4ILCA

The glic pentameric ligand-gated ion channel in complex with sulfates
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ilcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ilcA01
5HEGA 4NPPA 2PGZA 2BYSA 3JADA 3RIAA 5LXBA 3C84A 4UM3A 1OEDE 3RQUA 4HFHA 1OEDA 3WTLA 4FRRA 4BQTA 5J5IA 2M6BA 4TWHA 2LKHA 3SIOA 4XK9A 5J5FA 4WV9A 5CFBA 3WIPA 4ZRUA 5LG3A 3PEOA 3P4WA 4UY2A 5AFLA 1UW6A 2BG9A 5J5HA 4DBMA 4A97A 3RIFA 3WTMA 5CO5A 4HFBA 3WTKA 3UUBA 2BYQA 5KZUA 4X5TA 2Y54A 2XQ9A 5AFJA 2XQ7A 3SQ9A 5KE4A 3EAMA 4Z90A 2YMEA 3GUAA 2LKGA 2C9TA 3WTOA 2Y56A 4LMLA 4ZK1A 2XYTA 2BG9C 2XYSA 2XQ4A 4B5DA 2WNLA 3JAFA 5FJVA 2XQAA 2Y7YA 3EI0A 2WZYA 2Y57A 4ZK4A 3P50A 2BG9E 4UM1A 2WNCA 4ZR6A 1UV6A 4TWDA 4AFGA 5AFMB 3RHWA 4LMKA 1I9BA 4Z91A 2BYRA 3PMZA 4ILAA 3UQ7A 3WTJA 5AFHA 5BP0A 5TVCA 2MAWA 4ZZCA 4QH5A 3U8KA 3WTIA 5JMEA 3U8MA 5AINA 3UU4A 2XNVA 2BJ0A 3ZDGA 5HCJA 3SH1A 4ZZBA 5L4EA 4HFCA 2LLYA 4UM3P 3TLSA 3LSVA 4PIRA 2WN9A 2M6IA 4BFQA 2BR8A 1UX2A 2W8GA 4EZ1A 4ILCA 3UU3A 2XZ6A 4HFDA 5AFNA 3U8NA 3U8LA 4HFEA 2XQ3A 5HEOA 3TLWA 3UU5A 4AFHA 3C79A 5AFMA 2XNTA 3TLTA 3ZDHA 5HEHA 4LMJA 5BRXA 5SYOA 4HFIA 3IGQA 4D01A 5BW2A 3U8JA 3SQ6A 4QH1A 3RI5A 4TNWA 5J0ZA 5L4HA 2ZJVA 2BYNA 2WNJA 5AFKA 4TWFA 3JAEA 2XNUA 2XZ5A 4UXUA 3WTNA 2QC1B 3UQ4A 3T4MA 4QAAA 5HEJA 4COFA 2X00D 2X00A 4QH4A 3RQWA 4XHEA 2UZ6A 3UU6A 2YOEA 4F8HA 2YMDA 3EHZA 1OEDB 2W8FA 4A98A 5HEUA 2BYPA 2XQ6A 2LM2A 2BR7A 3TLVA 3WTHA 2XQ8A 4TNVA 3TLUA 5J5GA 4ZJSA 4QACA 5HCMA 2KSRA 4ALXA 4UM3S 2PH9A 4AFTA 4HQPA 2XQ5A 2BG9B 1OEDC 4IL4A 3UU8A 3ZKRA 5IUXA 5L47A 2Y58A 2YN6A 2ZJUA 4ZJTA 4NZBA 4QABA 2VL0A 4IL9A 2YKSA 4ILBA 4IREA
chains in the Genus database with same CATH superfamily
4NPPA 2JMKA 4YJ3E 2C5KT 4HFHA 3WTLA 5EK4A 3QOFA 5E0OA 2LSGA 5J5FA 3ZLIA 2H88A 3UUXB 4YTMA 4WNKA 2MPKA 4EYYR 5EK2A 3E08A 5J5HA 3WTMA 4CN6A 1B7TA 3C4WA 1IBLT 3CX6B 4HN9A 2YEVC 2ODUA 3MA9A 1HNWT 4WYVA 2ZLYA 3L8RA 5JRCA 2Y57A 2UXBT 5AQVB 3EDVA 4DR5T 4AKLA 4LF8T 4YHJA 5AFHA 5AQFB 5LGUB 1WCRA 2BJ0A 1L0VA 4DUYT 4HWIB 3SH1A 1MMAA 4BFQA 4ILCA 2J62A 4I4TE 3I9WA 4XAXB 4HFDA 2XQ3A 2XAGB 5FVLA 4YXDA 2XTLA 4DIDB 3IGQA 2A2FX 4YFSA 2J1DG 5JDHA 2EHOC 3Q9DA 3ZSSA 4MBQA 4QH4A 1HG2A 3RQWA 2FJEA 2WDVA 4MFRA 5H6RB 5KDMC 2BYPA 2EHOD 2EHOA 2PG8A 4TZ4C 2XSAA 4IL4A 1Z0PA 3AVRA 4N78D 1ZOYA 1NEKA 3ONXA 5L2LA 2A72A 4UF0B 4E7SA 4UM3A 2PJQA 5AQSB 2WQYA 3QNUA 2JMHA 4B3TT 4PJMA 3PUXF 2VVSA 4HEAA 4QXBB 5AFJA 2L3LA 4PFPA 2D0UA 1HFAA 3NWIA 2XJ7A 3NZPA 1US7B 2WB5A 4LFBT 3U8MA 3CQCB 2JPFA 5L4EA 3LSVA 4DV6T 3Q5WA 2BKOA 2KWIB 3C4XA 3SFEA 2IC9A 3TLTA 1IZNB 1T72A 5SYOA 3SOLA 1LVKA 2SPCA 3AE5A 3ZN0B 5AQQB 3TKLB 3B13A 2BVMA 2HPLA 4QKNA 2FBWA 4YHHT 3CK6A 2X66A 2V7JA 3TLVA 1WR6A 3TLUA 2Q9QB 2DHRA 1H7CA 4HWDA 1J5WA 2BS4A 2CCQA 5L3EB 3JADA 2CMRA 3B57A 2NW8A 5J5IA 4UR9A 3PEOA 3VHLA 1Y01A 1MMNA 3UUNA 4YSXA 3P4PA 1WRDA 3ANWB 4UVCB 5LBMA 4A56A 5FNVE 4EGWA 4G2AA 4JEUB 2C9TA 3HKCE 4UV9B 3BQLA 2ZM0A 2RPAA 4JI0T 2WDRA 4UVBB 2RP4A 2W2UA 4E7ZA 4KP3C 2NWBA 4DR2T 3J9X1 5JDLA 3CPZA 4UVAB 1X79A 3UU4A 4AQFC 2XNVA 1VRBA 2X9YA 2IIUA 3VR8A 2W62A 5AFNA 4AQFA 2VKOA 5JDMA 3PUSA 3AA0B 3SRZA 3V5UA 3U8JA 2QGSA 3SQ6A 2X68A 3VRAA 5AQJB 5JDFA 4JI1T 2XZ5A 4H9RC 4QAAA 5HEJA 4COFA 4DV3T 3O4XE 4HE8A 1XNQT 2V7IA 2D9DA 4MHCA 3UFEA 2PH9A 1KEYA 1J1JA 2E2AA 3FXEB 1XNRT 3MACA 2Y8DA 2PGZA 2DI4A 2DWGA 3FZHB 5FL0A 2UUBT 2M6BA 5JRCB 2YDSA 2V6YA 2X9XA 4DVDA 2X67A 4DBMA 4AQYT 3RIFA 1U5PA 3MZKB 4I43B 1UUSA 3U3IA 3H37A 2XQAA 1BR2A 5F3JA 3N5LA 3ZJ2A 2CA5A 3WAJA 2N1GA 4TX5A 5BR8T 3FZFB 1QSDA 5FXVA 3A8YC 5KMGP 3T8OA 2ACXA 4Z91A 4QX8B 3F31A 3PJAJ 5JMEA 1KNPA 2IW5B 2X0HA 4I55E 5HCJA 3ZCIA 2WN9A 3EDUA 3AAEB 3KINB 5J2UE 2B1EA 4DMVA 2XZ6A 2C5IT 2QYWA 3QB5A 5AFMA 2EHOB 2WAUA 4U72A 3CMLA 2G0UA 4CXXA 5AQPB 2W0GA 2KXPB 3WTNA 4QWNB 2H89A 3RF1A 2YMDA 5CJ5A 2FJBA 2BR7A 4ZS2A 4ZJSA 3AE3A 5GONE 2KSRA 4FI5A 5DJQC 5F5WA 2KT9A 3UU8A 4DBRA 2MBGA 3N9OA 2QA7A 4GK5E 4BQTA 4TV8E 1WYCA 2CLYB 3GWHA 3LG7A 2ZMAA 4C91A 2UUAT 3E22E 2BYQA 2KWHA 4P1NA 3UUMA 3SQ9A 2Q9QC 5AQHB 1KNZA 3ONJA 2LHRA 2XHEB 4ZK1A 4AKIA 3K3NA 3K8PC 3T1HT 5C8YE 1SA0E 4GOUA 2WNCA 1UV6A 4AFGA 4EAHA 1HF8A 2IHR1 3AEBA 3RYHE 4OYKA 5HXEA 5TAOA 3NRYA 3CX8B 5AQIB 1DU2A 4BJNA 3RPUA 3RYCE 3RKOA 2BR8A 4EYUA 4IT4A 2UXNB 5IHYA 4H9QC 4HFEA 3TLWA 1U4QA 4AFHA 4P0BA 4O4LE 5JDQA 2VQFT 3RI5A 3HL6A 3OKQA 4HWCA 5LNKA 2QC1B 1E7PA 3ONLC 2WMOA 1ZP0A 3RYFE 4EZ4A 3PDYA 4DR7T 2V6XA 4AFTA 3C4ZA 2K48A 1AJ3A 5JDNA 2YKSA 5IWAT 3RGLA 1HNXT 5F8PA 2LSKA 3Q5EA 4YSYA 2LSYA 3D0TA 4UY2A 2CXFA 4U2YA 3HKDE 3PUVF 2VVNA 4I50E 3AE9A 3EAMA 4H9SE 4U2ZA 2W67A 4XZCA 2J4GA 4IE4A 5JR9A 4LF4T 2C0SA 4P09A 3CKDA 3PUZF 5BP0A 2WCAA 4CQIA 3QB5K 5FXWA 4JI4T 3PUWF 2WBLA 4B6XA 3OBVE 2LE8A 1N34T 3U8LA 5LA6E 2XNTA 2K5BB 5LMNT 3AXJB 3PJAA 2A3DA 5JH7E 4YLHA 4DV2T 3N9QA 3Q2MA 2P9BA 4TWFA 2XNUA 3I0QA 3T4MA 1UX5A 1OXZA 4X1YE 4XHEA 3UU6A 4U33A 1JNZA 4A98A 2YINA 5FY7A 2A9UA 1D1BA 1XDPA 2V6YB 4TV9E 3E0ZA 2WU2A 2MYSA 2HHHT 1ZV4X 3DJBA 2Y48B 2Y6XA 2WWVA 3EABA 2V8SV 4XK9A 4DV4T 3QUJA 2CEAA 2PFVA 4LFAT 4X1KE 3OPCA 2AXDS 3DP7A 2XQ7A 5KE4A 1VCTA 2WSSV 2X51A 3HKBE 3NKZA 3L39A 3P4SA 2J47A 3C51A 3AA1B 4O2AE 3RYIE 4PJLA 2UU9T 5LJMA 2H3RA 4LF5T 3P50A 1FMVA 3RX6A 4BJMA 4ZR6A 5AFMB 2LT3A 3WTJA 3FXDB 5CB4E 2L8KA 2MAWA 2CLYC 5JTGA 4GYRA 4KHPT 4Q25A 5AQTB 3ZYKA 1W9RA 5FMNA 3I1AA 1EZ3A 5IYZE 2IC6A 2DLRA 3KBTA 1QUUA 3HKEE 3U8NA 2JQHA 4EIWA 2CRBA 2HPJA 4HWHA 4O8SA 2ZM6T 2V26A 3X1DA 4UXNB 1UGOA 5AQNB 1YD8G 3LK2B 3ZJ1A 2XM1A 4F8HA 4GYSA 5FKYA 5DABA 2E5LT 3WTHA 2CHOA 3EVYA 4JI5T 4YT0A 2IMLA 4ZI3C 4J2CA 4O4JE 1I94T 2ZM2A 3UULA 2BVLA 4NZBA 2JJ9A 2ZM8A 2BYSA 5FL1A 3K1SA 3RIAA 5LXBA 4F6RC 4ZI3D 4TN7B 1BR4A 2LSIA 4FJOA 2W63A 2LOSA 4ZRUA 4JLEA 1IJ6A 4KI0F 2Y54A 1XWMA 3CQXC 4Z90A 4GIWA 2KINB 2CHNA 1SUMB 4OK0A 4B5DA 3JAFA 3I9YA 3N9PA 4LF9T 3EI0A 1S94A 2NTXA 1VOMA 3ZT6A 4UM1A 2WDQA 3VU7H 3AECA 2BKNA 4LMKA 4JI8T 3AAAB 3F57A 3U8KA 4ZOLE 3NVOA 4O4HE 3CX7B 3ESLA 3KBUA 4TUYE 4UEMA 4L0RA 2ACZA 5H6QB 4JI2T 3TLSA 3ZT7A 4U7IA 3FB2A 5ADXL 1QLBA 1XZYA 3IBPA 3PTRB 2V7KA 3ZDHA 2XUEA 5AQOB 3ZC1A 3KFWX 3ZMTB 5JVDE 1MMDA 2PBIA 4QACA 3ZMVB 4U7YA 4HKAA 4BA9A 4O2BE 4HQPA 4JI3T 5LMUT 1N33T 5HEGA 4CXWA 3C84A 3W15B 5HXCA 5JR9B 3VRBA 1UX4A 5AFLA 5KXJA 3AXJA 3N2GE 1YXRA 3ZN1B 2X9WA 4X5TA 2X0LB 3C98B 2R6GF 2Z6EA 1HG5A 2LHNA 5AQKB 1XMQT 2WZIA 1HR0T 4XBFB 4ZI2D 2HN1A 3V5SA 2JQ9A 2X0YA 5L3GB 4P0AA 5LHHB 2I0MA 2LM9A 3RHWA 4K0UA 2H7OA 4ASKA 4CXYA 2VK9A 2LRKA 3RRWA 3PU3A 3AEGA 1J5ET 1WR0A 2KNDA 5ABHA 1UX2A 4EZ1A 3UU3A 2XAJB 5ABFA 2W00A 3FZMB 1KK7A 3MKDA 3C79A 4MLKA 5CGMA 4KX6A 2V7LA 4A5XA 3SWHA 4HGAA 4V1Av 1LKXA 3U78A 3KV9A 2XQ6A 5AQUB 3M65A 4TNVA 2WMNA 3ZMZB 2XM2A 4EXTA 3AA6B 3FBZA 3ZKRA 2ZJUA 2VB6A 4NIQA 1D0YA 4NXMT 3S4UA 2WS3A 3PUAA 2V7MA 3RC8A 4QXCB 3FHNA 4TWHA 3SIOA 2YDQA 5J1GA 3P4WA 1FMWA 2K9AA 3PE0A 4BAYB 4DV5T 4CI3B 4HFBA 2CXDA 4EOZB 5HXHA 4X64T 5FY0A 2BBJA 2V5CA 2W4XA 4PNIA 2XQ4A 3ZPOA 3MK7C 5FJVA 3NRXA 5CA1E 4DR4T 1HS7A 3HR0A 3AA7B 4AI6A 4OX9T 1I9BA 3CQGB 3IA3A 3VR9A 3KVBA 4H9NC 2GK9A 3FZKB 3PURA 2BZBA 2M6IA 2UXDT 1MMGA 3PU8A 3R6NA 1MNEA 2VWAA 3LFMA 5HEHA 3AEAA 3VKGA 3RKGA 5LXTE 5AQRB 5LBQB 4B3RT 5AFKA 1UCUA 2F4VT 2KMFA 5AQGB 5HEUA 2KZ7B 1D0XA 3HI2A 3Q5DA 4UM3S 2XSBA 2XQ5A 1MIVA 4DMWA 5DQWA 4UV8B 4AISA 4DO0A 2VL0A 3AEDA 5L3FB 3LK3B 3J7Yq 2BBHA 1OEDE 1WYBA 2LKHA 5LB7B 3Q5XA 4HTEA 5LG3A 2BG9A 3RC3A 3WTKA 5KZUA 4OFZA 2VKDA 4JUYA 4AKHA 4AQGA 3ZYMA 1HX8A 2N2NA 4H63V 3O1IA 2XY8B 2CM0A 3FZLB 5LGNB 4LF6T 4Z8XA 3LBXA 1R8IA 1T8BA 2BYRA 5HAXA 3PMZA 3UQ7A 5JR9C 4QXHB 4WW0A 1XMOT 2I59A 3BQIA 3H3AA 2QVAA 2L9QA 5FXZA 4LFCT 1GQEA 2WM9A 4DNDA 2MTQA 2DNXA 2XQYA 2XAQB 1HNZT 4IDZA 4M1PA 2CWOA 4AKGA 4IE7A 2C5JA 2NTYA 2VQET 5FY1A 2WNJA 1SE7A 5CA0E 4JYAT 2BDEA 4NUUA 4IE0A 1FIOA 1CHUA 2XAFB 4H9PC 4ISSA 2K24A 4DUZT 2XPKA 4YSZA 4B3MT 1HTJF 3P4RA 2YK0A 2NW9A 3B5MA 5L3BB 2RA1A 4ZJTA 4ILBA 5HWXA 2YU1A 5ABEA 4X65T 3RQUA 3G06A 4EEBA 5JREA 4IE5A 1D1AA 4WV9A 4X20E 1ZEEA 4AKRB 4JI6T 3JCFA 2DL1A 5AQLB 4PW8A 1FJGT 3ZCJA 4AIUA 2LJLA 3KV6A 2YMEA 1FEWA 3GUAA 3SFDA 3WTOA 4UIGA 2DWKA 4LF7T 5C2TA 3AE4A 2VL8A 2CBJA 5ABFB 2YDRA 2CE7A 4TWDA 3SS1A 2E5VA 2ODVA 4PAGA 3DTOA 2V5DA 3WTIA 1IJ5A 4OYJA 1S35A 1KF6A 2NR4A 4ZZBA 4X1IE 5ABGA 5LHIB 4UM3P 5FXXA 1W0AA 4AXPA 4MALA 5HEOA 2NW7A 4LMJA 1D1CA 3AEEA 1E1HB 3ZC0A 1WLXA 4QH1A 3LJCA 5J0ZA 1VCSA 4HFVA 4DV0T 5LCYA 3UFGA 2V1DB 2D0TA 2VKJA 3KV5A 4X62T 4PK6A 5L3DB 1O3XA 5L3CB 5HYAA 4QX7B 3LK42 1SHZC 2Y58A 2OA5A 3PV0F 3KVAA 3AE2A 4IREA 1M62A 1E2AA 2WZHA 5C3JA 1ZKEA 3GA8A 3M3ZB 2LOPA 1KFYA 4PJNA 1CUNA 1M7KA 2B76A 1N36T 2E9XC 4JEHB 4A97A 1YKHB 5CO5A 1MNDA 3IHRA 4L5GA 1Z8UA 3CVRA 2LKGA 2E9XD 2E9XA 2UXXB 4ZS3A 4ZHQE 3ZT5A 5M4YA 2XYTA 3GN5A 5FP3A 2JRKA 1IBKT 2Y7YA 2CWYA 3QC9A 2BG9E 3WI3A 2LEHA 3IEEA 3RH3A 4CI2B 2BS3A 4QH5A 3OYXA 5AFUL 4CN1A 2MOZA 1YW0A 1T98A 1UURA 1G8XA 4IHJE 5ETWA 4PIRA 4KHZF 2W8GA 4U74A 3CIRA 3UU5A 5BRXA 1T7SA 4HFIA 2UXCT 4JV5T 4D01A 5BW2A 3MXZA 4G63A 5AQMB 3AE8A 1G73A 4H9OC 3ETVA 3C64A 2UZ6A 2WWUA 5HXRA 2LM2A 2W61A 3FBLA 3AEFA 3P4QA 2BG9B 1OEDC 4IDOA 2JQKA 2JIWA 4YY3T 3P7IA 2CBIA 3NZQA 4U3CA 3LDQB 2I6HA 4YJ2E 2ES0A 1OEDA 5KX5E 1NENA 4DV7T 4IDNA 3UTKA 5CFBA 3WIPA 5HXSA 1JNRA 4B3ST 3OVUA 4IDQA 4I0UA 3LBXB 1UK5A 3O9XA 3P8CD 1MIYA 2XASB 2XQ9A 3EUHA 2PTFA 3N9LA 2WU5A 3O1JA 5JQGE 1YQ4A 2WNLA 2H7VC 3PUQA 3UT5E 3RLFF 2M67A 5FVKA 1D0ZA 4ANJA 4UELA 4ILAA 4KMCA 2YU2A 4ZZCA 3AE7A 4ZI2C 3AVSA 4EV6A 2IUBA 3T1YT 4JI7T 4DR3T 2LRLA 5LOVE 4GKKT 2UUCT 5LG4A 2CXLA 3BQKA 2BYNA 2QRXA 2D5UA 1I6ZA 4UXUA 3AE6A 2D2SA 3GMIA 4U31A 3UQ4A 2OV9A 3QK6A 2YOEA 4ZEYA 4GKJT 3CWZB 4CI1B 3VKHA 4EB6E 5HWYA 1KNRA 3K3OA 1N32T 4ALXA 3NBXX 5IUXA 4CZZB 1X9BA 2YN6A 5J2TE 4EZHA 5DQVA 3ETUA 4QABA 3ZMSB 4ERRA 2OLTA 2VASA 2WY2A 1HCIA 4YTPA 4NUVA 2CPTA 1UW6A 3JC6C 1BR0A 3UUBA 4YTNA 3O1HA 1Y64B 2NP9A 3WAKA 4ILUA 3OTOT 4UF0A 3H3MA 2Y56A 2KLQA 3JC6D 2VKHA 2XYSA 3PUGA 2X9HA 4DBQA 3N9MA 4NXNT 2XZEA 4DV1T 3K3QC 4ISTA 4CN4A 2FJDA 3PUYF 5EZYE 3ZEFB 4PK5A 2NOXA 1XDOA 2AE9A 3R84B 5LGTB 3AAIA 1MIWA 2N9DA 4IGUA 2XAHB 3RIUC 2JQQA 1BR1A 3MJXA 2WP9A 3I0OA 1LRZA 3L3PA 1WFDA 3HA4A 4DR6T 2DCFA 2FJAA 3RIUA 4TNWA 2ZJVA 3JAEA 1HX1B 4OHFA 3N9NA 4KUMB 1OWAA 2W8FA 3ZMUB 1YKEB 5EK3A 5L47A 2VURA 1LVFA 3AB3B 3ZYLA 4PJJA 2E9XB 4L9IA 4O4IE 3GN5B 4FRRA 3A7MA 4PK4A 1W09A 2Q9QD 2Q9QA 5JDGA 4ZXLA 4EEDA 2K3WA 2IDOB 2BKPA 1IAPA 4DR1T 4WBNE 4LMLA 4K0KT 1ZHCA 2BG9C 5LHGB 4IDPA 1W0BA 3N2KE 4X66T 2WZYA 4ZK4A 3L09A 5FYMA 4ZI7E 3ANWA 4ADZA 5A1LA 2HN2A 5TVCA 1YQ3A 5AINA 4QHOA 5BMVE 3ZDGA 1V9DA 5LJNA 2HH7A 1NWMX 4H63H 3F2EA 3BK9A 5LYJE 4HFCA 2LLYA 3IF8B 3A5XA 4WBOA 4HWFA 2LSJA 2BS2A 3KV4A 4GK0E 5L4HA 5LP6E 3ABVA 3C50A 4KBMB 4IIJE 3OYZA 2X00D 3AE1A 2X00A 2IAKA 4PFOA 3EHZA 1OEDB 3KDSE 3RRCA 2W66A 4IE6A 1IBMT 2XQ8A 1NAFA 5J5GA 4C90A 5HCMA 3N2OA 4JBWF 3ZSTA 2E8IA 2FUPA 4WZXA 4IL9A 3OJAA
chains in the Genus database with same CATH topology
5HEGA 4NPPA 2PGZA 2BYSA 3JADA 3RIAA 5LXBA 3C84A 4UM3A 1OEDE 3RQUA 4HFHA 1OEDA 3WTLA 4FRRA 4BQTA 5J5IA 2M6BA 4TWHA 2LKHA 3SIOA 4XK9A 5J5FA 4WV9A 5CFBA 3WIPA 4ZRUA 5LG3A 3PEOA 3P4WA 4UY2A 5AFLA 1UW6A 2BG9A 5J5HA 4DBMA 4A97A 3RIFA 3WTMA 5CO5A 4HFBA 3WTKA 3UUBA 2BYQA 5KZUA 4X5TA 2Y54A 2XQ9A 5AFJA 2XQ7A 3SQ9A 5KE4A 3EAMA 4Z90A 2YMEA 3GUAA 2LKGA 2C9TA 3WTOA 2Y56A 4LMLA 4ZK1A 2XYTA 2BG9C 2XYSA 2XQ4A 4B5DA 2WNLA 3JAFA 5FJVA 2XQAA 2Y7YA 3EI0A 2WZYA 2Y57A 4ZK4A 3P50A 2BG9E 4UM1A 2WNCA 4ZR6A 1UV6A 4TWDA 4AFGA 5AFMB 3RHWA 4LMKA 1I9BA 4Z91A 2BYRA 3PMZA 4ILAA 3UQ7A 3WTJA 5AFHA 5BP0A 5TVCA 2MAWA 4ZZCA 4QH5A 3U8KA 3WTIA 5JMEA 3U8MA 5AINA 3UU4A 2XNVA 2BJ0A 3ZDGA 5HCJA 3SH1A 4ZZBA 5L4EA 4HFCA 2LLYA 4UM3P 3TLSA 3LSVA 4PIRA 2WN9A 2M6IA 4BFQA 2BR8A 1UX2A 2W8GA 4EZ1A 4ILCA 3UU3A 2XZ6A 4HFDA 5AFNA 3U8NA 3U8LA 4HFEA 2XQ3A 5HEOA 3TLWA 3UU5A 4AFHA 3C79A 5AFMA 2XNTA 3TLTA 3ZDHA 5HEHA 4LMJA 5BRXA 5SYOA 4HFIA 3IGQA 4D01A 5BW2A 3U8JA 3SQ6A 4QH1A 3RI5A 4TNWA 5J0ZA 5L4HA 2ZJVA 2BYNA 2WNJA 5AFKA 4TWFA 3JAEA 2XNUA 2XZ5A 4UXUA 3WTNA 2QC1B 3UQ4A 3T4MA 4QAAA 5HEJA 4COFA 2X00D 2X00A 4QH4A 3RQWA 4XHEA 2UZ6A 3UU6A 2YOEA 4F8HA 2YMDA 3EHZA 1OEDB 2W8FA 4A98A 5HEUA 2BYPA 2XQ6A 2LM2A 2BR7A 3TLVA 3WTHA 2XQ8A 4TNVA 3TLUA 5J5GA 4ZJSA 4QACA 5HCMA 2KSRA 4ALXA 4UM3S 2PH9A 4AFTA 4HQPA 2XQ5A 2BG9B 1OEDC 4IL4A 3UU8A 3ZKRA 5IUXA 5L47A 2Y58A 2YN6A 2ZJUA 4ZJTA 4NZBA 4QABA 2VL0A 4IL9A 2YKSA 4ILBA 4IREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEG A;  4NPP A;  2PGZ A;  2BYS A;  3JAD A;  3RIA A;  5LXB A;  3C84 A;  4UM3 A;  1OED E;  3RQU A;  4HFH A;  1OED A;  3WTL A;  4FRR A;  4BQT A;  5J5I A;  2M6B A;  4TWH A;  2LKH A;  3SIO A;  4XK9 A;  5J5F A;  4WV9 A;  5CFB A;  3WIP A;  4ZRU A;  5LG3 A;  3PEO A;  3P4W A;  4UY2 A;  5AFL A;  1UW6 A;  2BG9 A;  5J5H A;  4DBM A;  4A97 A;  3RIF A;  3WTM A;  5CO5 A;  4HFB A;  3WTK A;  3UUB A;  2BYQ A;  5KZU A;  4X5T A;  2Y54 A;  2XQ9 A;  5AFJ A;  2XQ7 A;  3SQ9 A;  5KE4 A;  3EAM A;  4Z90 A;  2YME A;  3GUA A;  2LKG A;  2C9T A;  3WTO A;  2Y56 A;  4LML A;  4ZK1 A;  2XYT A;  2BG9 C;  2XYS A;  2XQ4 A;  4B5D A;  2WNL A;  3JAF A;  5FJV A;  2XQA A;  2Y7Y A;  3EI0 A;  2WZY A;  2Y57 A;  4ZK4 A;  3P50 A;  2BG9 E;  4UM1 A;  2WNC A;  4ZR6 A;  1UV6 A;  4TWD A;  4AFG A;  5AFM B;  3RHW A;  4LMK A;  1I9B A;  4Z91 A;  2BYR A;  3PMZ A;  4ILA A;  3UQ7 A;  3WTJ A;  5AFH A;  5BP0 A;  5TVC A;  2MAW A;  4ZZC A;  4QH5 A;  3U8K A;  3WTI A;  5JME A;  3U8M A;  5AIN A;  3UU4 A;  2XNV A;  2BJ0 A;  3ZDG A;  5HCJ A;  3SH1 A;  4ZZB A;  5L4E A;  4HFC A;  2LLY A;  4UM3 P;  3TLS A;  3LSV A;  4PIR A;  2WN9 A;  2M6I A;  4BFQ A;  2BR8 A;  1UX2 A;  2W8G A;  4EZ1 A;  4ILC A;  3UU3 A;  2XZ6 A;  4HFD A;  5AFN A;  3U8N A;  3U8L A;  4HFE A;  2XQ3 A;  5HEO A;  3TLW A;  3UU5 A;  4AFH A;  3C79 A;  5AFM A;  2XNT A;  3TLT A;  3ZDH A;  5HEH A;  4LMJ A;  5BRX A;  5SYO A;  4HFI A;  3IGQ A;  4D01 A;  5BW2 A;  3U8J A;  3SQ6 A;  4QH1 A;  3RI5 A;  4TNW A;  5J0Z A;  5L4H A;  2ZJV A;  2BYN A;  2WNJ A;  5AFK A;  4TWF A;  3JAE A;  2XNU A;  2XZ5 A;  4UXU A;  3WTN A;  2QC1 B;  3UQ4 A;  3T4M A;  4QAA A;  5HEJ A;  4COF A;  2X00 D;  2X00 A;  4QH4 A;  3RQW A;  4XHE A;  2UZ6 A;  3UU6 A;  2YOE A;  4F8H A;  2YMD A;  3EHZ A;  1OED B;  2W8F A;  4A98 A;  5HEU A;  2BYP A;  2XQ6 A;  2LM2 A;  2BR7 A;  3TLV A;  3WTH A;  2XQ8 A;  4TNV A;  3TLU A;  5J5G A;  4ZJS A;  4QAC A;  5HCM A;  2KSR A;  4ALX A;  4UM3 S;  2PH9 A;  4AFT A;  4HQP A;  2XQ5 A;  2BG9 B;  1OED C;  4IL4 A;  3UU8 A;  3ZKR A;  5IUX A;  5L47 A;  2Y58 A;  2YN6 A;  2ZJU A;  4ZJT A;  4NZB A;  4QAB A;  2VL0 A;  4IL9 A;  2YKS A;  4ILB A;  4IRE A; 
#chains in the Genus database with same CATH topology
 4NPP A;  2JMK A;  4YJ3 E;  2C5K T;  4HFH A;  3WTL A;  5EK4 A;  3QOF A;  5E0O A;  2LSG A;  5J5F A;  3ZLI A;  2H88 A;  3UUX B;  4YTM A;  4WNK A;  2MPK A;  4EYY R;  5EK2 A;  3E08 A;  5J5H A;  3WTM A;  4CN6 A;  1B7T A;  3C4W A;  1IBL T;  3CX6 B;  4HN9 A;  2YEV C;  2ODU A;  3MA9 A;  1HNW T;  4WYV A;  2ZLY A;  3L8R A;  5JRC A;  2Y57 A;  2UXB T;  5AQV B;  3EDV A;  4DR5 T;  4AKL A;  4LF8 T;  4YHJ A;  5AFH A;  5AQF B;  5LGU B;  1WCR A;  2BJ0 A;  1L0V A;  4DUY T;  4HWI B;  3SH1 A;  1MMA A;  4BFQ A;  4ILC A;  2J62 A;  4I4T E;  3I9W A;  4XAX B;  4HFD A;  2XQ3 A;  2XAG B;  5FVL A;  4YXD A;  2XTL A;  4DID B;  3IGQ A;  2A2F X;  4YFS A;  2J1D G;  5JDH A;  2EHO C;  3Q9D A;  3ZSS A;  4MBQ A;  4QH4 A;  1HG2 A;  3RQW A;  2FJE A;  2WDV A;  4MFR A;  5H6R B;  5KDM C;  2BYP A;  2EHO D;  2EHO A;  2PG8 A;  4TZ4 C;  2XSA A;  4IL4 A;  1Z0P A;  3AVR A;  4N78 D;  1ZOY A;  1NEK A;  3ONX A;  5L2L A;  2A72 A;  4UF0 B;  4E7S A;  4UM3 A;  2PJQ A;  5AQS B;  2WQY A;  3QNU A;  2JMH A;  4B3T T;  4PJM A;  3PUX F;  2VVS A;  4HEA A;  4QXB B;  5AFJ A;  2L3L A;  4PFP A;  2D0U A;  1HFA A;  3NWI A;  2XJ7 A;  3NZP A;  1US7 B;  2WB5 A;  4LFB T;  3U8M A;  3CQC B;  2JPF A;  5L4E A;  3LSV A;  4DV6 T;  3Q5W A;  2BKO A;  2KWI B;  3C4X A;  3SFE A;  2IC9 A;  3TLT A;  1IZN B;  1T72 A;  5SYO A;  3SOL A;  1LVK A;  2SPC A;  3AE5 A;  3ZN0 B;  5AQQ B;  3TKL B;  3B13 A;  2BVM A;  2HPL A;  4QKN A;  2FBW A;  4YHH T;  3CK6 A;  2X66 A;  2V7J A;  3TLV A;  1WR6 A;  3TLU A;  2Q9Q B;  2DHR A;  1H7C A;  4HWD A;  1J5W A;  2BS4 A;  2CCQ A;  5L3E B;  3JAD A;  2CMR A;  3B57 A;  2NW8 A;  5J5I A;  4UR9 A;  3PEO A;  3VHL A;  1Y01 A;  1MMN A;  3UUN A;  4YSX A;  3P4P A;  1WRD A;  3ANW B;  4UVC B;  5LBM A;  4A56 A;  5FNV E;  4EGW A;  4G2A A;  4JEU B;  2C9T A;  3HKC E;  4UV9 B;  3BQL A;  2ZM0 A;  2RPA A;  4JI0 T;  2WDR A;  4UVB B;  2RP4 A;  2W2U A;  4E7Z A;  4KP3 C;  2NWB A;  4DR2 T;  3J9X 1;  5JDL A;  3CPZ A;  4UVA B;  1X79 A;  3UU4 A;  4AQF C;  2XNV A;  1VRB A;  2X9Y A;  2IIU A;  3VR8 A;  2W62 A;  5AFN A;  4AQF A;  2VKO A;  5JDM A;  3PUS A;  3AA0 B;  3SRZ A;  3V5U A;  3U8J A;  2QGS A;  3SQ6 A;  2X68 A;  3VRA A;  5AQJ B;  5JDF A;  4JI1 T;  2XZ5 A;  4H9R C;  4QAA A;  5HEJ A;  4COF A;  4DV3 T;  3O4X E;  4HE8 A;  1XNQ T;  2V7I A;  2D9D A;  4MHC A;  3UFE A;  2PH9 A;  1KEY A;  1J1J A;  2E2A A;  3FXE B;  1XNR T;  3MAC A;  2Y8D A;  2PGZ A;  2DI4 A;  2DWG A;  3FZH B;  5FL0 A;  2UUB T;  2M6B A;  5JRC B;  2YDS A;  2V6Y A;  2X9X A;  4DVD A;  2X67 A;  4DBM A;  4AQY T;  3RIF A;  1U5P A;  3MZK B;  4I43 B;  1UUS A;  3U3I A;  3H37 A;  2XQA A;  1BR2 A;  5F3J A;  3N5L A;  3ZJ2 A;  2CA5 A;  3WAJ A;  2N1G A;  4TX5 A;  5BR8 T;  3FZF B;  1QSD A;  5FXV A;  3A8Y C;  5KMG P;  3T8O A;  2ACX A;  4Z91 A;  4QX8 B;  3F31 A;  3PJA J;  5JME A;  1KNP A;  2IW5 B;  2X0H A;  4I55 E;  5HCJ A;  3ZCI A;  2WN9 A;  3EDU A;  3AAE B;  3KIN B;  5J2U E;  2B1E A;  4DMV A;  2XZ6 A;  2C5I T;  2QYW A;  3QB5 A;  5AFM A;  2EHO B;  2WAU A;  4U72 A;  3CML A;  2G0U A;  4CXX A;  5AQP B;  2W0G A;  2KXP B;  3WTN A;  4QWN B;  2H89 A;  3RF1 A;  2YMD A;  5CJ5 A;  2FJB A;  2BR7 A;  4ZS2 A;  4ZJS A;  3AE3 A;  5GON E;  2KSR A;  4FI5 A;  5DJQ C;  5F5W A;  2KT9 A;  3UU8 A;  4DBR A;  2MBG A;  3N9O A;  2QA7 A;  4GK5 E;  4BQT A;  4TV8 E;  1WYC A;  2CLY B;  3GWH A;  3LG7 A;  2ZMA A;  4C91 A;  2UUA T;  3E22 E;  2BYQ A;  2KWH A;  4P1N A;  3UUM A;  3SQ9 A;  2Q9Q C;  5AQH B;  1KNZ A;  3ONJ A;  2LHR A;  2XHE B;  4ZK1 A;  4AKI A;  3K3N A;  3K8P C;  3T1H T;  5C8Y E;  1SA0 E;  4GOU A;  2WNC A;  1UV6 A;  4AFG A;  4EAH A;  1HF8 A;  2IHR 1;  3AEB A;  3RYH E;  4OYK A;  5HXE A;  5TAO A;  3NRY A;  3CX8 B;  5AQI B;  1DU2 A;  4BJN A;  3RPU A;  3RYC E;  3RKO A;  2BR8 A;  4EYU A;  4IT4 A;  2UXN B;  5IHY A;  4H9Q C;  4HFE A;  3TLW A;  1U4Q A;  4AFH A;  4P0B A;  4O4L E;  5JDQ A;  2VQF T;  3RI5 A;  3HL6 A;  3OKQ A;  4HWC A;  5LNK A;  2QC1 B;  1E7P A;  3ONL C;  2WMO A;  1ZP0 A;  3RYF E;  4EZ4 A;  3PDY A;  4DR7 T;  2V6X A;  4AFT A;  3C4Z A;  2K48 A;  1AJ3 A;  5JDN A;  2YKS A;  5IWA T;  3RGL A;  1HNX T;  5F8P A;  2LSK A;  3Q5E A;  4YSY A;  2LSY A;  3D0T A;  4UY2 A;  2CXF A;  4U2Y A;  3HKD E;  3PUV F;  2VVN A;  4I50 E;  3AE9 A;  3EAM A;  4H9S E;  4U2Z A;  2W67 A;  4XZC A;  2J4G A;  4IE4 A;  5JR9 A;  4LF4 T;  2C0S A;  4P09 A;  3CKD A;  3PUZ F;  5BP0 A;  2WCA A;  4CQI A;  3QB5 K;  5FXW A;  4JI4 T;  3PUW F;  2WBL A;  4B6X A;  3OBV E;  2LE8 A;  1N34 T;  3U8L A;  5LA6 E;  2XNT A;  2K5B B;  5LMN T;  3AXJ B;  3PJA A;  2A3D A;  5JH7 E;  4YLH A;  4DV2 T;  3N9Q A;  3Q2M A;  2P9B A;  4TWF A;  2XNU A;  3I0Q A;  3T4M A;  1UX5 A;  1OXZ A;  4X1Y E;  4XHE A;  3UU6 A;  4U33 A;  1JNZ A;  4A98 A;  2YIN A;  5FY7 A;  2A9U A;  1D1B A;  1XDP A;  2V6Y B;  4TV9 E;  3E0Z A;  2WU2 A;  2MYS A;  2HHH T;  1ZV4 X;  3DJB A;  2Y48 B;  2Y6X A;  2WWV A;  3EAB A;  2V8S V;  4XK9 A;  4DV4 T;  3QUJ A;  2CEA A;  2PFV A;  4LFA T;  4X1K E;  3OPC A;  2AXD S;  3DP7 A;  2XQ7 A;  5KE4 A;  1VCT A;  2WSS V;  2X51 A;  3HKB E;  3NKZ A;  3L39 A;  3P4S A;  2J47 A;  3C51 A;  3AA1 B;  4O2A E;  3RYI E;  4PJL A;  2UU9 T;  5LJM A;  2H3R A;  4LF5 T;  3P50 A;  1FMV A;  3RX6 A;  4BJM A;  4ZR6 A;  5AFM B;  2LT3 A;  3WTJ A;  3FXD B;  5CB4 E;  2L8K A;  2MAW A;  2CLY C;  5JTG A;  4GYR A;  4KHP T;  4Q25 A;  5AQT B;  3ZYK A;  1W9R A;  5FMN A;  3I1A A;  1EZ3 A;  5IYZ E;  2IC6 A;  2DLR A;  3KBT A;  1QUU A;  3HKE E;  3U8N A;  2JQH A;  4EIW A;  2CRB A;  2HPJ A;  4HWH A;  4O8S A;  2ZM6 T;  2V26 A;  3X1D A;  4UXN B;  1UGO A;  5AQN B;  1YD8 G;  3LK2 B;  3ZJ1 A;  2XM1 A;  4F8H A;  4GYS A;  5FKY A;  5DAB A;  2E5L T;  3WTH A;  2CHO A;  3EVY A;  4JI5 T;  4YT0 A;  2IML A;  4ZI3 C;  4J2C A;  4O4J E;  1I94 T;  2ZM2 A;  3UUL A;  2BVL A;  4NZB A;  2JJ9 A;  2ZM8 A;  2BYS A;  5FL1 A;  3K1S A;  3RIA A;  5LXB A;  4F6R C;  4ZI3 D;  4TN7 B;  1BR4 A;  2LSI A;  4FJO A;  2W63 A;  2LOS A;  4ZRU A;  4JLE A;  1IJ6 A;  4KI0 F;  2Y54 A;  1XWM A;  3CQX C;  4Z90 A;  4GIW A;  2KIN B;  2CHN A;  1SUM B;  4OK0 A;  4B5D A;  3JAF A;  3I9Y A;  3N9P A;  4LF9 T;  3EI0 A;  1S94 A;  2NTX A;  1VOM A;  3ZT6 A;  4UM1 A;  2WDQ A;  3VU7 H;  3AEC A;  2BKN A;  4LMK A;  4JI8 T;  3AAA B;  3F57 A;  3U8K A;  4ZOL E;  3NVO A;  4O4H E;  3CX7 B;  3ESL A;  3KBU A;  4TUY E;  4UEM A;  4L0R A;  2ACZ A;  5H6Q B;  4JI2 T;  3TLS A;  3ZT7 A;  4U7I A;  3FB2 A;  5ADX L;  1QLB A;  1XZY A;  3IBP A;  3PTR B;  2V7K A;  3ZDH A;  2XUE A;  5AQO B;  3ZC1 A;  3KFW X;  3ZMT B;  5JVD E;  1MMD A;  2PBI A;  4QAC A;  3ZMV B;  4U7Y A;  4HKA A;  4BA9 A;  4O2B E;  4HQP A;  4JI3 T;  5LMU T;  1N33 T;  5HEG A;  4CXW A;  3C84 A;  3W15 B;  5HXC A;  5JR9 B;  3VRB A;  1UX4 A;  5AFL A;  5KXJ A;  3AXJ A;  3N2G E;  1YXR A;  3ZN1 B;  2X9W A;  4X5T A;  2X0L B;  3C98 B;  2R6G F;  2Z6E A;  1HG5 A;  2LHN A;  5AQK B;  1XMQ T;  2WZI A;  1HR0 T;  4XBF B;  4ZI2 D;  2HN1 A;  3V5S A;  2JQ9 A;  2X0Y A;  5L3G B;  4P0A A;  5LHH B;  2I0M A;  2LM9 A;  3RHW A;  4K0U A;  2H7O A;  4ASK A;  4CXY A;  2VK9 A;  2LRK A;  3RRW A;  3PU3 A;  3AEG A;  1J5E T;  1WR0 A;  2KND A;  5ABH A;  1UX2 A;  4EZ1 A;  3UU3 A;  2XAJ B;  5ABF A;  2W00 A;  3FZM B;  1KK7 A;  3MKD A;  3C79 A;  4MLK A;  5CGM A;  4KX6 A;  2V7L A;  4A5X A;  3SWH A;  4HGA A;  4V1A v;  1LKX A;  3U78 A;  3KV9 A;  2XQ6 A;  5AQU B;  3M65 A;  4TNV A;  2WMN A;  3ZMZ B;  2XM2 A;  4EXT A;  3AA6 B;  3FBZ A;  3ZKR A;  2ZJU A;  2VB6 A;  4NIQ A;  1D0Y A;  4NXM T;  3S4U A;  2WS3 A;  3PUA A;  2V7M A;  3RC8 A;  4QXC B;  3FHN A;  4TWH A;  3SIO A;  2YDQ A;  5J1G A;  3P4W A;  1FMW A;  2K9A A;  3PE0 A;  4BAY B;  4DV5 T;  4CI3 B;  4HFB A;  2CXD A;  4EOZ B;  5HXH A;  4X64 T;  5FY0 A;  2BBJ A;  2V5C A;  2W4X A;  4PNI A;  2XQ4 A;  3ZPO A;  3MK7 C;  5FJV A;  3NRX A;  5CA1 E;  4DR4 T;  1HS7 A;  3HR0 A;  3AA7 B;  4AI6 A;  4OX9 T;  1I9B A;  3CQG B;  3IA3 A;  3VR9 A;  3KVB A;  4H9N C;  2GK9 A;  3FZK B;  3PUR A;  2BZB A;  2M6I A;  2UXD T;  1MMG A;  3PU8 A;  3R6N A;  1MNE A;  2VWA A;  3LFM A;  5HEH A;  3AEA A;  3VKG A;  3RKG A;  5LXT E;  5AQR B;  5LBQ B;  4B3R T;  5AFK A;  1UCU A;  2F4V T;  2KMF A;  5AQG B;  5HEU A;  2KZ7 B;  1D0X A;  3HI2 A;  3Q5D A;  4UM3 S;  2XSB A;  2XQ5 A;  1MIV A;  4DMW A;  5DQW A;  4UV8 B;  4AIS A;  4DO0 A;  2VL0 A;  3AED A;  5L3F B;  3LK3 B;  3J7Y q;  2BBH A;  1OED E;  1WYB A;  2LKH A;  5LB7 B;  3Q5X A;  4HTE A;  5LG3 A;  2BG9 A;  3RC3 A;  3WTK A;  5KZU A;  4OFZ A;  2VKD A;  4JUY A;  4AKH A;  4AQG A;  3ZYM A;  1HX8 A;  2N2N A;  4H63 V;  3O1I A;  2XY8 B;  2CM0 A;  3FZL B;  5LGN B;  4LF6 T;  4Z8X A;  3LBX A;  1R8I A;  1T8B A;  2BYR A;  5HAX A;  3PMZ A;  3UQ7 A;  5JR9 C;  4QXH B;  4WW0 A;  1XMO T;  2I59 A;  3BQI A;  3H3A A;  2QVA A;  2L9Q A;  5FXZ A;  4LFC T;  1GQE A;  2WM9 A;  4DND A;  2MTQ A;  2DNX A;  2XQY A;  2XAQ B;  1HNZ T;  4IDZ A;  4M1P A;  2CWO A;  4AKG A;  4IE7 A;  2C5J A;  2NTY A;  2VQE T;  5FY1 A;  2WNJ A;  1SE7 A;  5CA0 E;  4JYA T;  2BDE A;  4NUU A;  4IE0 A;  1FIO A;  1CHU A;  2XAF B;  4H9P C;  4ISS A;  2K24 A;  4DUZ T;  2XPK A;  4YSZ A;  4B3M T;  1HTJ F;  3P4R A;  2YK0 A;  2NW9 A;  3B5M A;  5L3B B;  2RA1 A;  4ZJT A;  4ILB A;  5HWX A;  2YU1 A;  5ABE A;  4X65 T;  3RQU A;  3G06 A;  4EEB A;  5JRE A;  4IE5 A;  1D1A A;  4WV9 A;  4X20 E;  1ZEE A;  4AKR B;  4JI6 T;  3JCF A;  2DL1 A;  5AQL B;  4PW8 A;  1FJG T;  3ZCJ A;  4AIU A;  2LJL A;  3KV6 A;  2YME A;  1FEW A;  3GUA A;  3SFD A;  3WTO A;  4UIG A;  2DWK A;  4LF7 T;  5C2T A;  3AE4 A;  2VL8 A;  2CBJ A;  5ABF B;  2YDR A;  2CE7 A;  4TWD A;  3SS1 A;  2E5V A;  2ODV A;  4PAG A;  3DTO A;  2V5D A;  3WTI A;  1IJ5 A;  4OYJ A;  1S35 A;  1KF6 A;  2NR4 A;  4ZZB A;  4X1I E;  5ABG A;  5LHI B;  4UM3 P;  5FXX A;  1W0A A;  4AXP A;  4MAL A;  5HEO A;  2NW7 A;  4LMJ A;  1D1C A;  3AEE A;  1E1H B;  3ZC0 A;  1WLX A;  4QH1 A;  3LJC A;  5J0Z A;  1VCS A;  4HFV A;  4DV0 T;  5LCY A;  3UFG A;  2V1D B;  2D0T A;  2VKJ A;  3KV5 A;  4X62 T;  4PK6 A;  5L3D B;  1O3X A;  5L3C B;  5HYA A;  4QX7 B;  3LK4 2;  1SHZ C;  2Y58 A;  2OA5 A;  3PV0 F;  3KVA A;  3AE2 A;  4IRE A;  1M62 A;  1E2A A;  2WZH A;  5C3J A;  1ZKE A;  3GA8 A;  3M3Z B;  2LOP A;  1KFY A;  4PJN A;  1CUN A;  1M7K A;  2B76 A;  1N36 T;  2E9X C;  4JEH B;  4A97 A;  1YKH B;  5CO5 A;  1MND A;  3IHR A;  4L5G A;  1Z8U A;  3CVR A;  2LKG A;  2E9X D;  2E9X A;  2UXX B;  4ZS3 A;  4ZHQ E;  3ZT5 A;  5M4Y A;  2XYT A;  3GN5 A;  5FP3 A;  2JRK A;  1IBK T;  2Y7Y A;  2CWY A;  3QC9 A;  2BG9 E;  3WI3 A;  2LEH A;  3IEE A;  3RH3 A;  4CI2 B;  2BS3 A;  4QH5 A;  3OYX A;  5AFU L;  4CN1 A;  2MOZ A;  1YW0 A;  1T98 A;  1UUR A;  1G8X A;  4IHJ E;  5ETW A;  4PIR A;  4KHZ F;  2W8G A;  4U74 A;  3CIR A;  3UU5 A;  5BRX A;  1T7S A;  4HFI A;  2UXC T;  4JV5 T;  4D01 A;  5BW2 A;  3MXZ A;  4G63 A;  5AQM B;  3AE8 A;  1G73 A;  4H9O C;  3ETV A;  3C64 A;  2UZ6 A;  2WWU A;  5HXR A;  2LM2 A;  2W61 A;  3FBL A;  3AEF A;  3P4Q A;  2BG9 B;  1OED C;  4IDO A;  2JQK A;  2JIW A;  4YY3 T;  3P7I A;  2CBI A;  3NZQ A;  4U3C A;  3LDQ B;  2I6H A;  4YJ2 E;  2ES0 A;  1OED A;  5KX5 E;  1NEN A;  4DV7 T;  4IDN A;  3UTK A;  5CFB A;  3WIP A;  5HXS A;  1JNR A;  4B3S T;  3OVU A;  4IDQ A;  4I0U A;  3LBX B;  1UK5 A;  3O9X A;  3P8C D;  1MIY A;  2XAS B;  2XQ9 A;  3EUH A;  2PTF A;  3N9L A;  2WU5 A;  3O1J A;  5JQG E;  1YQ4 A;  2WNL A;  2H7V C;  3PUQ A;  3UT5 E;  3RLF F;  2M67 A;  5FVK A;  1D0Z A;  4ANJ A;  4UEL A;  4ILA A;  4KMC A;  2YU2 A;  4ZZC A;  3AE7 A;  4ZI2 C;  3AVS A;  4EV6 A;  2IUB A;  3T1Y T;  4JI7 T;  4DR3 T;  2LRL A;  5LOV E;  4GKK T;  2UUC T;  5LG4 A;  2CXL A;  3BQK A;  2BYN A;  2QRX A;  2D5U A;  1I6Z A;  4UXU A;  3AE6 A;  2D2S A;  3GMI A;  4U31 A;  3UQ4 A;  2OV9 A;  3QK6 A;  2YOE A;  4ZEY A;  4GKJ T;  3CWZ B;  4CI1 B;  3VKH A;  4EB6 E;  5HWY A;  1KNR A;  3K3O A;  1N32 T;  4ALX A;  3NBX X;  5IUX A;  4CZZ B;  1X9B A;  2YN6 A;  5J2T E;  4EZH A;  5DQV A;  3ETU A;  4QAB A;  3ZMS B;  4ERR A;  2OLT A;  2VAS A;  2WY2 A;  1HCI A;  4YTP A;  4NUV A;  2CPT A;  1UW6 A;  3JC6 C;  1BR0 A;  3UUB A;  4YTN A;  3O1H A;  1Y64 B;  2NP9 A;  3WAK A;  4ILU A;  3OTO T;  4UF0 A;  3H3M A;  2Y56 A;  2KLQ A;  3JC6 D;  2VKH A;  2XYS A;  3PUG A;  2X9H A;  4DBQ A;  3N9M A;  4NXN T;  2XZE A;  4DV1 T;  3K3Q C;  4IST A;  4CN4 A;  2FJD A;  3PUY F;  5EZY E;  3ZEF B;  4PK5 A;  2NOX A;  1XDO A;  2AE9 A;  3R84 B;  5LGT B;  3AAI A;  1MIW A;  2N9D A;  4IGU A;  2XAH B;  3RIU C;  2JQQ A;  1BR1 A;  3MJX A;  2WP9 A;  3I0O A;  1LRZ A;  3L3P A;  1WFD A;  3HA4 A;  4DR6 T;  2DCF A;  2FJA A;  3RIU A;  4TNW A;  2ZJV A;  3JAE A;  1HX1 B;  4OHF A;  3N9N A;  4KUM B;  1OWA A;  2W8F A;  3ZMU B;  1YKE B;  5EK3 A;  5L47 A;  2VUR A;  1LVF A;  3AB3 B;  3ZYL A;  4PJJ A;  2E9X B;  4L9I A;  4O4I E;  3GN5 B;  4FRR A;  3A7M A;  4PK4 A;  1W09 A;  2Q9Q D;  2Q9Q A;  5JDG A;  4ZXL A;  4EED A;  2K3W A;  2IDO B;  2BKP A;  1IAP A;  4DR1 T;  4WBN E;  4LML A;  4K0K T;  1ZHC A;  2BG9 C;  5LHG B;  4IDP A;  1W0B A;  3N2K E;  4X66 T;  2WZY A;  4ZK4 A;  3L09 A;  5FYM A;  4ZI7 E;  3ANW A;  4ADZ A;  5A1L A;  2HN2 A;  5TVC A;  1YQ3 A;  5AIN A;  4QHO A;  5BMV E;  3ZDG A;  1V9D A;  5LJN A;  2HH7 A;  1NWM X;  4H63 H;  3F2E A;  3BK9 A;  5LYJ E;  4HFC A;  2LLY A;  3IF8 B;  3A5X A;  4WBO A;  4HWF A;  2LSJ A;  2BS2 A;  3KV4 A;  4GK0 E;  5L4H A;  5LP6 E;  3ABV A;  3C50 A;  4KBM B;  4IIJ E;  3OYZ A;  2X00 D;  3AE1 A;  2X00 A;  2IAK A;  4PFO A;  3EHZ A;  1OED B;  3KDS E;  3RRC A;  2W66 A;  4IE6 A;  1IBM T;  2XQ8 A;  1NAF A;  5J5G A;  4C90 A;  5HCM A;  3N2O A;  4JBW F;  3ZST A;  2E8I A;  2FUP A;  4WZX A;  4IL9 A;  3OJA A; 
#chains in the Genus database with same CATH homology
 5HEG A;  4NPP A;  2PGZ A;  2BYS A;  3JAD A;  3RIA A;  5LXB A;  3C84 A;  4UM3 A;  1OED E;  3RQU A;  4HFH A;  1OED A;  3WTL A;  4FRR A;  4BQT A;  5J5I A;  2M6B A;  4TWH A;  2LKH A;  3SIO A;  4XK9 A;  5J5F A;  4WV9 A;  5CFB A;  3WIP A;  4ZRU A;  5LG3 A;  3PEO A;  3P4W A;  4UY2 A;  5AFL A;  1UW6 A;  2BG9 A;  5J5H A;  4DBM A;  4A97 A;  3RIF A;  3WTM A;  5CO5 A;  4HFB A;  3WTK A;  3UUB A;  2BYQ A;  5KZU A;  4X5T A;  2Y54 A;  2XQ9 A;  5AFJ A;  2XQ7 A;  3SQ9 A;  5KE4 A;  3EAM A;  4Z90 A;  2YME A;  3GUA A;  2LKG A;  2C9T A;  3WTO A;  2Y56 A;  4LML A;  4ZK1 A;  2XYT A;  2BG9 C;  2XYS A;  2XQ4 A;  4B5D A;  2WNL A;  3JAF A;  5FJV A;  2XQA A;  2Y7Y A;  3EI0 A;  2WZY A;  2Y57 A;  4ZK4 A;  3P50 A;  2BG9 E;  4UM1 A;  2WNC A;  4ZR6 A;  1UV6 A;  4TWD A;  4AFG A;  5AFM B;  3RHW A;  4LMK A;  1I9B A;  4Z91 A;  2BYR A;  3PMZ A;  4ILA A;  3UQ7 A;  3WTJ A;  5AFH A;  5BP0 A;  5TVC A;  2MAW A;  4ZZC A;  4QH5 A;  3U8K A;  3WTI A;  5JME A;  3U8M A;  5AIN A;  3UU4 A;  2XNV A;  2BJ0 A;  3ZDG A;  5HCJ A;  3SH1 A;  4ZZB A;  5L4E A;  4HFC A;  2LLY A;  4UM3 P;  3TLS A;  3LSV A;  4PIR A;  2WN9 A;  2M6I A;  4BFQ A;  2BR8 A;  1UX2 A;  2W8G A;  4EZ1 A;  4ILC A;  3UU3 A;  2XZ6 A;  4HFD A;  5AFN A;  3U8N A;  3U8L A;  4HFE A;  2XQ3 A;  5HEO A;  3TLW A;  3UU5 A;  4AFH A;  3C79 A;  5AFM A;  2XNT A;  3TLT A;  3ZDH A;  5HEH A;  4LMJ A;  5BRX A;  5SYO A;  4HFI A;  3IGQ A;  4D01 A;  5BW2 A;  3U8J A;  3SQ6 A;  4QH1 A;  3RI5 A;  4TNW A;  5J0Z A;  5L4H A;  2ZJV A;  2BYN A;  2WNJ A;  5AFK A;  4TWF A;  3JAE A;  2XNU A;  2XZ5 A;  4UXU A;  3WTN A;  2QC1 B;  3UQ4 A;  3T4M A;  4QAA A;  5HEJ A;  4COF A;  2X00 D;  2X00 A;  4QH4 A;  3RQW A;  4XHE A;  2UZ6 A;  3UU6 A;  2YOE A;  4F8H A;  2YMD A;  3EHZ A;  1OED B;  2W8F A;  4A98 A;  5HEU A;  2BYP A;  2XQ6 A;  2LM2 A;  2BR7 A;  3TLV A;  3WTH A;  2XQ8 A;  4TNV A;  3TLU A;  5J5G A;  4ZJS A;  4QAC A;  5HCM A;  2KSR A;  4ALX A;  4UM3 S;  2PH9 A;  4AFT A;  4HQP A;  2XQ5 A;  2BG9 B;  1OED C;  4IL4 A;  3UU8 A;  3ZKR A;  5IUX A;  5L47 A;  2Y58 A;  2YN6 A;  2ZJU A;  4ZJT A;  4NZB A;  4QAB A;  2VL0 A;  4IL9 A;  2YKS A;  4ILB A;  4IRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...