 3ZJ2A 1MMNA 3LJCA 2HN1A 3ZMUB 2CXDA 3QC9A 2CM0A 4J2CA 5EK4A 4WBNE 3JAFA 1IBMT 2NW8A 2FBWA 2IUBA 3EHZA 5AFHA 4IE4A 4IDNA 3C4WA 2YMEA 1MMGA 2K24A 5ABFB 1IZNB 3OYXA 3QUJA 5HCMA 4GIWA 3ZSSA 5LG3A 2X66A 2I6HA 4K0KT 4JI4T 2Z6EA 4WV9A 2JJ9A 4DR5T 5CA1E 2IDOB 2YMDA 3U8JA 4HTEA 4YHHT 2YK0A 3MACA 3RYIE 4TWHA 4UVCB 2BVMA 2AXDS 3Q5DA 2K48A 4FI5A 2XNUA 3IEEA 2BVLA 4U33A 2VB6A 3WTJA 2YKSA 3KBUA 2AE9A 3PDYA 2WQYA 3RYCE 4XHEA 5J2TE 3PUZF 3U8MA 5L3GB 1N32T 2JQ9A 4IDZA 1UUSA 5F5WA 3SH1A 3VR8A 3T4MA 4EZ4A 1D1CA 2CWOA 2LRLA 1KF6A 2WNCA 1L0VA 1WYBA 5CJ5A 3QK6A 3N2GE 2MOZA 2ZJVA 3PUSA 2VQFT 3CVRA 4B3MT 4GK0E 3Q5EA 4U7YA 4E7SA 4PNIA 4ZI2D 4UM3S 3ZC0A 3OJAA 5JRCA 5JDGA 3H3AA 4PK5A 5LHGB 3MZKB 2Y54A 3TLTA 5JDQA 1OWAA 2E5LT 2VKOA 4TN7B 1IJ6A 5LHHB 2WAUA 4NUUA 3BQIA 4KHZF 3AAIA 2N9DA 4AQFC 2XJ7A 2XAJB 1NEKA 5M4YA 4O4HE 4ZI2C 4OHFA 3ANWA 1HR0T 2W2UA 2LT3A 5AFJA 4ILAA 3RYFE 5BW2A 2XQYA 5FXWA 2BG9E 4EYYR 3RRCA 3AE7A 3I1AA 5AQJB 2LHNA 4LMJA 3J9X1 1QLBA 3MK7C 5LGTB 1LKXA 5AFNA 4EZ1A 2JIWA 5AQFB 3K1SA 4DR2T 2LJLA 2V7JA 2JQHA 3E22E 3VRBA 4EB6E 5ADXL 4P1NA 4L9IA 3O1IA 4HWFA 5AFMB 1KEYA 2BG9C 2WDRA 4LFBT 4CQIA 4EIWA 5FMNA 4ZXLA 5FVKA 3HL6A 2WSSV 1MIWA 3I0QA 2JMHA 3IGQA 1U4QA 1MMDA 4LF9T 1XWMA 2A9UA 2W63A 2HHHT 3PURA 4ZEYA 1XZYA 2H3RA 3PV0F 4IDQA 3VKGA 2V5DA 2E8IA 4JI1T 4L5GA 5J5IA 5AQLB 2XAFB 3WTOA 2W0GA 2H89A 5J5HA 5LGUB 4YFSA 2Y7YA 4CXXA 3M65A 2BYQA 1X79A 3O1JA 5JDFA 3FZKB 4A5XA 5J1GA 1KNPA 3QOFA 2BR7A 3DP7A 5FP3A 2LM9A 3AA6B 3F2EA 4DUZT 1Y01A 1FIOA 3OBVE 1XMOT 5KX5E 1HG5A 2YOEA 2JPFA 4X5TA 3UU4A 2E9XB 3AEDA 4H9NC 4UF0A 1IAPA 4G63A 2LM2A 1HNXT 4KI0F 3LBXA 3HR0A 3WIPA 2JMKA 1QUUA 4DR6T 5FXXA 1FEWA 3N9PA 4LMLA 3LFMA 2X67A 2BYSA 1G73A 5AQGB 1HX1B 4JI3T 4PIRA 1ZHCA 5HWYA 5CFBA 3EVYA 3PJAJ 2M6IA 3PUVF 3KV9A 2X0YA 1KNZA 2HPLA 2ZM8A 1KFYA 4H9QC 5ETWA 3GUAA 2I59A 3R6NA 5HEGA 2ODVA 3F31A 2BBHA 4ZI7E 4OX9T 1SUMB 2X9WA 2WDVA 4I55E 4MALA 4GYRA 4OFZA 2CEAA 1XNQT 1JNRA 1ZP0A 4X20E 3N9NA 1GQEA 4M1PA 1SA0E 1T8BA 4ZHQE 5F3JA 5LGNB 5IUXA 3RF1A 2ZJUA 2I0MA 4DBQA 4QH5A 4LF5T 2CE7A 5CGMA 1XMQT 2HH7A 5BMVE 5AQUB 2WB5A 4ASKA 2EHOA 1NAFA 4X65T 4UM3A 4UELA 2LSKA 2XNTA 5AQSB 3UQ7A 5LCYA 2C5IT 4A98A 3CWZB 4NIQA 2BYRA 3HA4A 1HF8A 2UU9T 1US7B 4PFOA 3UT5E 4MBQA 5ABFA 4YSXA 2XQ5A 4HWCA 4WBOA 3ZMSB 4HEAA 4NUVA 2G0UA 2IW5B 3J7Yq 5KE4A 2W8FA 2Y58A 3PJAA 1UX2A 2J62A 2XSAA 2KZ7B 4PFPA 3ONLC 4KMCA 2X9XA 4AKRB 1QSDA 5FXZA 1YQ3A 3QNUA 3BQLA 4TWDA 5L47A 4ZI3D 3IA3A 2XSBA 3IF8B 2W66A 5LB7B 2VKHA 4ERRA 4JI5T 2BS4A 4ZJSA 4YSZA 2V26A 3N5LA 4L0RA 3M3ZB 2UUCT 3UU3A 4OYKA 3SRZA 5AQPB 2V5CA 3RKOA 3P4SA 3ABVA 2NTYA 3O1HA 2YDQA 3C98B 4AFGA 2WDQA 3CQGB 2XQAA 4IHJE 5LA6E 4BA9A 2LLYA 2OLTA 3PUYF 3UUXB 4QABA 2KINB 2KSRA 3AXJB 3UQ4A 3ZT6A 4MHCA 4GYSA 3ZDHA 3N9MA 5LHIB 3UU5A 1B7TA 3PEOA 3FHNA 4ZZBA 4IGUA 2BR8A 4UXNB 2BKOA 3TLSA 2D5UA 4O8SA 4CXWA 2CA5A 4JYAT 1FJGT 3HKCE 1T72A 3UUMA 2PFVA 1J1JA 2Q9QD 1HG2A 1FMVA 3CQXC 4QACA 1BR4A 4N78D 2XUEA 4YHJA 4DMVA 3C4ZA 2XZ6A 1UURA 2LSGA 3ZT5A 4ILCA 5HEUA 4UM1A 2MYSA 4X66T 3ZCIA 3O4XE 5F8PA 4JLEA 3Q5XA 3RGLA 4ANJA 1J5WA 5C8YE 4U31A 2XASB 3N9QA 4YT0A 4UIGA 1MIYA 2MPKA 5JDNA 3CIRA 1S94A 1W0AA 4ZZCA 3ZT7A 2X00A 4MFRA 3DJBA 5HEHA 4KHPT 2DI4A 2XQ4A 1I6ZA 3KBTA 2H7VC 2VVNA 3JCFA 3PE0A 3G06A 5KZUA 3PU8A 5LOVE 2CMRA 1U5PA 5J0ZA 4DV1T 4PJLA 2XM1A 2QC1B 2L9QA 3VHLA 2CLYC 2C5KT 5FY0A 4QKNA 4IIJE 4HWDA 2CBJA 3KV4A 2BG9B 5EK3A 3ZCJA 2A72A 3T8OA 5JTGA 3AAEB 3MJXA 4YTNA 2BYNA 5L3EB 1IBKT 4PJJA 5L4EA 3R84B 4F6RC 1X9BA 4DR4T 3LSVA 2XAHB 2UXBT 3RI5A 5JVDE 4UR9A 3PUQA 3CKDA 2VURA 3E0ZA 4HWIB 4QAAA 2V1DB 2UZ6A 4Z8XA 3I9YA 3P4QA 4O4JE 5JDMA 2VK9A 5JR9A 2X9YA 1UGOA 3Q2MA 2WBLA 4ISTA 1N34T 1V9DA 4WW0A 1VCSA 2HPJA 3FB2A 3WTKA 1W09A 3WAJA 2KT9A 4CI1B 5LBQB 3L8RA 3V5SA 3AEGA 2IC9A 4WYVA 1KK7A 1VRBA 1OXZA 2V8SV 3VRAA 5AQQB 3AE5A 4X62T 1MMAA 4H9OC 1YKEB 3FZMB 3NWIA 2XHEB 3TLWA 3RHWA 1D0ZA 1WR6A 2WNLA 3RH3A 1NWMX 4TV9E 4DIDB 3WTMA 4F8HA 1YQ4A 2BBJA 3MXZA 3CMLA 2EHOC 2UUBT 3U3IA 5DQWA 3UFGA 1UX5A 4QHOA 2WZHA 5HXSA 3DTOA 1OEDA 2UXNB 2E2AA 5FKYA 3HKDE 1YKHB 2XM2A 2QVAA 2WWUA 2K3WA 3C4XA 3ONXA 4UVAB 3AVSA 1HTJF 1T7SA 4G2AA 2WM9A 1ZV4X 4IE6A 2CXFA 4Q25A 4IREA 4YJ3E 4DV6T 4H9SE 5LMUT 4B3TT 1E7PA 3C84A 3K8PC 5AFKA 5TAOA 4IE7A 3AE9A 5ABEA 3GA8A 3LDQB 2KWHA 2C5JA 5FVLA 3P4RA 5LJNA 4TUYE 2ZM2A 4P0BA 4XZCA 5HAXA 2QA7A 3P7IA 2VASA 1UX4A 2M67A 2JRKA 3RRWA 2V6YA 3CX6B 2FUPA 2CPTA 2CHOA 4QH4A 4TNVA 2XQ8A 3UUNA 3U78A 3SQ9A 5HWXA 4PJNA 2VWAA 3KDSE 2Y56A 2OA5A 5ABHA 4AXPA 4PK6A 1SHZC 2VKJA 5HEOA 3OPCA 5LJMA 4IL4A 4CN1A 4ILUA 4LF7T 4U7IA 2W8GA 2YDSA 3RX6A 3SQ6A 2PTFA 1HNZT 3AEBA 4QX8B 2IC6A 4LF8T 2LOPA 4DBRA 2B76A 2C9TA 1CUNA 3W15B 2ZM0A 5JMEA 4DV5T 2X00D 3SFDA 3OYZA 2LEHA 5JRCB 3S4UA 1HX8A 5IWAT 2W4XA 5DJQC 4TNWA 2K5BB 5JQGE 4AKIA 4E7ZA 2VKDA 5AQOB 4XBFB 2BKNA 5EK2A 3L09A 1BR1A 4KP3C 3TLUA 5LXTE 1M62A 3CPZA 2N2NA 4B3ST 2H7OA 4BJNA 1DU2A 3SFEA 2W00A 2C0SA 4JUYA 3ONJA 5A1LA 2KLQA 2BS3A 4ZK4A 1H7CA 4JI2T 4KX6A 4QXBB 4H9RC 2V7MA 3E08A 4LFCT 3PU3A 3RIAA 4CI2B 3KVAA 2FJEA 4X1YE 2DCFA 4V1Av 2Y57A 2XAGB 5FNVE 3FBLA 1WRDA 2K9AA 3ZLIA 2XZ5A 4DV2T 5KDMC 4PAGA 2J1DG 2WU2A 4U2ZA 2QGSA 2Q9QB 4H63H 4YLHA 3UULA 5CA0E 5FJVA 4DR3T 5GONE 1CHUA 1O3XA 1HFAA 3WAKA 1T98A 1J5ET 2VL8A 3ZMZB 4PJMA 2E5VA 3OVUA 4UEMA 3PMZA 3FXDB 3A7MA 3SS1A 3X1DA 5CO5A 1R8IA 1ZEEA 4HWHA 2V6XA 2XQ7A 2WP9A 5CB4E 4WZXA 3WTHA 1XDOA 4BFQA 3GWHA 2OV9A 5LYJE 2VVSA 4YTPA 4HFBA 5LP6E 1E2AA 2PBIA 4DV4T 5HYAA 5JR9C 1M7KA 2QYWA 2WMOA 3JC6C 3ZPOA 2E9XC 2DWKA 3RQWA 4X64T 4DV0T 2D0TA 4AQYT 1HNWT 3SOLA 2RP4A 4ZK1A 4XAXB 4TV8E 4KBMB 5ABGA 4UF0B 4H63V 4LMKA 5FY7A 1HS7A 2BKPA 3LBXB 4AKHA 1NENA 1W9RA 2ZMAA 3I0OA 4P0AA 5TVCA 3L39A 4A56A 3RC8A 3LK2B 1WYCA 1OEDE 4EEDA 3QB5K 2PG8A 2JQKA 1KNRA 4DBMA 2M6BA 4OK0A 2DL1A 5KXJA 4P09A 3AE6A 5AQMB 1D0YA 2DLRA 3P4PA 3KV6A 4I0UA 1OEDC 5HXHA 3FZLB 4AKGA 4AIUA 2YINA 3AE1A 2PGZA 2V7KA 2R6GF 5SYOA 5JH7E 3RKGA 4ILBA 1Y64B 2WMNA 5HXRA 4JI6T 3AE3A 3LG7A 3U8NA 4X1IE 4CXYA 3KFWX 2BJ0A 4C91A 2BYPA 1JNZA 3RIFA 2XQ6A 5AFMA 1IJ5A 4ALXA 2ZLYA 2YN6A 3EDUA 2EHOB 4HGAA 2JQQA 2XNVA 3UTKA 4FJOA 4TWFA 5L3FB 3VKHA 5L4HA 2NP9A 2X9HA 2IMLA 3EDVA 2NOXA 4YJ2E 2L8KA 1LRZA 2UUAT 2LKHA 4BQTA 2WZIA 3N2OA 4HFDA 3UU8A 4DR1T 5FYMA 4H9PC 1EZ3A 4EEBA 3L3PA 5LBMA 4B6XA 3C51A 4DV7T 3T1YT 4FRRA 1G8XA 4JEUB 3IHRA 4UV9B 2CHNA 4JBWF 2B1EA 4DVDA 1IBLT 4YXDA 3IBPA 2H88A 1BR0A 4ZRUA 4NPPA 4ADZA 3EAMA 3VU7H 5IHYA 5LXBA 2A2FX 2CWYA 2E9XA 1N33T 1XNRT 5HCJA 2NW7A 5LG4A 3TKLB 3WTNA 2YDRA 1VCTA 1MNEA 5JDHA 1UK5A 3U8LA 3AE4A 5JDLA 3LK3B 2UXXB 3RIUA 4EXTA 2X0HA 4B5DA 3Q9DA 1YW0A 3ZEFB 4HE8A 3ZN1B 1MIVA 3N2KE 2V7IA 2WZYA 1UCUA 2UXDT 3RLFF 2XQ3A 4CI3B 3ZYMA 2EHOD 3CK6A 2RA1A 4X1KE 3H3MA 5J5FA 3UUBA 1ZKEA 3B5MA 5HXEA 2X68A 2LSJA 4UV8B 2XYSA 4IDOA 3Q5WA 3NVOA 3U8KA 5EZYE 3AEAA 2LOSA 2P9BA 2D2SA 3PUGA 4K0UA 4MLKA 5J2UE 1UW6A 3K3NA 4B3RT 2DNXA 4HFVA 2WWVA 2LSIA 3BQKA 5FL1A 2WS3A 2RPAA 2J4GA 3NRXA 3AE2A 3ZYKA 1XDPA 5AQIB 2FJBA 4AISA 2WN9A 3GN5B 2W62A 4GK5E 3AEFA 4JV5T 3WTLA 2CCQA 3ZN0B 4COFA 2ODUA 3N9LA 3QB5A 2FJAA 2MAWA 2Q9QA 5AINA 5L3BB 4QWNB 5H6RB 3K3QC 3KV5A 5AQTB 2PH9A 5HEJA 1D1AA 3RQUA 4C90A 2LSYA 5C3JA 4ZOLE 3PTRB 5FY1A 2X51A 4IDPA 4AFHA 4IE5A 1ZOYA 2D9DA 4PW8A 4BJMA 3FBZA 3RPUA 2N1GA 4BAYB 3JADA 5H6QB 4NZBA 3KINB 2WNJA 2LHRA 4WNKA 3A5XA 4DNDA 3NZPA 3ESLA 3P50A 3AEEA 2YU1A 3AA0B 1WFDA 3EABA 3RYHE 3CX8B 3NBXX 4IE0A 5LNKA 2W67A 4LF6T 4YTMA 5BR8T 2XTLA 2XPKA 4QXHB 3PUWF 1UV6A 1AJ3A 4HFCA 2NW9A 4CN4A 2ZM6T 4ZS2A 1WLXA 2F4VT 3AE8A 2ACXA 4OYJA 5AFUL 3HKBE 2LE8A 3AECA 3AXJA 4Z91A 3C50A 5JR9B 2MBGA 2BS2A 4I4TE 3ETVA 4U72A 1SE7A 5C2TA 3SWHA 2Y8DA 3D0TA 1LVFA 3ZYLA 4DUYT 2L3LA 3MA9A 4GKJT 1I9BA 2BDEA 3ZMVB 2NTXA 3N9OA 3UFEA 2CRBA 1I94T 5AQVB 5J5GA 3P4WA 2UXCT 2W61A 3H37A 4EGWA 2PJQA 2NR4A 2IAKA 3AA1B 4HKAA 2IIUA 4QX7B 4I50E 3RC3A 4AI6A 3FZFB 3MKDA 5AQKB 4IL9A 3TLVA 3P8CD 3ZSTA 3AVRA 3SIOA 4DR7T 2XAQB 3FZHB 4UVBB 3ANWB 1YXRA 4AQGA 2VL0A 4U74A 3CX7B 2NWBA
chains in the Genus database with same CATH topology
4QH1A 5FJVA 3IGQA 1OEDA 5CFBA 5HEOA 5TVCA 5BW2A 2M6IA 4QAAA 4HFIA 4TWDA 5L47A 4HFDA 4IL4A 3C79A 3UU8A 2UZ6A 4A97A 2ZJVA 3U8KA 3ZDGA 1OEDE 3JAFA 2W8GA 4UM3S 3GUAA 3EHZA 3SQ6A 5AFHA 4HFEA 5HEGA 1UV6A 4ZJSA 4HFHA 4HFCA 4ZJTA 5J5IA 5BP0A 1OEDB 2YMEA 4FRRA 4ZR6A 1UW6A 4DBMA 3PMZA 2Y54A 2M6BA 3WTIA 3TLTA 2C9TA 4IREA 3WTOA 3UU3A 4ZZCA 5CO5A 5HCMA 5JMEA 2X00A 5LG3A 5BRXA 3ZKRA 2XQ7A 5HEHA 2X00D 3C84A 4AFTA 5J5HA 5AFKA 4WV9A 4Z91A 2Y7YA 4AFGA 1OEDC 2BYQA 3WTKA 2XQAA 2XQ4A 2WN9A 3WTHA 4ZRUA 4NPPA 3EI0A 2YMDA 4TNWA 3U8JA 4BFQA 2LLYA 3EAMA 5IUXA 3WTLA 4HFBA 5KZUA 2PGZA 5SYOA 2ZJUA 4COFA 4QABA 4ILBA 5LXBA 4QH5A 3JAEA 2BG9A 2KSRA 1I9BA 5HCJA 4HQPA 2MAWA 4TWHA 5AINA 2BR7A 5AFJA 3UQ4A 3WTNA 4ILAA 5J0ZA 2XYTA 2PH9A 3ZDHA 4UM3A 4UY2A 5J5GA 3U8NA 3TLUA 3P4WA 2QC1B 3UU5A 2XNUA 4UM3P 5HEJA 2BG9E 2BJ0A 3RQUA 3PEOA 4ZZBA 3U8LA 2XNTA 4XK9A 2YKSA 2BR8A 2BYPA 3UQ7A 3WTJA 5AFLA 3TLSA 4A98A 2BYRA 2XQ9A 3RIFA 2XQ6A 4B5DA 4D01A 5AFMA 4LMJA 4ZK4A 3RQWA 2LKGA 2YOEA 4ALXA 4X5TA 3UU4A 2BG9B 4XHEA 4AFHA 2YN6A 4EZ1A 5AFNA 3TLWA 3RHWA 4UXUA 2WZYA 2LM2A 3U8MA 3RIAA 4ZK1A 4QH4A 2WNLA 3WIPA 2XQ5A 2BYNA 4TNVA 4QACA 2XQ3A 2XQ8A 4IL9A 3TLVA 5L4EA 2Y57A 3SH1A 3WTMA 3SIOA 3SQ9A 3T4MA 5AFMB 4F8HA 2XNVA 2W8FA 2Y58A 2BG9C 5KE4A 3LSVA 5J5FA 4LMLA 4Z90A 4TWFA 1UX2A 3JADA 2XZ5A 4NZBA 2XZ6A 3RI5A 3UUBA 5L4HA 4LMKA 2WNJA 2BYSA 2Y56A 4ILCA 4PIRA 2VL0A 3P50A 5HEUA 2LKHA 2WNCA 4UM1A 2XYSA 4BQTA 3UU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH1 A;  5FJV A;  3IGQ A;  1OED A;  5CFB A;  5HEO A;  5TVC A;  5BW2 A;  2M6I A;  4QAA A;  4HFI A;  4TWD A;  5L47 A;  4HFD A;  4IL4 A;  3C79 A;  3UU8 A;  2UZ6 A;  4A97 A;  2ZJV A;  3U8K A;  3ZDG A;  1OED E;  3JAF A;  2W8G A;  4UM3 S;  3GUA A;  3EHZ A;  3SQ6 A;  5AFH A;  4HFE A;  5HEG A;  1UV6 A;  4ZJS A;  4HFH A;  4HFC A;  4ZJT A;  5J5I A;  5BP0 A;  1OED B;  2YME A;  4FRR A;  4ZR6 A;  1UW6 A;  4DBM A;  3PMZ A;  2Y54 A;  2M6B A;  3WTI A;  3TLT A;  2C9T A;  4IRE A;  3WTO A;  3UU3 A;  4ZZC A;  5CO5 A;  5HCM A;  5JME A;  2X00 A;  5LG3 A;  5BRX A;  3ZKR A;  2XQ7 A;  5HEH A;  2X00 D;  3C84 A;  4AFT A;  5J5H A;  5AFK A;  4WV9 A;  4Z91 A;  2Y7Y A;  4AFG A;  1OED C;  2BYQ A;  3WTK A;  2XQA A;  2XQ4 A;  2WN9 A;  3WTH A;  4ZRU A;  4NPP A;  3EI0 A;  2YMD A;  4TNW A;  3U8J A;  4BFQ A;  2LLY A;  3EAM A;  5IUX A;  3WTL A;  4HFB A;  5KZU A;  2PGZ A;  5SYO A;  2ZJU A;  4COF A;  4QAB A;  4ILB A;  5LXB A;  4QH5 A;  3JAE A;  2BG9 A;  2KSR A;  1I9B A;  5HCJ A;  4HQP A;  2MAW A;  4TWH A;  5AIN A;  2BR7 A;  5AFJ A;  3UQ4 A;  3WTN A;  4ILA A;  5J0Z A;  2XYT A;  2PH9 A;  3ZDH A;  4UM3 A;  4UY2 A;  5J5G A;  3U8N A;  3TLU A;  3P4W A;  2QC1 B;  3UU5 A;  2XNU A;  4UM3 P;  5HEJ A;  2BG9 E;  2BJ0 A;  3RQU A;  3PEO A;  4ZZB A;  3U8L A;  2XNT A;  4XK9 A;  2YKS A;  2BR8 A;  2BYP A;  3UQ7 A;  3WTJ A;  5AFL A;  3TLS A;  4A98 A;  2BYR A;  2XQ9 A;  3RIF A;  2XQ6 A;  4B5D A;  4D01 A;  5AFM A;  4LMJ A;  4ZK4 A;  3RQW A;  2LKG A;  2YOE A;  4ALX A;  4X5T A;  3UU4 A;  2BG9 B;  4XHE A;  4AFH A;  2YN6 A;  4EZ1 A;  5AFN A;  3TLW A;  3RHW A;  4UXU A;  2WZY A;  2LM2 A;  3U8M A;  3RIA A;  4ZK1 A;  4QH4 A;  2WNL A;  3WIP A;  2XQ5 A;  2BYN A;  4TNV A;  4QAC A;  2XQ3 A;  2XQ8 A;  4IL9 A;  3TLV A;  5L4E A;  2Y57 A;  3SH1 A;  3WTM A;  3SIO A;  3SQ9 A;  3T4M A;  5AFM B;  4F8H A;  2XNV A;  2W8F A;  2Y58 A;  2BG9 C;  5KE4 A;  3LSV A;  5J5F A;  4LML A;  4Z90 A;  4TWF A;  1UX2 A;  3JAD A;  2XZ5 A;  4NZB A;  2XZ6 A;  3RI5 A;  3UUB A;  5L4H A;  4LMK A;  2WNJ A;  2BYS A;  2Y56 A;  4ILC A;  4PIR A;  2VL0 A;  3P50 A;  5HEU A;  2LKH A;  2WNC A;  4UM1 A;  2XYS A;  4BQT A;  3UU6 A; 
#chains in the Genus database with same CATH topology
 4QH1 A;  1VOM A;  4AQF A;  4HFI A;  2KMF A;  4EYU A;  4PK4 A;  4A97 A;  3ZDG A;  5KMG P;  4IT4 A;  5LMN T;  2Y6X A;  4QXC B;  4HFE A;  3O9X A;  2KND A;  2LRK A;  4HFH A;  4ZJT A;  2MTQ A;  2VQE T;  1OED B;  4ZR6 A;  4DO0 A;  3B57 A;  3V5U A;  5AQR B;  4EOZ B;  4U3C A;  4O2A E;  3C64 A;  4EAH A;  3ZKR A;  4AFT A;  5DQV A;  3K3O A;  5HXC A;  4JI8 T;  4YSY A;  3EI0 A;  2XZE A;  4CN6 A;  3GMI A;  3NKZ A;  4KUM B;  3WI3 A;  3JC6 D;  2BG9 A;  4LFA T;  4GKK T;  2E9X D;  2GK9 A;  2KWI B;  2YU2 A;  3AA7 B;  3B13 A;  3LK4 2;  4UY2 A;  2CXL A;  3I9W A;  5FXV A;  2LKG A;  3NRY A;  1FMW A;  2CBI A;  1S35 A;  5FL0 A;  2CLY B;  1LVK A;  4UXU A;  2X0L B;  3CQC B;  4EV6 A;  4U2Y A;  4GOU A;  4JI0 T;  4NXM T;  1HCI A;  5DAB A;  2DWG A;  2ES0 A;  4O4L E;  2V6Y B;  5AQH B;  2BZB A;  3A8Y C;  4Z90 A;  2XY8 B;  2WU5 A;  2Y48 B;  1N36 T;  3OTO T;  3RIU C;  2IHR 1;  3NZQ A;  2SPC A;  3KVB A;  2A3D A;  5L2L A;  5L3D B;  3C79 A;  2KXP B;  1E1H B;  4ZI3 C;  5E0O A;  2D0U A;  3F57 A;  1Z0P A;  4I43 B;  4YY3 T;  3VR9 A;  2WCA A;  5BP0 A;  2WY2 A;  3HI2 A;  4JI7 T;  2QRX A;  3WTI A;  4ISS A;  3ZMT B;  3ZC1 A;  3HKE E;  1W0B A;  5BRX A;  5IYZ E;  4LF4 T;  1YD8 G;  2V7L A;  3ETU A;  4DV3 T;  4JEH B;  3AB3 B;  1WCR A;  3T1H T;  1MND A;  4O2B E;  3JAE A;  4O4I E;  2HN2 A;  4HN9 A;  3PUA A;  2ACZ A;  5L3C B;  3BK9 A;  1D0X A;  4NXN T;  2XYT A;  5JRE A;  2J47 A;  4AKL A;  4UM3 P;  3FXE B;  4XK9 A;  3ZJ1 A;  4TZ4 C;  5AFL A;  2XQ9 A;  3AAA B;  4D01 A;  1BR2 A;  1WR0 A;  4ZS3 A;  5AQN B;  3OKQ A;  3PUX F;  4DMW A;  3EUH A;  4CZZ B;  2FJD A;  2DHR A;  1Z8U A;  2Q9Q C;  4EZH A;  4TX5 A;  2YEV C;  3GN5 A;  1D1B A;  4HQP A;  3UU6 A;  3ZJ2 A;  1MMN A;  3LJC A;  2HN1 A;  3ZMU B;  2CXD A;  3QC9 A;  2CM0 A;  4J2C A;  5EK4 A;  4WBN E;  3JAF A;  1IBM T;  2NW8 A;  2FBW A;  2IUB A;  3EHZ A;  5AFH A;  4IE4 A;  4IDN A;  3C4W A;  2YME A;  1MMG A;  2K24 A;  5ABF B;  1IZN B;  3OYX A;  3QUJ A;  5HCM A;  4GIW A;  3ZSS A;  5LG3 A;  2X66 A;  2I6H A;  4K0K T;  4JI4 T;  2Z6E A;  4WV9 A;  2JJ9 A;  4DR5 T;  5CA1 E;  2IDO B;  2YMD A;  3U8J A;  4HTE A;  4YHH T;  2YK0 A;  3MAC A;  3RYI E;  4TWH A;  4UVC B;  2BVM A;  2AXD S;  3Q5D A;  2K48 A;  4FI5 A;  2XNU A;  3IEE A;  2BVL A;  4U33 A;  2VB6 A;  3WTJ A;  2YKS A;  3KBU A;  2AE9 A;  3PDY A;  2WQY A;  3RYC E;  4XHE A;  5J2T E;  3PUZ F;  3U8M A;  5L3G B;  1N32 T;  2JQ9 A;  4IDZ A;  1UUS A;  5F5W A;  3SH1 A;  3VR8 A;  3T4M A;  4EZ4 A;  1D1C A;  2CWO A;  2LRL A;  1KF6 A;  2WNC A;  1L0V A;  1WYB A;  5CJ5 A;  3QK6 A;  3N2G E;  2MOZ A;  2ZJV A;  3PUS A;  2VQF T;  3CVR A;  4B3M T;  4GK0 E;  3Q5E A;  4U7Y A;  4E7S A;  4PNI A;  4ZI2 D;  4UM3 S;  3ZC0 A;  3OJA A;  5JRC A;  5JDG A;  3H3A A;  4PK5 A;  5LHG B;  3MZK B;  2Y54 A;  3TLT A;  5JDQ A;  1OWA A;  2E5L T;  2VKO A;  4TN7 B;  1IJ6 A;  5LHH B;  2WAU A;  4NUU A;  3BQI A;  4KHZ F;  3AAI A;  2N9D A;  4AQF C;  2XJ7 A;  2XAJ B;  1NEK A;  5M4Y A;  4O4H E;  4ZI2 C;  4OHF A;  3ANW A;  1HR0 T;  2W2U A;  2LT3 A;  5AFJ A;  4ILA A;  3RYF E;  5BW2 A;  2XQY A;  5FXW A;  2BG9 E;  4EYY R;  3RRC A;  3AE7 A;  3I1A A;  5AQJ B;  2LHN A;  4LMJ A;  3J9X 1;  1QLB A;  3MK7 C;  5LGT B;  1LKX A;  5AFN A;  4EZ1 A;  2JIW A;  5AQF B;  3K1S A;  4DR2 T;  2LJL A;  2V7J A;  2JQH A;  3E22 E;  3VRB A;  4EB6 E;  5ADX L;  4P1N A;  4L9I A;  3O1I A;  4HWF A;  5AFM B;  1KEY A;  2BG9 C;  2WDR A;  4LFB T;  4CQI A;  4EIW A;  5FMN A;  4ZXL A;  5FVK A;  3HL6 A;  2WSS V;  1MIW A;  3I0Q A;  2JMH A;  3IGQ A;  1U4Q A;  1MMD A;  4LF9 T;  1XWM A;  2A9U A;  2W63 A;  2HHH T;  3PUR A;  4ZEY A;  1XZY A;  2H3R A;  3PV0 F;  4IDQ A;  3VKG A;  2V5D A;  2E8I A;  4JI1 T;  4L5G A;  5J5I A;  5AQL B;  2XAF B;  3WTO A;  2W0G A;  2H89 A;  5J5H A;  5LGU B;  4YFS A;  2Y7Y A;  4CXX A;  3M65 A;  2BYQ A;  1X79 A;  3O1J A;  5JDF A;  3FZK B;  4A5X A;  5J1G A;  1KNP A;  3QOF A;  2BR7 A;  3DP7 A;  5FP3 A;  2LM9 A;  3AA6 B;  3F2E A;  4DUZ T;  1Y01 A;  1FIO A;  3OBV E;  1XMO T;  5KX5 E;  1HG5 A;  2YOE A;  2JPF A;  4X5T A;  3UU4 A;  2E9X B;  3AED A;  4H9N C;  4UF0 A;  1IAP A;  4G63 A;  2LM2 A;  1HNX T;  4KI0 F;  3LBX A;  3HR0 A;  3WIP A;  2JMK A;  1QUU A;  4DR6 T;  5FXX A;  1FEW A;  3N9P A;  4LML A;  3LFM A;  2X67 A;  2BYS A;  1G73 A;  5AQG B;  1HX1 B;  4JI3 T;  4PIR A;  1ZHC A;  5HWY A;  5CFB A;  3EVY A;  3PJA J;  2M6I A;  3PUV F;  3KV9 A;  2X0Y A;  1KNZ A;  2HPL A;  2ZM8 A;  1KFY A;  4H9Q C;  5ETW A;  3GUA A;  2I59 A;  3R6N A;  5HEG A;  2ODV A;  3F31 A;  2BBH A;  4ZI7 E;  4OX9 T;  1SUM B;  2X9W A;  2WDV A;  4I55 E;  4MAL A;  4GYR A;  4OFZ A;  2CEA A;  1XNQ T;  1JNR A;  1ZP0 A;  4X20 E;  3N9N A;  1GQE A;  4M1P A;  1SA0 E;  1T8B A;  4ZHQ E;  5F3J A;  5LGN B;  5IUX A;  3RF1 A;  2ZJU A;  2I0M A;  4DBQ A;  4QH5 A;  4LF5 T;  2CE7 A;  5CGM A;  1XMQ T;  2HH7 A;  5BMV E;  5AQU B;  2WB5 A;  4ASK A;  2EHO A;  1NAF A;  4X65 T;  4UM3 A;  4UEL A;  2LSK A;  2XNT A;  5AQS B;  3UQ7 A;  5LCY A;  2C5I T;  4A98 A;  3CWZ B;  4NIQ A;  2BYR A;  3HA4 A;  1HF8 A;  2UU9 T;  1US7 B;  4PFO A;  3UT5 E;  4MBQ A;  5ABF A;  4YSX A;  2XQ5 A;  4HWC A;  4WBO A;  3ZMS B;  4HEA A;  4NUV A;  2G0U A;  2IW5 B;  3J7Y q;  5KE4 A;  2W8F A;  2Y58 A;  3PJA A;  1UX2 A;  2J62 A;  2XSA A;  2KZ7 B;  4PFP A;  3ONL C;  4KMC A;  2X9X A;  4AKR B;  1QSD A;  5FXZ A;  1YQ3 A;  3QNU A;  3BQL A;  4TWD A;  5L47 A;  4ZI3 D;  3IA3 A;  2XSB A;  3IF8 B;  2W66 A;  5LB7 B;  2VKH A;  4ERR A;  4JI5 T;  2BS4 A;  4ZJS A;  4YSZ A;  2V26 A;  3N5L A;  4L0R A;  3M3Z B;  2UUC T;  3UU3 A;  4OYK A;  3SRZ A;  5AQP B;  2V5C A;  3RKO A;  3P4S A;  3ABV A;  2NTY A;  3O1H A;  2YDQ A;  3C98 B;  4AFG A;  2WDQ A;  3CQG B;  2XQA A;  4IHJ E;  5LA6 E;  4BA9 A;  2LLY A;  2OLT A;  3PUY F;  3UUX B;  4QAB A;  2KIN B;  2KSR A;  3AXJ B;  3UQ4 A;  3ZT6 A;  4MHC A;  4GYS A;  3ZDH A;  3N9M A;  5LHI B;  3UU5 A;  1B7T A;  3PEO A;  3FHN A;  4ZZB A;  4IGU A;  2BR8 A;  4UXN B;  2BKO A;  3TLS A;  2D5U A;  4O8S A;  4CXW A;  2CA5 A;  4JYA T;  1FJG T;  3HKC E;  1T72 A;  3UUM A;  2PFV A;  1J1J A;  2Q9Q D;  1HG2 A;  1FMV A;  3CQX C;  4QAC A;  1BR4 A;  4N78 D;  2XUE A;  4YHJ A;  4DMV A;  3C4Z A;  2XZ6 A;  1UUR A;  2LSG A;  3ZT5 A;  4ILC A;  5HEU A;  4UM1 A;  2MYS A;  4X66 T;  3ZCI A;  3O4X E;  5F8P A;  4JLE A;  3Q5X A;  3RGL A;  4ANJ A;  1J5W A;  5C8Y E;  4U31 A;  2XAS B;  3N9Q A;  4YT0 A;  4UIG A;  1MIY A;  2MPK A;  5JDN A;  3CIR A;  1S94 A;  1W0A A;  4ZZC A;  3ZT7 A;  2X00 A;  4MFR A;  3DJB A;  5HEH A;  4KHP T;  2DI4 A;  2XQ4 A;  1I6Z A;  3KBT A;  2H7V C;  2VVN A;  3JCF A;  3PE0 A;  3G06 A;  5KZU A;  3PU8 A;  5LOV E;  2CMR A;  1U5P A;  5J0Z A;  4DV1 T;  4PJL A;  2XM1 A;  2QC1 B;  2L9Q A;  3VHL A;  2CLY C;  2C5K T;  5FY0 A;  4QKN A;  4IIJ E;  4HWD A;  2CBJ A;  3KV4 A;  2BG9 B;  5EK3 A;  3ZCJ A;  2A72 A;  3T8O A;  5JTG A;  3AAE B;  3MJX A;  4YTN A;  2BYN A;  5L3E B;  1IBK T;  4PJJ A;  5L4E A;  3R84 B;  4F6R C;  1X9B A;  4DR4 T;  3LSV A;  2XAH B;  2UXB T;  3RI5 A;  5JVD E;  4UR9 A;  3PUQ A;  3CKD A;  2VUR A;  3E0Z A;  4HWI B;  4QAA A;  2V1D B;  2UZ6 A;  4Z8X A;  3I9Y A;  3P4Q A;  4O4J E;  5JDM A;  2VK9 A;  5JR9 A;  2X9Y A;  1UGO A;  3Q2M A;  2WBL A;  4IST A;  1N34 T;  1V9D A;  4WW0 A;  1VCS A;  2HPJ A;  3FB2 A;  3WTK A;  1W09 A;  3WAJ A;  2KT9 A;  4CI1 B;  5LBQ B;  3L8R A;  3V5S A;  3AEG A;  2IC9 A;  4WYV A;  1KK7 A;  1VRB A;  1OXZ A;  2V8S V;  3VRA A;  5AQQ B;  3AE5 A;  4X62 T;  1MMA A;  4H9O C;  1YKE B;  3FZM B;  3NWI A;  2XHE B;  3TLW A;  3RHW A;  1D0Z A;  1WR6 A;  2WNL A;  3RH3 A;  1NWM X;  4TV9 E;  4DID B;  3WTM A;  4F8H A;  1YQ4 A;  2BBJ A;  3MXZ A;  3CML A;  2EHO C;  2UUB T;  3U3I A;  5DQW A;  3UFG A;  1UX5 A;  4QHO A;  2WZH A;  5HXS A;  3DTO A;  1OED A;  2UXN B;  2E2A A;  5FKY A;  3HKD E;  1YKH B;  2XM2 A;  2QVA A;  2WWU A;  2K3W A;  3C4X A;  3ONX A;  4UVA B;  3AVS A;  1HTJ F;  1T7S A;  4G2A A;  2WM9 A;  1ZV4 X;  4IE6 A;  2CXF A;  4Q25 A;  4IRE A;  4YJ3 E;  4DV6 T;  4H9S E;  5LMU T;  4B3T T;  1E7P A;  3C84 A;  3K8P C;  5AFK A;  5TAO A;  4IE7 A;  3AE9 A;  5ABE A;  3GA8 A;  3LDQ B;  2KWH A;  2C5J A;  5FVL A;  3P4R A;  5LJN A;  4TUY E;  2ZM2 A;  4P0B A;  4XZC A;  5HAX A;  2QA7 A;  3P7I A;  2VAS A;  1UX4 A;  2M67 A;  2JRK A;  3RRW A;  2V6Y A;  3CX6 B;  2FUP A;  2CPT A;  2CHO A;  4QH4 A;  4TNV A;  2XQ8 A;  3UUN A;  3U78 A;  3SQ9 A;  5HWX A;  4PJN A;  2VWA A;  3KDS E;  2Y56 A;  2OA5 A;  5ABH A;  4AXP A;  4PK6 A;  1SHZ C;  2VKJ A;  5HEO A;  3OPC A;  5LJM A;  4IL4 A;  4CN1 A;  4ILU A;  4LF7 T;  4U7I A;  2W8G A;  2YDS A;  3RX6 A;  3SQ6 A;  2PTF A;  1HNZ T;  3AEB A;  4QX8 B;  2IC6 A;  4LF8 T;  2LOP A;  4DBR A;  2B76 A;  2C9T A;  1CUN A;  3W15 B;  2ZM0 A;  5JME A;  4DV5 T;  2X00 D;  3SFD A;  3OYZ A;  2LEH A;  5JRC B;  3S4U A;  1HX8 A;  5IWA T;  2W4X A;  5DJQ C;  4TNW A;  2K5B B;  5JQG E;  4AKI A;  4E7Z A;  2VKD A;  5AQO B;  4XBF B;  2BKN A;  5EK2 A;  3L09 A;  1BR1 A;  4KP3 C;  3TLU A;  5LXT E;  1M62 A;  3CPZ A;  2N2N A;  4B3S T;  2H7O A;  4BJN A;  1DU2 A;  3SFE A;  2W00 A;  2C0S A;  4JUY A;  3ONJ A;  5A1L A;  2KLQ A;  2BS3 A;  4ZK4 A;  1H7C A;  4JI2 T;  4KX6 A;  4QXB B;  4H9R C;  2V7M A;  3E08 A;  4LFC T;  3PU3 A;  3RIA A;  4CI2 B;  3KVA A;  2FJE A;  4X1Y E;  2DCF A;  4V1A v;  2Y57 A;  2XAG B;  5FNV E;  3FBL A;  1WRD A;  2K9A A;  3ZLI A;  2XZ5 A;  4DV2 T;  5KDM C;  4PAG A;  2J1D G;  2WU2 A;  4U2Z A;  2QGS A;  2Q9Q B;  4H63 H;  4YLH A;  3UUL A;  5CA0 E;  5FJV A;  4DR3 T;  5GON E;  1CHU A;  1O3X A;  1HFA A;  3WAK A;  1T98 A;  1J5E T;  2VL8 A;  3ZMZ B;  4PJM A;  2E5V A;  3OVU A;  4UEM A;  3PMZ A;  3FXD B;  3A7M A;  3SS1 A;  3X1D A;  5CO5 A;  1R8I A;  1ZEE A;  4HWH A;  2V6X A;  2XQ7 A;  2WP9 A;  5CB4 E;  4WZX A;  3WTH A;  1XDO A;  4BFQ A;  3GWH A;  2OV9 A;  5LYJ E;  2VVS A;  4YTP A;  4HFB A;  5LP6 E;  1E2A A;  2PBI A;  4DV4 T;  5HYA A;  5JR9 C;  1M7K A;  2QYW A;  2WMO A;  3JC6 C;  3ZPO A;  2E9X C;  2DWK A;  3RQW A;  4X64 T;  4DV0 T;  2D0T A;  4AQY T;  1HNW T;  3SOL A;  2RP4 A;  4ZK1 A;  4XAX B;  4TV8 E;  4KBM B;  5ABG A;  4UF0 B;  4H63 V;  4LMK A;  5FY7 A;  1HS7 A;  2BKP A;  3LBX B;  4AKH A;  1NEN A;  1W9R A;  2ZMA A;  3I0O A;  4P0A A;  5TVC A;  3L39 A;  4A56 A;  3RC8 A;  3LK2 B;  1WYC A;  1OED E;  4EED A;  3QB5 K;  2PG8 A;  2JQK A;  1KNR A;  4DBM A;  2M6B A;  4OK0 A;  2DL1 A;  5KXJ A;  4P09 A;  3AE6 A;  5AQM B;  1D0Y A;  2DLR A;  3P4P A;  3KV6 A;  4I0U A;  1OED C;  5HXH A;  3FZL B;  4AKG A;  4AIU A;  2YIN A;  3AE1 A;  2PGZ A;  2V7K A;  2R6G F;  5SYO A;  5JH7 E;  3RKG A;  4ILB A;  1Y64 B;  2WMN A;  5HXR A;  4JI6 T;  3AE3 A;  3LG7 A;  3U8N A;  4X1I E;  4CXY A;  3KFW X;  2BJ0 A;  4C91 A;  2BYP A;  1JNZ A;  3RIF A;  2XQ6 A;  5AFM A;  1IJ5 A;  4ALX A;  2ZLY A;  2YN6 A;  3EDU A;  2EHO B;  4HGA A;  2JQQ A;  2XNV A;  3UTK A;  4FJO A;  4TWF A;  5L3F B;  3VKH A;  5L4H A;  2NP9 A;  2X9H A;  2IML A;  3EDV A;  2NOX A;  4YJ2 E;  2L8K A;  1LRZ A;  2UUA T;  2LKH A;  4BQT A;  2WZI A;  3N2O A;  4HFD A;  3UU8 A;  4DR1 T;  5FYM A;  4H9P C;  1EZ3 A;  4EEB A;  3L3P A;  5LBM A;  4B6X A;  3C51 A;  4DV7 T;  3T1Y T;  4FRR A;  1G8X A;  4JEU B;  3IHR A;  4UV9 B;  2CHN A;  4JBW F;  2B1E A;  4DVD A;  1IBL T;  4YXD A;  3IBP A;  2H88 A;  1BR0 A;  4ZRU A;  4NPP A;  4ADZ A;  3EAM A;  3VU7 H;  5IHY A;  5LXB A;  2A2F X;  2CWY A;  2E9X A;  1N33 T;  1XNR T;  5HCJ A;  2NW7 A;  5LG4 A;  3TKL B;  3WTN A;  2YDR A;  1VCT A;  1MNE A;  5JDH A;  1UK5 A;  3U8L A;  3AE4 A;  5JDL A;  3LK3 B;  2UXX B;  3RIU A;  4EXT A;  2X0H A;  4B5D A;  3Q9D A;  1YW0 A;  3ZEF B;  4HE8 A;  3ZN1 B;  1MIV A;  3N2K E;  2V7I A;  2WZY A;  1UCU A;  2UXD T;  3RLF F;  2XQ3 A;  4CI3 B;  3ZYM A;  2EHO D;  3CK6 A;  2RA1 A;  4X1K E;  3H3M A;  5J5F A;  3UUB A;  1ZKE A;  3B5M A;  5HXE A;  2X68 A;  2LSJ A;  4UV8 B;  2XYS A;  4IDO A;  3Q5W A;  3NVO A;  3U8K A;  5EZY E;  3AEA A;  2LOS A;  2P9B A;  2D2S A;  3PUG A;  4K0U A;  4MLK A;  5J2U E;  1UW6 A;  3K3N A;  4B3R T;  2DNX A;  4HFV A;  2WWV A;  2LSI A;  3BQK A;  5FL1 A;  2WS3 A;  2RPA A;  2J4G A;  3NRX A;  3AE2 A;  3ZYK A;  1XDP A;  5AQI B;  2FJB A;  4AIS A;  2WN9 A;  3GN5 B;  2W62 A;  4GK5 E;  3AEF A;  4JV5 T;  3WTL A;  2CCQ A;  3ZN0 B;  4COF A;  2ODU A;  3N9L A;  3QB5 A;  2FJA A;  2MAW A;  2Q9Q A;  5AIN A;  5L3B B;  4QWN B;  5H6R B;  3K3Q C;  3KV5 A;  5AQT B;  2PH9 A;  5HEJ A;  1D1A A;  3RQU A;  4C90 A;  2LSY A;  5C3J A;  4ZOL E;  3PTR B;  5FY1 A;  2X51 A;  4IDP A;  4AFH A;  4IE5 A;  1ZOY A;  2D9D A;  4PW8 A;  4BJM A;  3FBZ A;  3RPU A;  2N1G A;  4BAY B;  3JAD A;  5H6Q B;  4NZB A;  3KIN B;  2WNJ A;  2LHR A;  4WNK A;  3A5X A;  4DND A;  3NZP A;  3ESL A;  3P50 A;  3AEE A;  2YU1 A;  3AA0 B;  1WFD A;  3EAB A;  3RYH E;  3CX8 B;  3NBX X;  4IE0 A;  5LNK A;  2W67 A;  4LF6 T;  4YTM A;  5BR8 T;  2XTL A;  2XPK A;  4QXH B;  3PUW F;  1UV6 A;  1AJ3 A;  4HFC A;  2NW9 A;  4CN4 A;  2ZM6 T;  4ZS2 A;  1WLX A;  2F4V T;  3AE8 A;  2ACX A;  4OYJ A;  5AFU L;  3HKB E;  2LE8 A;  3AEC A;  3AXJ A;  4Z91 A;  3C50 A;  5JR9 B;  2MBG A;  2BS2 A;  4I4T E;  3ETV A;  4U72 A;  1SE7 A;  5C2T A;  3SWH A;  2Y8D A;  3D0T A;  1LVF A;  3ZYL A;  4DUY T;  2L3L A;  3MA9 A;  4GKJ T;  1I9B A;  2BDE A;  3ZMV B;  2NTX A;  3N9O A;  3UFE A;  2CRB A;  1I94 T;  5AQV B;  5J5G A;  3P4W A;  2UXC T;  2W61 A;  3H37 A;  4EGW A;  2PJQ A;  2NR4 A;  2IAK A;  3AA1 B;  4HKA A;  2IIU A;  4QX7 B;  4I50 E;  3RC3 A;  4AI6 A;  3FZF B;  3MKD A;  5AQK B;  4IL9 A;  3TLV A;  3P8C D;  3ZST A;  3AVR A;  3SIO A;  4DR7 T;  2XAQ B;  3FZH B;  4UVB B;  3ANW B;  1YXR A;  4AQG A;  2VL0 A;  4U74 A;  3CX7 B;  2NWB A; 
#chains in the Genus database with same CATH homology
 4QH1 A;  5FJV A;  3IGQ A;  1OED A;  5CFB A;  5HEO A;  5TVC A;  5BW2 A;  2M6I A;  4QAA A;  4HFI A;  4TWD A;  5L47 A;  4HFD A;  4IL4 A;  3C79 A;  3UU8 A;  2UZ6 A;  4A97 A;  2ZJV A;  3U8K A;  3ZDG A;  1OED E;  3JAF A;  2W8G A;  4UM3 S;  3GUA A;  3EHZ A;  3SQ6 A;  5AFH A;  4HFE A;  5HEG A;  1UV6 A;  4ZJS A;  4HFH A;  4HFC A;  4ZJT A;  5J5I A;  5BP0 A;  1OED B;  2YME A;  4FRR A;  4ZR6 A;  1UW6 A;  4DBM A;  3PMZ A;  2Y54 A;  2M6B A;  3WTI A;  3TLT A;  2C9T A;  4IRE A;  3WTO A;  3UU3 A;  4ZZC A;  5CO5 A;  5HCM A;  5JME A;  2X00 A;  5LG3 A;  5BRX A;  3ZKR A;  2XQ7 A;  5HEH A;  2X00 D;  3C84 A;  4AFT A;  5J5H A;  5AFK A;  4WV9 A;  4Z91 A;  2Y7Y A;  4AFG A;  1OED C;  2BYQ A;  3WTK A;  2XQA A;  2XQ4 A;  2WN9 A;  3WTH A;  4ZRU A;  4NPP A;  3EI0 A;  2YMD A;  4TNW A;  3U8J A;  4BFQ A;  2LLY A;  3EAM A;  5IUX A;  3WTL A;  4HFB A;  5KZU A;  2PGZ A;  5SYO A;  2ZJU A;  4COF A;  4QAB A;  4ILB A;  5LXB A;  4QH5 A;  3JAE A;  2BG9 A;  2KSR A;  1I9B A;  5HCJ A;  4HQP A;  2MAW A;  4TWH A;  5AIN A;  2BR7 A;  5AFJ A;  3UQ4 A;  3WTN A;  4ILA A;  5J0Z A;  2XYT A;  2PH9 A;  3ZDH A;  4UM3 A;  4UY2 A;  5J5G A;  3U8N A;  3TLU A;  3P4W A;  2QC1 B;  3UU5 A;  2XNU A;  4UM3 P;  5HEJ A;  2BG9 E;  2BJ0 A;  3RQU A;  3PEO A;  4ZZB A;  3U8L A;  2XNT A;  4XK9 A;  2YKS A;  2BR8 A;  2BYP A;  3UQ7 A;  3WTJ A;  5AFL A;  3TLS A;  4A98 A;  2BYR A;  2XQ9 A;  3RIF A;  2XQ6 A;  4B5D A;  4D01 A;  5AFM A;  4LMJ A;  4ZK4 A;  3RQW A;  2LKG A;  2YOE A;  4ALX A;  4X5T A;  3UU4 A;  2BG9 B;  4XHE A;  4AFH A;  2YN6 A;  4EZ1 A;  5AFN A;  3TLW A;  3RHW A;  4UXU A;  2WZY A;  2LM2 A;  3U8M A;  3RIA A;  4ZK1 A;  4QH4 A;  2WNL A;  3WIP A;  2XQ5 A;  2BYN A;  4TNV A;  4QAC A;  2XQ3 A;  2XQ8 A;  4IL9 A;  3TLV A;  5L4E A;  2Y57 A;  3SH1 A;  3WTM A;  3SIO A;  3SQ9 A;  3T4M A;  5AFM B;  4F8H A;  2XNV A;  2W8F A;  2Y58 A;  2BG9 C;  5KE4 A;  3LSV A;  5J5F A;  4LML A;  4Z90 A;  4TWF A;  1UX2 A;  3JAD A;  2XZ5 A;  4NZB A;  2XZ6 A;  3RI5 A;  3UUB A;  5L4H A;  4LMK A;  2WNJ A;  2BYS A;  2Y56 A;  4ILC A;  4PIR A;  2VL0 A;  3P50 A;  5HEU A;  2LKH A;  2WNC A;  4UM1 A;  2XYS A;  4BQT A;  3UU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...