4ILCA

The glic pentameric ligand-gated ion channel in complex with sulfates
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ilcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ilcA01
3U8LA 1UW6A 4QACA 5CFBA 2XNVA 3ZKRA 4AFGA 2KSRA 3RHWA 4LMJA 4UXUA 3PMZA 5J5IA 2XQ8A 4QABA 2BYQA 3IGQA 5AINA 4WV9A 5AFKA 5TVCA 5BP0A 2Y57A 4UM3S 2BG9A 3SQ9A 3RIAA 1UX2A 3EAMA 3SQ6A 4ZJTA 3RQUA 3GUAA 2WNLA 5J5GA 4B5DA 4XHEA 2BG9E 2M6IA 4ZR6A 2Y56A 4ZK4A 5LXBA 3TLTA 2WZYA 2WN9A 3JADA 5LG3A 2LKGA 3LSVA 2ZJUA 2C9TA 3TLWA 5HEJA 2YN6A 2BJ0A 3UU3A 5AFMB 5KZUA 4TNVA 5FJVA 2LM2A 4ZK1A 5AFNA 3UU4A 4LMKA 3WTHA 3JAEA 3ZDGA 4HFDA 4QH1A 4Z91A 5HCJA 3U8JA 5KE4A 4LMLA 2YKSA 4HFEA 4IL9A 4QAAA 4ILCA 5AFHA 5J5HA 2LKHA 3RQWA 2BYSA 2Y54A 5BRXA 3UU6A 2WNJA 4AFHA 4EZ1A 1UV6A 2M6BA 5AFLA 5L4HA 4IREA 3EI0A 4A97A 2BG9C 2BG9B 2XQ5A 4HFIA 4NPPA 2VL0A 2PH9A 3C84A 2YMDA 1OEDA 5HEOA 4QH4A 3P50A 4X5TA 2BR8A 2BYNA 4ZRUA 2XZ5A 3WTMA 2XNUA 4TWFA 4NZBA 3WTLA 3UQ4A 3JAFA 5AFJA 4UY2A 3UU5A 3TLSA 1OEDE 4FRRA 3WIPA 2XQ3A 2W8GA 2ZJVA 4ZZBA 3U8NA 5L47A 4DBMA 3U8KA 2XQ4A 4TWHA 3RI5A 4UM1A 5JMEA 5CO5A 3T4MA 3TLVA 3WTIA 3U8MA 5HCMA 5HEUA 4PIRA 2XYSA 2MAWA 3ZDHA 4BQTA 2Y7YA 2WNCA 3TLUA 2XQAA 4AFTA 3EHZA 3UUBA 4IL4A 3P4WA 2XNTA 3WTJA 4QH5A 2X00D 2XQ6A 4BFQA 3WTOA 3C79A 4HQPA 4HFHA 5HEGA 4Z90A 2LLYA 2XZ6A 2XQ9A 2Y58A 4TNWA 3SIOA 3SH1A 3WTKA 1OEDC 1OEDB 3RIFA 5J0ZA 4TWDA 4ZJSA 2BYRA 2UZ6A 2YMEA 2YOEA 4ILAA 4A98A 5HEHA 4F8HA 4ALXA 4HFCA 4UM3A 2BR7A 4COFA 4D01A 5J5FA 5AFMA 2BYPA 5SYOA 5BW2A 2XQ7A 4XK9A 3UU8A 3UQ7A 2W8FA 2XYTA 5L4EA 4UM3P 2PGZA 4ILBA 2QC1B 1I9BA 2X00A 3PEOA 4HFBA 3WTNA 4ZZCA 5IUXA
chains in the Genus database with same CATH superfamily
3DTOA 4AFGA 4UXUA 4AIUA 3FXEB 2WWVA 4DR4T 3VRBA 4AQFC 4ZJTA 3RQUA 3BQLA 3AE3A 2WNLA 5CA0E 2J4GA 3L39A 2Y56A 4IE4A 2BKOA 4HWDA 2X66A 2NTXA 3AA6B 2UXDT 3IBPA 2BYSA 5BRXA 4EYUA 4DR2T 2JJ9A 2ZLYA 3ZMTB 3T1YT 3FB2A 4J2CA 2BYNA 4H9RC 3ZYKA 1HR0T 3C4ZA 4ZI7E 2ZJVA 4UELA 4C91A 3SWHA 4X64T 5A1LA 4QHOA 1YXRA 4CZZB 4EXTA 1VCTA 2CWYA 2V6YB 3PV0F 2UXCT 5HXSA 4DMWA 4TWDA 4ZJSA 4TV8E 2V7KA 5JTGA 2KXPB 3RH3A 3ZYLA 5H6QB 4EB6E 4E7SA 4O2BE 5LGTB 4EOZB 4MFRA 1VOMA 3KDSE 2C5KT 4KP3C 4B6XA 4E7ZA 2BYQA 5AINA 2DLRA 4YTPA 4L0RA 1MMGA 4ERRA 4UIGA 2GK9A 3O4XE 3PUXF 4O4HE 5J5GA 3AE5A 3F31A 3MK7C 3PUVF 4LF4T 4DR3T 1MIWA 2VQET 2SPCA 3AEGA 4TNVA 3I0QA 3VHLA 1E1HB 1FMWA 4IL9A 2ZM0A 3F2EA 3AAEB 1S35A 4FJOA 5FKYA 3J7Yq 3EUHA 1VCSA 5HEOA 1Y64B 1LRZA 1Y01A 2D5UA 3N9NA 5AQQB 3UQ4A 4H9OC 3LJCA 4QWNB 2LSIA 3MA9A 1N33T 3CX6B 1MMAA 2X68A 2F4VT 3RRWA 3TLVA 1OWAA 5LNKA 1XNQT 4H9SE 1D1AA 4BQTA 2E8IA 1XNRT 3WAJA 2CXFA 2LSGA 2KWIB 3GA8A 4YFSA 4HQPA 5FXZA 2RPAA 4DMVA 1OEDC 4ASKA 3KV5A 3K3QC 3OYZA 2K9AA 2XQ7A 4XK9A 1QSDA 5L4EA 4ILBA 4DV2T 1IBMT 5HAXA 2N1GA 3LBXB 5JRCB 2QA7A 3M65A 2C0SA 3SQ9A 5F8PA 4A5XA 2XAFB 1YKEB 4JYAT 3AEFA 3LDQB 1WFDA 2YN6A 4OX9T 2WM9A 4QH1A 2N9DA 2EHOC 4CXWA 3A5XA 4YTMA 2KINB 2LE8A 2WNJA 2NWBA 2XJ7A 5HYAA 2KMFA 4NPPA 2J47A 4KX6A 4V1Av 2ZM8A 4LFCT 2XM2A 2H89A 3WTLA 3WIPA 2Y8DA 4GKJT 3U8NA 2LRLA 4TWHA 1M7KA 3QNUA 2IW5B 2WS3A 1JNZA 1SHZC 2KT9A 3NKZA 4ZI2C 4KUMB 2CWOA 1U5PA 3BK9A 3UFGA 4F6RC 4Z90A 2LLYA 4TNWA 5ABHA 3N9PA 4WBNE 1HFAA 2V7MA 2YOEA 3BQKA 1U4QA 4UM3P 5AQMB 4AXPA 4LF5T 2AXDS 4ZXLA 3UUNA 3SS1A 3PUGA 3E08A 3MZKB 1NENA 1HTJF 2XQ8A 1T7SA 5AQSB 2Y57A 3P4RA 4UVAB 3TKLB 2WY2A 1UX2A 5FL1A 3HKBE 2BZBA 2BKPA 4GOUA 5LG3A 1NEKA 3LSVA 4U72A 2LM2A 3OKQA 3NBXX 4TZ4C 4YSZA 2NW7A 4G63A 1EZ3A 4ILCA 2FJAA 3NZPA 4WNKA 2A9UA 5FY0A 3UU6A 5AFUL 4LF8T 2W61A 4CN4A 2E2AA 4UVBB 5JR9A 1B7TA 4X5TA 2LSYA 3G06A 2D2SA 3ONXA 3PTRB 2X9WA 4OFZA 3PURA 3AA7B 2ACZA 4OK0A 3ZMSB 5JMEA 1ZOYA 5HEUA 1I94T 5AQTB 4UF0A 2CHNA 3RGLA 4DV5T 1W09A 5JDLA 2XPKA 3RKGA 4KHPT 4QXCB 1KNPA 3I9YA 4ILAA 3ETUA 2JQ9A 3B57A 4YHJA 5SYOA 4AI6A 3KV9A 2PGZA 5L3EB 1YD8G 4G2AA 2WCAA 3ZMVB 4ZZCA 3PUZF 3AEDA 1UW6A 4EGWA 2V7JA 3C51A 2KSRA 5FXVA 4QABA 2MTQA 5JDGA 2BG9A 3RC3A 1ZKEA 2FUPA 2UXNB 1D1CA 4B5DA 4OYKA 2LHRA 4ZHQE 4X66T 4AKRB 2K5BB 3K3OA 2LOSA 2ZJUA 3AECA 3ZCIA 4A56A 2H88A 4UXNB 3ABVA 2CMRA 2C5JA 2VURA 2NW8A 2X51A 2QYWA 2IUBA 2Y54A 2KWHA 4EEBA 1UK5A 3CMLA 2DCFA 2M6BA 3D0TA 4BJMA 3OTOT 4CN6A 3UTKA 1ZP0A 4HFIA 5J1GA 2BR8A 2FJBA 4ZEYA 5AFJA 3O9XA 2CEAA 1WLXA 4PW8A 2VL8A 4DBMA 4I43B 1YW0A 4CXXA 5IWAT 3W15B 3U8MA 5HCMA 4AKHA 3U3IA 3EHZA 4I50E 2X00D 4EEDA 2EHOD 2XZ6A 2Y58A 2V5DA 4LF9T 1GQEA 2FBWA 2W62A 4B3ST 4IE5A 1IJ6A 4X20E 2XM1A 4XBFB 3HR0A 4PK5A 3PEOA 3EABA 3U8LA 1UCUA 2CM0A 4B3RT 3B13A 5DJQC 2WZIA 4QXBB 2RA1A 1DU2A 3EDVA 2B1EA 2JQQA 2XASB 4DBQA 4UV9B 4CI2B 1IBLT 3JADA 3J9X1 4ADZA 2X9YA 5DABA 5FJVA 2CA5A 5KX5E 1SA0E 5LJNA 3ZC0A 2RP4A 3Q5XA 3L09A 2YU2A 5FXXA 3PU8A 4PAGA 5KMGP 2XUEA 4JBWF 5AFLA 3KVBA 3PUWF 4P1NA 3C84A 2PBIA 2YMDA 4ANJA 4I0UA 3UT5E 1XMQT 2H7VC 5TAOA 4TWFA 3ZN0B 4JEHB 1N36T 4XZCA 5LGNB 3LK2B 3ZJ1A 2XAHB 2LRKA 4I55E 3ZDHA 1HG2A 4DR5T 1WR0A 3EDUA 3WI3A 3LK3B 4GYSA 3WTOA 2XSAA 2BBHA 3UUMA 2XQ9A 1OEDB 4HTEA 2JIWA 2YK0A 3KV4A 3PUAA 4PK4A 2DNXA 2W8FA 5CA1E 2N2NA 4HFBA 2YDRA 1MMNA 5IUXA 4EZ4A 4HE8A 5CFBA 5J5IA 5HWYA 4K0UA 5TVCA 4UM3S 2LHNA 5CJ5A 3E0ZA 3LK42 4X1IE 5EK2A 5LXBA 2UXBT 2C9TA 5AFMB 2LEHA 3C4XA 2UUBT 2EHOB 3DP7A 5J5HA 5LBMA 4YY3T 5LCYA 3CIRA 2D0UA 2V1DB 3R84B 2HN2A 2FJDA 5JDMA 2VL0A 5LGUB 5ADXL 5E0OA 4NZBA 4DBRA 5FL0A 4NXNT 4P0BA 1XZYA 2V8SV 3HL6A 4O2AE 2DWGA 2IDOB 5AQKB 1G8XA 4BJNA 3N9OA 3I1AA 4DR1T 3UUBA 2OA5A 4IL4A 3H3MA 4ILUA 3VKGA 3OJAA 4QXHB 1T8BA 4L5GA 5ABFA 1WYBA 3WTKA 5JR9C 4IE7A 4UVCB 5CB4E 4ALXA 3AXJB 3CQCB 2WBLA 2UXXB 1MIYA 3GN5B 2VVSA 2W00A 2IHR1 3MACA 4IDNA 4U3CA 5HWXA 4QACA 3P4SA 5FY7A 4IGUA 3Q5WA 1I6ZA 2BS2A 4JI5T 1KFYA 3EAMA 5JH7E 3CPZA 4MLKA 3ANWA 3S4UA 2LOPA 5FY1A 4AKLA 2D0TA 3RIUC 5AFNA 2MPKA 3ZDGA 2V26A 4CQIA 5HCJA 4LF7T 4GK5E 4QAAA 4N78D 3R6NA 5GONE 2AE9A 2K24A 1UV6A 4GYRA 3SFEA 3SFDA 4ISSA 3AE8A 2BG9C 3OYXA 4PFPA 2X0HA 2ODUA 3L3PA 3P50A 4AQFA 3ZEFB 3E22E 1J5WA 4UY2A 1OEDE 3N9QA 1XDPA 2XQ3A 2HPLA 4WBOA 3ZN1B 2XQ4A 1T72A 4CI1B 3GWHA 1LKXA 2R6GF 4DO0A 2IIUA 1XDOA 5L3FB 4YXDA 1AJ3A 3K8PC 3ZMUB 1UX5A 5HXEA 2YU1A 2XHEB 4QH5A 3T8OA 2XQ6A 2I6HA 2LSJA 3C79A 4HFHA 2XZEA 3N9LA 2Q9QA 3CQXC 3RIFA 3AVRA 3PE0A 2WDVA 4PJLA 3IF8B 2ES0A 4AKGA 2BR7A 4D01A 1KEYA 2NW9A 3I0OA 4YJ2E 5ABEA 1KNZA 1BR2A 5C8YE 2NOXA 1MNEA 3JC6C 4JI7T 2IC9A 3KBUA 3HKDE 5BP0A 1CUNA 3RYCE 1SE7A 2YDQA 4UR9A 5AQVB 4NUVA 1IZNB 2M6IA 1ZHCA 2HPJA 2Y48B 5HXCA 3KFWX 3ZYMA 1UX4A 5HEJA 2E9XA 3T1HT 4B3TT 4GKKT 4YTNA 2D9DA 4P0AA 4DUZT 3RQWA 2JPFA 2DWKA 3PUSA 5EK3A 5L2LA 3RLFF 5BR8T 3PU3A 2MBGA 4JI3T 2CE7A 2DHRA 4UV8B 1W9RA 2V6XA 1E2AA 4ZRUA 1LVKA 4HGAA 2X67A 3LG7A 4IDPA 2UUCT 5LHHB 1QUUA 3ZT7A 4MHCA 3MJXA 2WMOA 4H9NC 5L47A 5M4YA 3U8KA 2CCQA 1HG5A 3IA3A 5CO5A 5BMVE 4QKNA 3WTIA 1N34T 3TLUA 1WCRA 2KNDA 2YINA 5LA6E 3P8CD 5J0ZA 1UURA 5HEHA 5AQGB 3ZSSA 2WZHA 2L3LA 1HNXT 1OXZA 5LHIB 1V9DA 4WZXA 2OLTA 4CN1A 4YSYA 5HXHA 2VB6A 3K1SA 1WYCA 5LOVE 5AQUB 3AAIA 3FZKB 3FZFB 2DI4A 5LMUT 4ZK4A 2YDSA 3TLTA 4CXYA 5KZUA 4B3MT 3C50A 3JAEA 4HFDA 4EAHA 2VKJA 5KE4A 2WP9A 4HFEA 4X62T 1XMOT 2LKHA 1UGOA 3C64A 4EZ1A 3CX7B 2V6YA 4U7IA 3WTMA 1Z8UA 5LYJE 5J2TE 1YQ3A 3ZJ2A 2Z6EA 2X9HA 4M1PA 3RI5A 3T4MA 2JQKA 2W63A 4O4JE 3N9MA 2Y7YA 3AEAA 3I9WA 5JQGE 2L9QA 2VKDA 3NRYA 5C2TA 1HX8A 3SIOA 5FNVE 4U7YA 4C90A 3OBVE 2W2UA 4ZI3C 2PFVA 3UQ7A 2XYTA 2WQYA 3H37A 2JQHA 3UUXB 5AQIB 3WAKA 4DR6T 1J5ET 3ZKRA 3RHWA 5AQOB 4O4IE 4P09A 2V5CA 1HS7A 4HN9A 4X1KE 3FBLA 5AQRB 3B5MA 2LSKA 2XAGB 1W0AA 2QVAA 3UU3A 3UU4A 3N2KE 1FEWA 4PNIA 1MMDA 2XAQB 2JMHA 5LB7B 3ZT6A 5FMNA 5JDNA 4U2ZA 3RYFE 4DV0T 4LF6T 2VKOA 3QC9A 3JC6D 5EZYE 4BAYB 4AQYT 3RYIE 2XY8B 4IDOA 4UM1A 5L3CB 5JDQA 3KINB 1NAFA 2VASA 2WNCA 4AFTA 2PG8A 3LBXA 5JRCA 4KBMB 4LFBT 5HEGA 1MNDA 5JR9B 2HH7A 5DQVA 4DIDB 1ZV4X 5LMNT 3QOFA 3PJAJ 2BYPA 3C4WA 2A2FX 5LHGB 2Y6XA 2E5VA 2BS3A 2QC1B 1US7B 3CQGB 4U33A 3VRAA 3WTNA 2X0YA 4DVDA 2CHOA 4XAXB 3PMZA 3FZMB 3IGQA 3AVSA 4UF0B 5L3DB 3NZQA 3ZCJA 4DV6T 2Q9QC 5JDHA 2ZM2A 1XWMA 4EZHA 3EVYA 2XQYA 4KI0F 2C5IT 3C98B 4ZK1A 3AEEA 1W0BA 3WTHA 4BA9A 4OYJA 1QLBA 3U8JA 2H7OA 4UEMA 1IAPA 2M67A 1HX1B 1YQ4A 4AFHA 3CWZB 3V5UA 4A97A 2BG9B 3AE1A 4H9PC 3QB5A 2XZ5A 4Q25A 3UULA 1IJ5A 4GIWA 4FI5A 3TLSA 4FRRA 2WWUA 3Q5EA 2K3WA 3PJAA 3ZMZB 2E9XC 3AE7A 2E5LT 1J1JA 1D0YA 3NRXA 2CBIA 4PIRA 3A7MA 2WDQA 4OHFA 4HWFA 2VVNA 4YSXA 2LT3A 3AEBA 1G73A 4YHHT 1H7CA 5LJMA 2MYSA 1X9BA 1JNRA 1KK7A 2VKHA 5JREA 1NWMX 4UM3A 4COFA 4PFOA 2CXDA 2CBJA 2NR4A 3PUQA 4MBQA 1FIOA 2VQFT 2V7LA 4ISTA 4YJ3E 4HWIB 4X1YE 2CRBA 1ZEEA 3K3NA 1HCIA 5FXWA 3FXDB 4JV5T 3FZLB 4LMJA 3KBTA 4WV9A 3GMIA 3O1JA 5LG4A 2UUAT 3OVUA 4O8SA 3GUAA 4IE6A 3HI2A 2CLYB 5HXRA 3O1IA 1N32T 2BJ0A 2PJQA 2BVMA 5AQJB 4IIJE 4ZI3D 4JUYA 4EV6A 2X9XA 5J2UE 4AKIA 5ETWA 1BR0A 5F5WA 1IBKT 2K48A 2UU9T 1HF8A 3CX8B 3FZHB 3ONLC 4JI2T 4DV7T 4PJMA 4NIQA 3VR9A 2J1DG 1HNWT 2DL1A 4ZS2A 2XYSA 3ONJA 3V5SA 4JLEA 2XQAA 1BR1A 3N2OA 3M3ZB 2A3DA 2JRKA 4PJNA 4JEUB 2LM9A 5DQWA 4GK0E 3SH1A 1T98A 3CVRA 2W4XA 3ZPOA 2UZ6A 4WYVA 4YT0A 4F8HA 2I0MA 4HFCA 3CK6A 5J5FA 3HKCE 2QGSA 1FJGT 5IHYA 3RX6A 3RRCA 4H9QC 2IC6A 5KDMC 2KZ7B 2LJLA 2BKNA 5FYMA 2JMKA 1X79A 3RKOA 1R8IA 1D1BA 3ESLA 5EK4A 3AE2A 1WR6A 2ODVA 3N5LA 5FVKA 2BG9E 3KV6A 2LKGA 3F57A 4PJJA 3QK6A 4LMKA 1M62A 4YLHA 4DUYT 3RYHE 3P4QA 5L4HA 4IREA 1E7PA 4I4TE 2CLYC 4TN7B 5IYZE 2VK9A 2MOZA 4DR7T 4HWCA 2WAUA 4QH4A 3ZLIA 2CPTA 4TV9E 3RC8A 5LXTE 3UU5A 5ABGA 3UFEA 3PUYF 2NTYA 2W8GA 2Q9QD 4EIWA 4TUYE 1MIVA 4K0KT 1LVFA 2I59A 2WU5A 3HKEE 2V7IA 3ETVA 1UUSA 5L3GB 2PTFA 1WRDA 4AISA 3AB3B 4ZOLE 2ZMAA 4DNDA 3O1HA 4EYYR 2YMEA 3NVOA 4PK6A 2A72A 5FVLA 4IE0A 4H63H 3UU8A 2L8KA 4AQGA 2NP9A 4X65T 4HEAA 2BS4A 4JI8T 2BDEA 1VRBA 2H3RA 2E9XD 3AAAB 3Q9DA 4KHZF 2OV9A 5AQNB 4JI0T 4L9IA 2QRXA 1FMVA 1D0ZA 2XTLA 3AE6A 2BVLA 3VU7H 5ABFB 3RIAA 3A8YC 4QX7B 4Z8XA 3OPCA 3Q5DA 2YEVC 2WZYA 2WN9A 3FHNA 2IAKA 2WSSV 3RPUA 1Z0PA 3TLWA 4CI3B 5AQHB 5F3JA 5LP6E 3DJBA 4LMLA 2YKSA 3ZC1A 5AFHA 4WW0A 2W67A 3EI0A 3MXZA 1S94A 2PH9A 4TX5A 1OEDA 4U74A 5CGMA 3ZSTA 2BBJA 3JAFA 5LBQB 3ANWB 2XAJB 3Q2MA 5AQPB 2FJEA 3FBZA 3AE4A 1KNRA 3AE9A 3RIUA 2ZM6T 2X0LB 3QB5K 2MAWA 3AA1B 5H6RB 3CKDA 2B76A 4JI1T 4BFQA 4IT4A 2HHHT 3LFMA 4U2YA 5JVDE 4DV1T 5JDFA 4IDZA 2BYRA 4A98A 5AFMA 3X1DA 1KF6A 3VR8A 2KLQA 2VWAA 1I9BA 2X00A 3HA4A 2EHOA 4DV3T 4NXMT 5BW2A 2WDRA 4IDQA 5AQFB 3U78A 2XNVA 2CXLA 1D0XA 5AFKA 2IMLA 5C3JA 4MALA 3RF1A 4NUUA 4O4LE 2Q9QB 3SQ6A 2P9BA 3JCFA 4HWHA 4XHEA 4ZR6A 4LFAT 2W0GA 1L0VA 2ACXA 5KXJA 4JI4T 3P4PA 3SOLA 4Z91A 3VKHA 4U31A 5AQLB 2J62A 2XSBA 1O3XA 4H63V 2XQ5A 2WMNA 2XNUA 5FP3A 3ZT5A 3AXJA 3IEEA 3KVAA 4DV4T 3AA0B 4ZZBA 2E9XB 3GN5A 1CHUA 4HFVA 2WU2A 3BQIA 1BR4A 4ZS3A 4JI6T 3NWIA 3QUJA 3L8RA 3P4WA 2XNTA 3WTJA 2W66A 2WB5A 1HNZT 3MKDA 3H3AA 3P7IA 2HN1A 3IHRA 1YKHB 3N2GE 1SUMB 2G0UA 4QX8B 4ZI2D 3SRZA 3PDYA 4IHJE 5L3BB 4KMCA 4HKAA
chains in the Genus database with same CATH topology
3U8LA 1UW6A 4QACA 5CFBA 2XNVA 3ZKRA 4AFGA 2KSRA 3RHWA 4LMJA 4UXUA 3PMZA 5J5IA 2XQ8A 4QABA 2BYQA 3IGQA 5AINA 4WV9A 5AFKA 5TVCA 5BP0A 2Y57A 4UM3S 2BG9A 3SQ9A 3RIAA 1UX2A 3EAMA 3SQ6A 4ZJTA 3RQUA 3GUAA 2WNLA 5J5GA 4B5DA 4XHEA 2BG9E 2M6IA 4ZR6A 2Y56A 4ZK4A 5LXBA 3TLTA 2WZYA 2WN9A 3JADA 5LG3A 2LKGA 3LSVA 2ZJUA 2C9TA 3TLWA 5HEJA 2YN6A 2BJ0A 3UU3A 5AFMB 5KZUA 4TNVA 5FJVA 2LM2A 4ZK1A 5AFNA 3UU4A 4LMKA 3WTHA 3JAEA 3ZDGA 4HFDA 4QH1A 4Z91A 5HCJA 3U8JA 5KE4A 4LMLA 2YKSA 4HFEA 4IL9A 4QAAA 4ILCA 5AFHA 5J5HA 2LKHA 3RQWA 2BYSA 2Y54A 5BRXA 3UU6A 2WNJA 4AFHA 4EZ1A 1UV6A 2M6BA 5AFLA 5L4HA 4IREA 3EI0A 4A97A 2BG9C 2BG9B 2XQ5A 4HFIA 4NPPA 2VL0A 2PH9A 3C84A 2YMDA 1OEDA 5HEOA 4QH4A 3P50A 4X5TA 2BR8A 2BYNA 4ZRUA 2XZ5A 3WTMA 2XNUA 4TWFA 4NZBA 3WTLA 3UQ4A 3JAFA 5AFJA 4UY2A 3UU5A 3TLSA 1OEDE 4FRRA 3WIPA 2XQ3A 2W8GA 2ZJVA 4ZZBA 3U8NA 5L47A 4DBMA 3U8KA 2XQ4A 4TWHA 3RI5A 4UM1A 5JMEA 5CO5A 3T4MA 3TLVA 3WTIA 3U8MA 5HCMA 5HEUA 4PIRA 2XYSA 2MAWA 3ZDHA 4BQTA 2Y7YA 2WNCA 3TLUA 2XQAA 4AFTA 3EHZA 3UUBA 4IL4A 3P4WA 2XNTA 3WTJA 4QH5A 2X00D 2XQ6A 4BFQA 3WTOA 3C79A 4HQPA 4HFHA 5HEGA 4Z90A 2LLYA 2XZ6A 2XQ9A 2Y58A 4TNWA 3SIOA 3SH1A 3WTKA 1OEDC 1OEDB 3RIFA 5J0ZA 4TWDA 4ZJSA 2BYRA 2UZ6A 2YMEA 2YOEA 4ILAA 4A98A 5HEHA 4F8HA 4ALXA 4HFCA 4UM3A 2BR7A 4COFA 4D01A 5J5FA 5AFMA 2BYPA 5SYOA 5BW2A 2XQ7A 4XK9A 3UU8A 3UQ7A 2W8FA 2XYTA 5L4EA 4UM3P 2PGZA 4ILBA 2QC1B 1I9BA 2X00A 3PEOA 4HFBA 3WTNA 4ZZCA 5IUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8L A;  1UW6 A;  4QAC A;  5CFB A;  2XNV A;  3ZKR A;  4AFG A;  2KSR A;  3RHW A;  4LMJ A;  4UXU A;  3PMZ A;  5J5I A;  2XQ8 A;  4QAB A;  2BYQ A;  3IGQ A;  5AIN A;  4WV9 A;  5AFK A;  5TVC A;  5BP0 A;  2Y57 A;  4UM3 S;  2BG9 A;  3SQ9 A;  3RIA A;  1UX2 A;  3EAM A;  3SQ6 A;  4ZJT A;  3RQU A;  3GUA A;  2WNL A;  5J5G A;  4B5D A;  4XHE A;  2BG9 E;  2M6I A;  4ZR6 A;  2Y56 A;  4ZK4 A;  5LXB A;  3TLT A;  2WZY A;  2WN9 A;  3JAD A;  5LG3 A;  2LKG A;  3LSV A;  2ZJU A;  2C9T A;  3TLW A;  5HEJ A;  2YN6 A;  2BJ0 A;  3UU3 A;  5AFM B;  5KZU A;  4TNV A;  5FJV A;  2LM2 A;  4ZK1 A;  5AFN A;  3UU4 A;  4LMK A;  3WTH A;  3JAE A;  3ZDG A;  4HFD A;  4QH1 A;  4Z91 A;  5HCJ A;  3U8J A;  5KE4 A;  4LML A;  2YKS A;  4HFE A;  4IL9 A;  4QAA A;  4ILC A;  5AFH A;  5J5H A;  2LKH A;  3RQW A;  2BYS A;  2Y54 A;  5BRX A;  3UU6 A;  2WNJ A;  4AFH A;  4EZ1 A;  1UV6 A;  2M6B A;  5AFL A;  5L4H A;  4IRE A;  3EI0 A;  4A97 A;  2BG9 C;  2BG9 B;  2XQ5 A;  4HFI A;  4NPP A;  2VL0 A;  2PH9 A;  3C84 A;  2YMD A;  1OED A;  5HEO A;  4QH4 A;  3P50 A;  4X5T A;  2BR8 A;  2BYN A;  4ZRU A;  2XZ5 A;  3WTM A;  2XNU A;  4TWF A;  4NZB A;  3WTL A;  3UQ4 A;  3JAF A;  5AFJ A;  4UY2 A;  3UU5 A;  3TLS A;  1OED E;  4FRR A;  3WIP A;  2XQ3 A;  2W8G A;  2ZJV A;  4ZZB A;  3U8N A;  5L47 A;  4DBM A;  3U8K A;  2XQ4 A;  4TWH A;  3RI5 A;  4UM1 A;  5JME A;  5CO5 A;  3T4M A;  3TLV A;  3WTI A;  3U8M A;  5HCM A;  5HEU A;  4PIR A;  2XYS A;  2MAW A;  3ZDH A;  4BQT A;  2Y7Y A;  2WNC A;  3TLU A;  2XQA A;  4AFT A;  3EHZ A;  3UUB A;  4IL4 A;  3P4W A;  2XNT A;  3WTJ A;  4QH5 A;  2X00 D;  2XQ6 A;  4BFQ A;  3WTO A;  3C79 A;  4HQP A;  4HFH A;  5HEG A;  4Z90 A;  2LLY A;  2XZ6 A;  2XQ9 A;  2Y58 A;  4TNW A;  3SIO A;  3SH1 A;  3WTK A;  1OED C;  1OED B;  3RIF A;  5J0Z A;  4TWD A;  4ZJS A;  2BYR A;  2UZ6 A;  2YME A;  2YOE A;  4ILA A;  4A98 A;  5HEH A;  4F8H A;  4ALX A;  4HFC A;  4UM3 A;  2BR7 A;  4COF A;  4D01 A;  5J5F A;  5AFM A;  2BYP A;  5SYO A;  5BW2 A;  2XQ7 A;  4XK9 A;  3UU8 A;  3UQ7 A;  2W8F A;  2XYT A;  5L4E A;  4UM3 P;  2PGZ A;  4ILB A;  2QC1 B;  1I9B A;  2X00 A;  3PEO A;  4HFB A;  3WTN A;  4ZZC A;  5IUX A; 
#chains in the Genus database with same CATH topology
 3DTO A;  4AFG A;  4UXU A;  4AIU A;  3FXE B;  2WWV A;  4DR4 T;  3VRB A;  4AQF C;  4ZJT A;  3RQU A;  3BQL A;  3AE3 A;  2WNL A;  5CA0 E;  2J4G A;  3L39 A;  2Y56 A;  4IE4 A;  2BKO A;  4HWD A;  2X66 A;  2NTX A;  3AA6 B;  2UXD T;  3IBP A;  2BYS A;  5BRX A;  4EYU A;  4DR2 T;  2JJ9 A;  2ZLY A;  3ZMT B;  3T1Y T;  3FB2 A;  4J2C A;  2BYN A;  4H9R C;  3ZYK A;  1HR0 T;  3C4Z A;  4ZI7 E;  2ZJV A;  4UEL A;  4C91 A;  3SWH A;  4X64 T;  5A1L A;  4QHO A;  1YXR A;  4CZZ B;  4EXT A;  1VCT A;  2CWY A;  2V6Y B;  3PV0 F;  2UXC T;  5HXS A;  4DMW A;  4TWD A;  4ZJS A;  4TV8 E;  2V7K A;  5JTG A;  2KXP B;  3RH3 A;  3ZYL A;  5H6Q B;  4EB6 E;  4E7S A;  4O2B E;  5LGT B;  4EOZ B;  4MFR A;  1VOM A;  3KDS E;  2C5K T;  4KP3 C;  4B6X A;  4E7Z A;  2BYQ A;  5AIN A;  2DLR A;  4YTP A;  4L0R A;  1MMG A;  4ERR A;  4UIG A;  2GK9 A;  3O4X E;  3PUX F;  4O4H E;  5J5G A;  3AE5 A;  3F31 A;  3MK7 C;  3PUV F;  4LF4 T;  4DR3 T;  1MIW A;  2VQE T;  2SPC A;  3AEG A;  4TNV A;  3I0Q A;  3VHL A;  1E1H B;  1FMW A;  4IL9 A;  2ZM0 A;  3F2E A;  3AAE B;  1S35 A;  4FJO A;  5FKY A;  3J7Y q;  3EUH A;  1VCS A;  5HEO A;  1Y64 B;  1LRZ A;  1Y01 A;  2D5U A;  3N9N A;  5AQQ B;  3UQ4 A;  4H9O C;  3LJC A;  4QWN B;  2LSI A;  3MA9 A;  1N33 T;  3CX6 B;  1MMA A;  2X68 A;  2F4V T;  3RRW A;  3TLV A;  1OWA A;  5LNK A;  1XNQ T;  4H9S E;  1D1A A;  4BQT A;  2E8I A;  1XNR T;  3WAJ A;  2CXF A;  2LSG A;  2KWI B;  3GA8 A;  4YFS A;  4HQP A;  5FXZ A;  2RPA A;  4DMV A;  1OED C;  4ASK A;  3KV5 A;  3K3Q C;  3OYZ A;  2K9A A;  2XQ7 A;  4XK9 A;  1QSD A;  5L4E A;  4ILB A;  4DV2 T;  1IBM T;  5HAX A;  2N1G A;  3LBX B;  5JRC B;  2QA7 A;  3M65 A;  2C0S A;  3SQ9 A;  5F8P A;  4A5X A;  2XAF B;  1YKE B;  4JYA T;  3AEF A;  3LDQ B;  1WFD A;  2YN6 A;  4OX9 T;  2WM9 A;  4QH1 A;  2N9D A;  2EHO C;  4CXW A;  3A5X A;  4YTM A;  2KIN B;  2LE8 A;  2WNJ A;  2NWB A;  2XJ7 A;  5HYA A;  2KMF A;  4NPP A;  2J47 A;  4KX6 A;  4V1A v;  2ZM8 A;  4LFC T;  2XM2 A;  2H89 A;  3WTL A;  3WIP A;  2Y8D A;  4GKJ T;  3U8N A;  2LRL A;  4TWH A;  1M7K A;  3QNU A;  2IW5 B;  2WS3 A;  1JNZ A;  1SHZ C;  2KT9 A;  3NKZ A;  4ZI2 C;  4KUM B;  2CWO A;  1U5P A;  3BK9 A;  3UFG A;  4F6R C;  4Z90 A;  2LLY A;  4TNW A;  5ABH A;  3N9P A;  4WBN E;  1HFA A;  2V7M A;  2YOE A;  3BQK A;  1U4Q A;  4UM3 P;  5AQM B;  4AXP A;  4LF5 T;  2AXD S;  4ZXL A;  3UUN A;  3SS1 A;  3PUG A;  3E08 A;  3MZK B;  1NEN A;  1HTJ F;  2XQ8 A;  1T7S A;  5AQS B;  2Y57 A;  3P4R A;  4UVA B;  3TKL B;  2WY2 A;  1UX2 A;  5FL1 A;  3HKB E;  2BZB A;  2BKP A;  4GOU A;  5LG3 A;  1NEK A;  3LSV A;  4U72 A;  2LM2 A;  3OKQ A;  3NBX X;  4TZ4 C;  4YSZ A;  2NW7 A;  4G63 A;  1EZ3 A;  4ILC A;  2FJA A;  3NZP A;  4WNK A;  2A9U A;  5FY0 A;  3UU6 A;  5AFU L;  4LF8 T;  2W61 A;  4CN4 A;  2E2A A;  4UVB B;  5JR9 A;  1B7T A;  4X5T A;  2LSY A;  3G06 A;  2D2S A;  3ONX A;  3PTR B;  2X9W A;  4OFZ A;  3PUR A;  3AA7 B;  2ACZ A;  4OK0 A;  3ZMS B;  5JME A;  1ZOY A;  5HEU A;  1I94 T;  5AQT B;  4UF0 A;  2CHN A;  3RGL A;  4DV5 T;  1W09 A;  5JDL A;  2XPK A;  3RKG A;  4KHP T;  4QXC B;  1KNP A;  3I9Y A;  4ILA A;  3ETU A;  2JQ9 A;  3B57 A;  4YHJ A;  5SYO A;  4AI6 A;  3KV9 A;  2PGZ A;  5L3E B;  1YD8 G;  4G2A A;  2WCA A;  3ZMV B;  4ZZC A;  3PUZ F;  3AED A;  1UW6 A;  4EGW A;  2V7J A;  3C51 A;  2KSR A;  5FXV A;  4QAB A;  2MTQ A;  5JDG A;  2BG9 A;  3RC3 A;  1ZKE A;  2FUP A;  2UXN B;  1D1C A;  4B5D A;  4OYK A;  2LHR A;  4ZHQ E;  4X66 T;  4AKR B;  2K5B B;  3K3O A;  2LOS A;  2ZJU A;  3AEC A;  3ZCI A;  4A56 A;  2H88 A;  4UXN B;  3ABV A;  2CMR A;  2C5J A;  2VUR A;  2NW8 A;  2X51 A;  2QYW A;  2IUB A;  2Y54 A;  2KWH A;  4EEB A;  1UK5 A;  3CML A;  2DCF A;  2M6B A;  3D0T A;  4BJM A;  3OTO T;  4CN6 A;  3UTK A;  1ZP0 A;  4HFI A;  5J1G A;  2BR8 A;  2FJB A;  4ZEY A;  5AFJ A;  3O9X A;  2CEA A;  1WLX A;  4PW8 A;  2VL8 A;  4DBM A;  4I43 B;  1YW0 A;  4CXX A;  5IWA T;  3W15 B;  3U8M A;  5HCM A;  4AKH A;  3U3I A;  3EHZ A;  4I50 E;  2X00 D;  4EED A;  2EHO D;  2XZ6 A;  2Y58 A;  2V5D A;  4LF9 T;  1GQE A;  2FBW A;  2W62 A;  4B3S T;  4IE5 A;  1IJ6 A;  4X20 E;  2XM1 A;  4XBF B;  3HR0 A;  4PK5 A;  3PEO A;  3EAB A;  3U8L A;  1UCU A;  2CM0 A;  4B3R T;  3B13 A;  5DJQ C;  2WZI A;  4QXB B;  2RA1 A;  1DU2 A;  3EDV A;  2B1E A;  2JQQ A;  2XAS B;  4DBQ A;  4UV9 B;  4CI2 B;  1IBL T;  3JAD A;  3J9X 1;  4ADZ A;  2X9Y A;  5DAB A;  5FJV A;  2CA5 A;  5KX5 E;  1SA0 E;  5LJN A;  3ZC0 A;  2RP4 A;  3Q5X A;  3L09 A;  2YU2 A;  5FXX A;  3PU8 A;  4PAG A;  5KMG P;  2XUE A;  4JBW F;  5AFL A;  3KVB A;  3PUW F;  4P1N A;  3C84 A;  2PBI A;  2YMD A;  4ANJ A;  4I0U A;  3UT5 E;  1XMQ T;  2H7V C;  5TAO A;  4TWF A;  3ZN0 B;  4JEH B;  1N36 T;  4XZC A;  5LGN B;  3LK2 B;  3ZJ1 A;  2XAH B;  2LRK A;  4I55 E;  3ZDH A;  1HG2 A;  4DR5 T;  1WR0 A;  3EDU A;  3WI3 A;  3LK3 B;  4GYS A;  3WTO A;  2XSA A;  2BBH A;  3UUM A;  2XQ9 A;  1OED B;  4HTE A;  2JIW A;  2YK0 A;  3KV4 A;  3PUA A;  4PK4 A;  2DNX A;  2W8F A;  5CA1 E;  2N2N A;  4HFB A;  2YDR A;  1MMN A;  5IUX A;  4EZ4 A;  4HE8 A;  5CFB A;  5J5I A;  5HWY A;  4K0U A;  5TVC A;  4UM3 S;  2LHN A;  5CJ5 A;  3E0Z A;  3LK4 2;  4X1I E;  5EK2 A;  5LXB A;  2UXB T;  2C9T A;  5AFM B;  2LEH A;  3C4X A;  2UUB T;  2EHO B;  3DP7 A;  5J5H A;  5LBM A;  4YY3 T;  5LCY A;  3CIR A;  2D0U A;  2V1D B;  3R84 B;  2HN2 A;  2FJD A;  5JDM A;  2VL0 A;  5LGU B;  5ADX L;  5E0O A;  4NZB A;  4DBR A;  5FL0 A;  4NXN T;  4P0B A;  1XZY A;  2V8S V;  3HL6 A;  4O2A E;  2DWG A;  2IDO B;  5AQK B;  1G8X A;  4BJN A;  3N9O A;  3I1A A;  4DR1 T;  3UUB A;  2OA5 A;  4IL4 A;  3H3M A;  4ILU A;  3VKG A;  3OJA A;  4QXH B;  1T8B A;  4L5G A;  5ABF A;  1WYB A;  3WTK A;  5JR9 C;  4IE7 A;  4UVC B;  5CB4 E;  4ALX A;  3AXJ B;  3CQC B;  2WBL A;  2UXX B;  1MIY A;  3GN5 B;  2VVS A;  2W00 A;  2IHR 1;  3MAC A;  4IDN A;  4U3C A;  5HWX A;  4QAC A;  3P4S A;  5FY7 A;  4IGU A;  3Q5W A;  1I6Z A;  2BS2 A;  4JI5 T;  1KFY A;  3EAM A;  5JH7 E;  3CPZ A;  4MLK A;  3ANW A;  3S4U A;  2LOP A;  5FY1 A;  4AKL A;  2D0T A;  3RIU C;  5AFN A;  2MPK A;  3ZDG A;  2V26 A;  4CQI A;  5HCJ A;  4LF7 T;  4GK5 E;  4QAA A;  4N78 D;  3R6N A;  5GON E;  2AE9 A;  2K24 A;  1UV6 A;  4GYR A;  3SFE A;  3SFD A;  4ISS A;  3AE8 A;  2BG9 C;  3OYX A;  4PFP A;  2X0H A;  2ODU A;  3L3P A;  3P50 A;  4AQF A;  3ZEF B;  3E22 E;  1J5W A;  4UY2 A;  1OED E;  3N9Q A;  1XDP A;  2XQ3 A;  2HPL A;  4WBO A;  3ZN1 B;  2XQ4 A;  1T72 A;  4CI1 B;  3GWH A;  1LKX A;  2R6G F;  4DO0 A;  2IIU A;  1XDO A;  5L3F B;  4YXD A;  1AJ3 A;  3K8P C;  3ZMU B;  1UX5 A;  5HXE A;  2YU1 A;  2XHE B;  4QH5 A;  3T8O A;  2XQ6 A;  2I6H A;  2LSJ A;  3C79 A;  4HFH A;  2XZE A;  3N9L A;  2Q9Q A;  3CQX C;  3RIF A;  3AVR A;  3PE0 A;  2WDV A;  4PJL A;  3IF8 B;  2ES0 A;  4AKG A;  2BR7 A;  4D01 A;  1KEY A;  2NW9 A;  3I0O A;  4YJ2 E;  5ABE A;  1KNZ A;  1BR2 A;  5C8Y E;  2NOX A;  1MNE A;  3JC6 C;  4JI7 T;  2IC9 A;  3KBU A;  3HKD E;  5BP0 A;  1CUN A;  3RYC E;  1SE7 A;  2YDQ A;  4UR9 A;  5AQV B;  4NUV A;  1IZN B;  2M6I A;  1ZHC A;  2HPJ A;  2Y48 B;  5HXC A;  3KFW X;  3ZYM A;  1UX4 A;  5HEJ A;  2E9X A;  3T1H T;  4B3T T;  4GKK T;  4YTN A;  2D9D A;  4P0A A;  4DUZ T;  3RQW A;  2JPF A;  2DWK A;  3PUS A;  5EK3 A;  5L2L A;  3RLF F;  5BR8 T;  3PU3 A;  2MBG A;  4JI3 T;  2CE7 A;  2DHR A;  4UV8 B;  1W9R A;  2V6X A;  1E2A A;  4ZRU A;  1LVK A;  4HGA A;  2X67 A;  3LG7 A;  4IDP A;  2UUC T;  5LHH B;  1QUU A;  3ZT7 A;  4MHC A;  3MJX A;  2WMO A;  4H9N C;  5L47 A;  5M4Y A;  3U8K A;  2CCQ A;  1HG5 A;  3IA3 A;  5CO5 A;  5BMV E;  4QKN A;  3WTI A;  1N34 T;  3TLU A;  1WCR A;  2KND A;  2YIN A;  5LA6 E;  3P8C D;  5J0Z A;  1UUR A;  5HEH A;  5AQG B;  3ZSS A;  2WZH A;  2L3L A;  1HNX T;  1OXZ A;  5LHI B;  1V9D A;  4WZX A;  2OLT A;  4CN1 A;  4YSY A;  5HXH A;  2VB6 A;  3K1S A;  1WYC A;  5LOV E;  5AQU B;  3AAI A;  3FZK B;  3FZF B;  2DI4 A;  5LMU T;  4ZK4 A;  2YDS A;  3TLT A;  4CXY A;  5KZU A;  4B3M T;  3C50 A;  3JAE A;  4HFD A;  4EAH A;  2VKJ A;  5KE4 A;  2WP9 A;  4HFE A;  4X62 T;  1XMO T;  2LKH A;  1UGO A;  3C64 A;  4EZ1 A;  3CX7 B;  2V6Y A;  4U7I A;  3WTM A;  1Z8U A;  5LYJ E;  5J2T E;  1YQ3 A;  3ZJ2 A;  2Z6E A;  2X9H A;  4M1P A;  3RI5 A;  3T4M A;  2JQK A;  2W63 A;  4O4J E;  3N9M A;  2Y7Y A;  3AEA A;  3I9W A;  5JQG E;  2L9Q A;  2VKD A;  3NRY A;  5C2T A;  1HX8 A;  3SIO A;  5FNV E;  4U7Y A;  4C90 A;  3OBV E;  2W2U A;  4ZI3 C;  2PFV A;  3UQ7 A;  2XYT A;  2WQY A;  3H37 A;  2JQH A;  3UUX B;  5AQI B;  3WAK A;  4DR6 T;  1J5E T;  3ZKR A;  3RHW A;  5AQO B;  4O4I E;  4P09 A;  2V5C A;  1HS7 A;  4HN9 A;  4X1K E;  3FBL A;  5AQR B;  3B5M A;  2LSK A;  2XAG B;  1W0A A;  2QVA A;  3UU3 A;  3UU4 A;  3N2K E;  1FEW A;  4PNI A;  1MMD A;  2XAQ B;  2JMH A;  5LB7 B;  3ZT6 A;  5FMN A;  5JDN A;  4U2Z A;  3RYF E;  4DV0 T;  4LF6 T;  2VKO A;  3QC9 A;  3JC6 D;  5EZY E;  4BAY B;  4AQY T;  3RYI E;  2XY8 B;  4IDO A;  4UM1 A;  5L3C B;  5JDQ A;  3KIN B;  1NAF A;  2VAS A;  2WNC A;  4AFT A;  2PG8 A;  3LBX A;  5JRC A;  4KBM B;  4LFB T;  5HEG A;  1MND A;  5JR9 B;  2HH7 A;  5DQV A;  4DID B;  1ZV4 X;  5LMN T;  3QOF A;  3PJA J;  2BYP A;  3C4W A;  2A2F X;  5LHG B;  2Y6X A;  2E5V A;  2BS3 A;  2QC1 B;  1US7 B;  3CQG B;  4U33 A;  3VRA A;  3WTN A;  2X0Y A;  4DVD A;  2CHO A;  4XAX B;  3PMZ A;  3FZM B;  3IGQ A;  3AVS A;  4UF0 B;  5L3D B;  3NZQ A;  3ZCJ A;  4DV6 T;  2Q9Q C;  5JDH A;  2ZM2 A;  1XWM A;  4EZH A;  3EVY A;  2XQY A;  4KI0 F;  2C5I T;  3C98 B;  4ZK1 A;  3AEE A;  1W0B A;  3WTH A;  4BA9 A;  4OYJ A;  1QLB A;  3U8J A;  2H7O A;  4UEM A;  1IAP A;  2M67 A;  1HX1 B;  1YQ4 A;  4AFH A;  3CWZ B;  3V5U A;  4A97 A;  2BG9 B;  3AE1 A;  4H9P C;  3QB5 A;  2XZ5 A;  4Q25 A;  3UUL A;  1IJ5 A;  4GIW A;  4FI5 A;  3TLS A;  4FRR A;  2WWU A;  3Q5E A;  2K3W A;  3PJA A;  3ZMZ B;  2E9X C;  3AE7 A;  2E5L T;  1J1J A;  1D0Y A;  3NRX A;  2CBI A;  4PIR A;  3A7M A;  2WDQ A;  4OHF A;  4HWF A;  2VVN A;  4YSX A;  2LT3 A;  3AEB A;  1G73 A;  4YHH T;  1H7C A;  5LJM A;  2MYS A;  1X9B A;  1JNR A;  1KK7 A;  2VKH A;  5JRE A;  1NWM X;  4UM3 A;  4COF A;  4PFO A;  2CXD A;  2CBJ A;  2NR4 A;  3PUQ A;  4MBQ A;  1FIO A;  2VQF T;  2V7L A;  4IST A;  4YJ3 E;  4HWI B;  4X1Y E;  2CRB A;  1ZEE A;  3K3N A;  1HCI A;  5FXW A;  3FXD B;  4JV5 T;  3FZL B;  4LMJ A;  3KBT A;  4WV9 A;  3GMI A;  3O1J A;  5LG4 A;  2UUA T;  3OVU A;  4O8S A;  3GUA A;  4IE6 A;  3HI2 A;  2CLY B;  5HXR A;  3O1I A;  1N32 T;  2BJ0 A;  2PJQ A;  2BVM A;  5AQJ B;  4IIJ E;  4ZI3 D;  4JUY A;  4EV6 A;  2X9X A;  5J2U E;  4AKI A;  5ETW A;  1BR0 A;  5F5W A;  1IBK T;  2K48 A;  2UU9 T;  1HF8 A;  3CX8 B;  3FZH B;  3ONL C;  4JI2 T;  4DV7 T;  4PJM A;  4NIQ A;  3VR9 A;  2J1D G;  1HNW T;  2DL1 A;  4ZS2 A;  2XYS A;  3ONJ A;  3V5S A;  4JLE A;  2XQA A;  1BR1 A;  3N2O A;  3M3Z B;  2A3D A;  2JRK A;  4PJN A;  4JEU B;  2LM9 A;  5DQW A;  4GK0 E;  3SH1 A;  1T98 A;  3CVR A;  2W4X A;  3ZPO A;  2UZ6 A;  4WYV A;  4YT0 A;  4F8H A;  2I0M A;  4HFC A;  3CK6 A;  5J5F A;  3HKC E;  2QGS A;  1FJG T;  5IHY A;  3RX6 A;  3RRC A;  4H9Q C;  2IC6 A;  5KDM C;  2KZ7 B;  2LJL A;  2BKN A;  5FYM A;  2JMK A;  1X79 A;  3RKO A;  1R8I A;  1D1B A;  3ESL A;  5EK4 A;  3AE2 A;  1WR6 A;  2ODV A;  3N5L A;  5FVK A;  2BG9 E;  3KV6 A;  2LKG A;  3F57 A;  4PJJ A;  3QK6 A;  4LMK A;  1M62 A;  4YLH A;  4DUY T;  3RYH E;  3P4Q A;  5L4H A;  4IRE A;  1E7P A;  4I4T E;  2CLY C;  4TN7 B;  5IYZ E;  2VK9 A;  2MOZ A;  4DR7 T;  4HWC A;  2WAU A;  4QH4 A;  3ZLI A;  2CPT A;  4TV9 E;  3RC8 A;  5LXT E;  3UU5 A;  5ABG A;  3UFE A;  3PUY F;  2NTY A;  2W8G A;  2Q9Q D;  4EIW A;  4TUY E;  1MIV A;  4K0K T;  1LVF A;  2I59 A;  2WU5 A;  3HKE E;  2V7I A;  3ETV A;  1UUS A;  5L3G B;  2PTF A;  1WRD A;  4AIS A;  3AB3 B;  4ZOL E;  2ZMA A;  4DND A;  3O1H A;  4EYY R;  2YME A;  3NVO A;  4PK6 A;  2A72 A;  5FVL A;  4IE0 A;  4H63 H;  3UU8 A;  2L8K A;  4AQG A;  2NP9 A;  4X65 T;  4HEA A;  2BS4 A;  4JI8 T;  2BDE A;  1VRB A;  2H3R A;  2E9X D;  3AAA B;  3Q9D A;  4KHZ F;  2OV9 A;  5AQN B;  4JI0 T;  4L9I A;  2QRX A;  1FMV A;  1D0Z A;  2XTL A;  3AE6 A;  2BVL A;  3VU7 H;  5ABF B;  3RIA A;  3A8Y C;  4QX7 B;  4Z8X A;  3OPC A;  3Q5D A;  2YEV C;  2WZY A;  2WN9 A;  3FHN A;  2IAK A;  2WSS V;  3RPU A;  1Z0P A;  3TLW A;  4CI3 B;  5AQH B;  5F3J A;  5LP6 E;  3DJB A;  4LML A;  2YKS A;  3ZC1 A;  5AFH A;  4WW0 A;  2W67 A;  3EI0 A;  3MXZ A;  1S94 A;  2PH9 A;  4TX5 A;  1OED A;  4U74 A;  5CGM A;  3ZST A;  2BBJ A;  3JAF A;  5LBQ B;  3ANW B;  2XAJ B;  3Q2M A;  5AQP B;  2FJE A;  3FBZ A;  3AE4 A;  1KNR A;  3AE9 A;  3RIU A;  2ZM6 T;  2X0L B;  3QB5 K;  2MAW A;  3AA1 B;  5H6R B;  3CKD A;  2B76 A;  4JI1 T;  4BFQ A;  4IT4 A;  2HHH T;  3LFM A;  4U2Y A;  5JVD E;  4DV1 T;  5JDF A;  4IDZ A;  2BYR A;  4A98 A;  5AFM A;  3X1D A;  1KF6 A;  3VR8 A;  2KLQ A;  2VWA A;  1I9B A;  2X00 A;  3HA4 A;  2EHO A;  4DV3 T;  4NXM T;  5BW2 A;  2WDR A;  4IDQ A;  5AQF B;  3U78 A;  2XNV A;  2CXL A;  1D0X A;  5AFK A;  2IML A;  5C3J A;  4MAL A;  3RF1 A;  4NUU A;  4O4L E;  2Q9Q B;  3SQ6 A;  2P9B A;  3JCF A;  4HWH A;  4XHE A;  4ZR6 A;  4LFA T;  2W0G A;  1L0V A;  2ACX A;  5KXJ A;  4JI4 T;  3P4P A;  3SOL A;  4Z91 A;  3VKH A;  4U31 A;  5AQL B;  2J62 A;  2XSB A;  1O3X A;  4H63 V;  2XQ5 A;  2WMN A;  2XNU A;  5FP3 A;  3ZT5 A;  3AXJ A;  3IEE A;  3KVA A;  4DV4 T;  3AA0 B;  4ZZB A;  2E9X B;  3GN5 A;  1CHU A;  4HFV A;  2WU2 A;  3BQI A;  1BR4 A;  4ZS3 A;  4JI6 T;  3NWI A;  3QUJ A;  3L8R A;  3P4W A;  2XNT A;  3WTJ A;  2W66 A;  2WB5 A;  1HNZ T;  3MKD A;  3H3A A;  3P7I A;  2HN1 A;  3IHR A;  1YKH B;  3N2G E;  1SUM B;  2G0U A;  4QX8 B;  4ZI2 D;  3SRZ A;  3PDY A;  4IHJ E;  5L3B B;  4KMC A;  4HKA A; 
#chains in the Genus database with same CATH homology
 3U8L A;  1UW6 A;  4QAC A;  5CFB A;  2XNV A;  3ZKR A;  4AFG A;  2KSR A;  3RHW A;  4LMJ A;  4UXU A;  3PMZ A;  5J5I A;  2XQ8 A;  4QAB A;  2BYQ A;  3IGQ A;  5AIN A;  4WV9 A;  5AFK A;  5TVC A;  5BP0 A;  2Y57 A;  4UM3 S;  2BG9 A;  3SQ9 A;  3RIA A;  1UX2 A;  3EAM A;  3SQ6 A;  4ZJT A;  3RQU A;  3GUA A;  2WNL A;  5J5G A;  4B5D A;  4XHE A;  2BG9 E;  2M6I A;  4ZR6 A;  2Y56 A;  4ZK4 A;  5LXB A;  3TLT A;  2WZY A;  2WN9 A;  3JAD A;  5LG3 A;  2LKG A;  3LSV A;  2ZJU A;  2C9T A;  3TLW A;  5HEJ A;  2YN6 A;  2BJ0 A;  3UU3 A;  5AFM B;  5KZU A;  4TNV A;  5FJV A;  2LM2 A;  4ZK1 A;  5AFN A;  3UU4 A;  4LMK A;  3WTH A;  3JAE A;  3ZDG A;  4HFD A;  4QH1 A;  4Z91 A;  5HCJ A;  3U8J A;  5KE4 A;  4LML A;  2YKS A;  4HFE A;  4IL9 A;  4QAA A;  4ILC A;  5AFH A;  5J5H A;  2LKH A;  3RQW A;  2BYS A;  2Y54 A;  5BRX A;  3UU6 A;  2WNJ A;  4AFH A;  4EZ1 A;  1UV6 A;  2M6B A;  5AFL A;  5L4H A;  4IRE A;  3EI0 A;  4A97 A;  2BG9 C;  2BG9 B;  2XQ5 A;  4HFI A;  4NPP A;  2VL0 A;  2PH9 A;  3C84 A;  2YMD A;  1OED A;  5HEO A;  4QH4 A;  3P50 A;  4X5T A;  2BR8 A;  2BYN A;  4ZRU A;  2XZ5 A;  3WTM A;  2XNU A;  4TWF A;  4NZB A;  3WTL A;  3UQ4 A;  3JAF A;  5AFJ A;  4UY2 A;  3UU5 A;  3TLS A;  1OED E;  4FRR A;  3WIP A;  2XQ3 A;  2W8G A;  2ZJV A;  4ZZB A;  3U8N A;  5L47 A;  4DBM A;  3U8K A;  2XQ4 A;  4TWH A;  3RI5 A;  4UM1 A;  5JME A;  5CO5 A;  3T4M A;  3TLV A;  3WTI A;  3U8M A;  5HCM A;  5HEU A;  4PIR A;  2XYS A;  2MAW A;  3ZDH A;  4BQT A;  2Y7Y A;  2WNC A;  3TLU A;  2XQA A;  4AFT A;  3EHZ A;  3UUB A;  4IL4 A;  3P4W A;  2XNT A;  3WTJ A;  4QH5 A;  2X00 D;  2XQ6 A;  4BFQ A;  3WTO A;  3C79 A;  4HQP A;  4HFH A;  5HEG A;  4Z90 A;  2LLY A;  2XZ6 A;  2XQ9 A;  2Y58 A;  4TNW A;  3SIO A;  3SH1 A;  3WTK A;  1OED C;  1OED B;  3RIF A;  5J0Z A;  4TWD A;  4ZJS A;  2BYR A;  2UZ6 A;  2YME A;  2YOE A;  4ILA A;  4A98 A;  5HEH A;  4F8H A;  4ALX A;  4HFC A;  4UM3 A;  2BR7 A;  4COF A;  4D01 A;  5J5F A;  5AFM A;  2BYP A;  5SYO A;  5BW2 A;  2XQ7 A;  4XK9 A;  3UU8 A;  3UQ7 A;  2W8F A;  2XYT A;  5L4E A;  4UM3 P;  2PGZ A;  4ILB A;  2QC1 B;  1I9B A;  2X00 A;  3PEO A;  4HFB A;  3WTN A;  4ZZC A;  5IUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...