4QH4A

The glic pentameric ligand-gated ion channel (wild-type) crystallized in acetate buffer at ph3
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 90
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh4A01
5FJVA 2XQAA 3RQWA 3UQ7A 5J5IA 5KE4A 1UX2A 4HFCA 4COFA 2LKHA 2UZ6A 4TNWA 2WNLA 3UU8A 4TNVA 3LSVA 2BR8A 3SQ6A 3WTJA 5SYOA 4QAAA 2XYTA 5LG3A 3JADA 4QH1A 2BG9C 2YKSA 5AINA 3ZDGA 5HEOA 4AFTA 5HCJA 3C79A 4ZZCA 3WTNA 4DBMA 2BG9E 2VL0A 4ILBA 5L4EA 3U8MA 2BJ0A 2XQ9A 2LM2A 2BR7A 4HFDA 3WTIA 3TLTA 2M6IA 4IREA 4QH4A 4UXUA 4HFHA 4IL9A 3TLWA 2XQ7A 3U8KA 5J5FA 4LMKA 2XQ6A 2XQ4A 4TWFA 2W8GA 2ZJUA 3JAEA 4D01A 2WNCA 3U8NA 3ZDHA 5BW2A 5BP0A 3T4MA 3EI0A 4A97A 4AFGA 2X00A 3SIOA 3C84A 2YMDA 2LKGA 5LXBA 4QACA 5HEGA 4LMLA 1OEDB 5IUXA 5AFJA 2LLYA 4NPPA 5HEHA 4TWHA 2WN9A 2XYSA 2XZ5A 3RI5A 4HQPA 3UU6A 4ZJSA 4XK9A 2XQ8A 5AFHA 4LMJA 4BQTA 4PIRA 3RQUA 3P4WA 3PMZA 4ZJTA 3WTLA 4Z91A 4ILCA 3UUBA 4ZRUA 5J0ZA 2PH9A 4EZ1A 3TLSA 5HEUA 2Y7YA 2XNVA 4IL4A 2M6BA 3UU5A 2BYNA 2Y56A 2C9TA 5J5GA 4UY2A 4HFIA 4F8HA 3WIPA 1OEDA 3UU4A 4UM3P 2YOEA 4ZR6A 2XQ5A 2WZYA 3WTHA 4A98A 3IGQA 5TVCA 3TLVA 3UQ4A 5HCMA 4ZZBA 1UW6A 2BYQA 2Y58A 3U8LA 3TLUA 2YMEA 3ZKRA 3EAMA 2BG9B 2BYPA 2W8FA 2ZJVA 4Z90A 5BRXA 3RIFA 5AFKA 5J5HA 3P50A 5CFBA 4ILAA 4QH5A 4UM1A 4XHEA 4X5TA 2XNUA 2BYSA 4FRRA 5L4HA 2PGZA 2Y54A 3RHWA 4HFEA 3U8JA 5AFMB 4UM3A 3JAFA 1OEDC 3UU3A 4HFBA 3WTMA 2XNTA 4UM3S 2XQ3A 5AFMA 1OEDE 2KSRA 3WTKA 2X00D 3WTOA 4B5DA 5AFNA 5JMEA 5KZUA 2MAWA 2Y57A 3GUAA 3PEOA 5L47A 4NZBA 1I9BA 2BG9A 4WV9A 4ALXA 2XZ6A 2QC1B 1UV6A 3SH1A 5CO5A 2WNJA 5HEJA 4BFQA 4ZK1A 4AFHA 3EHZA 4ZK4A 2YN6A 4TWDA 3RIAA 2BYRA 5AFLA 3SQ9A 4QABA
chains in the Genus database with same CATH superfamily
4EGWA 3FHNA 3SOLA 4ILUA 2WNLA 2I0MA 3MKDA 4LF4T 1HNZT 2IDOB 4QX7B 4XAXB 5LYJE 2LM2A 3U3IA 2VWAA 3NZQA 4HFHA 1D0YA 2LHNA 2XQ6A 3AE5A 4O4JE 4U31A 3RRWA 3EI0A 2NTYA 4DR2T 5JR9A 4X1IE 3HKBE 4HWFA 2X9YA 2X68A 2XAQB 3J9X1 4NXMT 4L0RA 2CM0A 2RPAA 2UXDT 3H3AA 5F8PA 4ILCA 4JV5T 4MALA 3T1YT 1FIOA 2XNVA 4H9NC 4AQYT 3LK2B 3C50A 4IT4A 4UM3P 4O8SA 3M65A 1HTJF 3UQ4A 4PW8A 4IE5A 4ZZBA 2WM9A 3ZYLA 3MACA 3ZCIA 4HWIB 2X9XA 2N2NA 3P50A 2BYSA 2J47A 5L4HA 2WMOA 4LFCT 3ANWA 3WTKA 2X51A 2GK9A 4B5DA 4JI8T 3KV4A 4TX5A 5AQUB 1XMQT 1FMWA 1LVKA 4ALXA 2Z6EA 4I4TE 2HPJA 4PAGA 2OV9A 2YN6A 1MIYA 3RRCA 2DWKA 1HG2A 4X65T 1XWMA 5HCJA 3H37A 3O1IA 3AAIA 2V6YA 2A9UA 5F3JA 4DR6T 3P4RA 2XQ4A 4F6RC 5BW2A 4AFGA 5H6QB 2HHHT 4JI0T 3C84A 4EEBA 1WFDA 5AFJA 3E08A 5GONE 4ZI2D 4AISA 4ASKA 2BVLA 4H63V 4ZJTA 3PJAJ 3PUXF 2XSAA 4EZ1A 3NWIA 3BQLA 3AEDA 2YU2A 4DV3T 5AQKB 5JR9B 2UUAT 1VOMA 3ZSTA 3UTKA 3JC6C 3FBZA 1LVFA 4IGUA 5FXWA 4B3RT 1WCRA 4QXHB 1D0ZA 2WMNA 4FRRA 4X1YE 4UM3A 4TUYE 2ZM6T 5CA1E 3SFDA 2ZM2A 4LFAT 4UF0B 4DO0A 2IMLA 3SRZA 2D0TA 3LG7A 4EOZB 2BBJA 3PUVF 5AFUL 4EZ4A 1D0XA 4TWDA 1H7CA 2BYRA 5ABGA 2LOPA 4PFPA 4TZ4C 2ZLYA 5BMVE 4ZS3A 1KNRA 3ZT7A 1G73A 2WU5A 4QAAA 2XYTA 1EZ3A 4UF0A 2D2SA 2Y8DA 5JDLA 3QK6A 5IHYA 3CMLA 4QH4A 3B13A 4DMWA 4IL9A 1XNRT 1Y64B 2KXPB 3O1JA 3ZN1B 3UFGA 2WAUA 2HPLA 2UXXB 1DU2A 4H63H 4DNDA 4LMLA 2LLYA 4HQPA 2JPFA 4ZOLE 2H7OA 2XQ8A 2V7LA 1Y01A 2YDRA 3PMZA 4B3MT 2ZM8A 3LFMA 3GMIA 4ZXLA 2MOZA 2Y56A 3WIPA 2C0SA 3G06A 4X66T 4ZR6A 3RYHE 4DV0T 4OYKA 5CJ5A 1UW6A 3ETUA 3HKEE 4EIWA 4YTPA 5J5HA 4X5TA 3K3QC 2IC6A 2C5IT 2MTQA 2BS2A 4U3CA 2OLTA 1XDPA 3PUZF 5JMEA 2MAWA 3ZEFB 2WWVA 3AE8A 1G8XA 2KNDA 3VKHA 5HEJA 3X1DA 2W61A 3EHZA 2K9AA 3RQWA 2E9XC 2UUCT 2XM2A 4EAHA 5AQHB 3M3ZB 2XQYA 3N9MA 4XZCA 1N33T 4U7YA 4AKHA 5LA6E 4HFDA 1IJ6A 2A2FX 4CI1B 1E2AA 5JDHA 2W2UA 1Z0PA 4HEAA 4ZHQE 2LSKA 3T4MA 3PV0F 1O3XA 4JI6T 5HEHA 3AVSA 1WYBA 5HYAA 3ETVA 2FBWA 4Z91A 3AA1B 1U4QA 3ANWB 3A7MA 1HCIA 2WU2A 2LSJA 3ZYMA 3K3NA 2XAHB 1HR0T 3RF1A 2E9XB 1I6ZA 4UXNB 2PFVA 3CIRA 2D9DA 5AQSB 2BYPA 4Z90A 2WSSV 1VCSA 2L8KA 2PGZA 5LB7B 5AFMB 2CHNA 5A1LA 4GK0E 3U78A 1UUSA 4GKJT 3EABA 5LMNT 4H9OC 3RLFF 3AE3A 3N5LA 2WWUA 2CA5A 1YKEB 3QB5K 4CN1A 2V26A 1L0VA 3RIAA 4V1Av 4CI3B 5FJVA 1UX2A 1W09A 2CCQA 1VCTA 2H89A 2W4XA 2BKPA 1GQEA 2IAKA 3OYXA 1D1BA 2NW8A 3LK3B 3MZKB 4QWNB 1U5PA 2LRLA 1KFYA 4AFTA 2VL0A 3L09A 1T8BA 4AKLA 2X0LB 3AA6B 3WTIA 2PBIA 3NRXA 3P7IA 2E9XA 4HWDA 3C4ZA 5KX5E 2CWOA 5HEGA 3UFEA 1ZOYA 2DWGA 5AQGB 5LGTB 1HF8A 2KWIB 3VR8A 5LXTE 2RA1A 4ZRUA 3AE9A 3DTOA 3KV5A 4HTEA 4QX8B 2EHOA 2L9QA 4HFIA 3HA4A 4YSZA 3OJAA 1UURA 5JDGA 1FEWA 4E7ZA 2WZYA 2CRBA 3CKDA 4CXXA 3FBLA 3ZLIA 2UXBT 3Q5XA 4HWCA 2UXNB 2H88A 3QC9A 1OXZA 5C3JA 2XNTA 4U74A 4UEMA 5ABFA 5JDQA 5IYZE 3C64A 1NENA 2A3DA 2LRKA 4BFQA 3AA7B 3W15B 1I94T 2V6XA 5HAXA 5AFLA 1MNEA 3RH3A 2VB6A 1B7TA 2PJQA 3I9WA 4MFRA 2E9XD 4BAYB 2LHRA 4ISTA 3MA9A 5LG4A 4IREA 3KV9A 2XQ7A 5J5FA 3KBTA 4K0KT 5LJNA 3GWHA 2DNXA 5LHHB 3AXJB 1OEDB 2IHR1 1FJGT 1YXRA 5L3FB 4MBQA 2ACXA 2V7JA 4PIRA 4FJOA 5FXVA 5AQJB 3UUMA 4UELA 4GYSA 2CXLA 3N9OA 2BYNA 4X20E 2Q9QD 2Y48B 2XY8B 4WBOA 2IIUA 5JRCA 4I43B 4HE8A 2KINB 5FMNA 3ZYKA 2HN2A 3RC8A 4HFEA 1UX4A 3LBXA 2NOXA 3UU3A 2X67A 3AE2A 3RYIE 2VQFT 5FL1A 2KZ7B 4IE6A 2NW9A 4DVDA 5AQMB 5FYMA 3C4WA 3OPCA 2BZBA 4OYJA 2JIWA 2Q9QC 4IHJE 3KV6A 3AE4A 5AQPB 4E7SA 3ZDGA 4QXCB 2C5KT 4KX6A 4DV1T 3N9QA 3R84B 4JI5T 2LE8A 3RYFE 4WBNE 3N9NA 2JJ9A 3UUXB 4H9SE 3UULA 2LKGA 1S94A 1SA0E 3F57A 3C98B 2V5DA 3R6NA 3PUWF 3HL6A 2LT3A 4LF7T 1M62A 2Y7YA 2K48A 3Q5EA 2C9TA 4F8HA 3K1SA 4DUZT 4H9QC 2Y58A 1WR0A 1XNQT 4UV9B 5EK3A 1NAFA 5J2TE 5HWXA 3QUJA 5C8YE 4AQFA 4YTNA 5IWAT 2AE9A 5E0OA 2A72A 4UM3S 2VVNA 3FB2A 4FI5A 4JEUB 4O4LE 5L47A 4HGAA 1ZV4X 5KXJA 3SS1A 4JI4T 5F5WA 3PU3A 3SQ9A 4B3ST 3AEFA 4LF5T 4COFA 2DL1A 4UVAB 3SQ6A 3WTJA 5SYOA 4N78D 2BG9C 1JNRA 2XUEA 4C91A 3IEEA 4YTMA 5AINA 4CXYA 3BQKA 2FJDA 3HKCE 2CWYA 4EEDA 4JBWF 3OVUA 4X1KE 3I0OA 5JR9C 3U8KA 4TWFA 4IDZA 2X9HA 3OYZA 4EYYR 3N2OA 4G63A 2P9BA 1T98A 1WYCA 5HWYA 4JYAT 2XYSA 5L3EB 3UU6A 1MMAA 4XK9A 3ZPOA 2QRXA 3C51A 3P4WA 4BJNA 3CQCB 5ETWA 5DJQC 4LF9T 5J5GA 5FKYA 3QOFA 3IGQA 5HCMA 3TLUA 2CLYC 3EAMA 4O4IE 1LRZA 3IBPA 1BR4A 1YQ3A 3FXDB 2I59A 4YSYA 4HFBA 5AFMA 4UR9A 4EB6E 2LSIA 2WCAA 4OK0A 3KFWX 2ZMAA 4ANJA 1I9BA 4WYVA 1KEYA 4YXDA 1HNXT 4AFHA 4HFVA 2W00A 5DABA 4EYUA 5KE4A 4DBRA 1WLXA 3CPZA 4TNVA 3LDQB 2YKSA 1E1HB 4ZI7E 3AECA 3IF8B 4JUYA 3KINB 3ZSSA 3AEBA 4KHPT 4CXWA 4I50E 4DR3T 2ZJUA 4DR7T 3ZMUB 4D01A 3U8NA 3AB3B 5BP0A 4L9IA 4H9RC 2Q9QA 2CMRA 5LXBA 2VVSA 2J4GA 4KHZF 2LSGA 3CK6A 2W63A 5JQGE 4LMJA 4DR4T 2YK0A 3ZMSB 4LF8T 1QUUA 2CEAA 2EHOD 5DQWA 4OFZA 5C2TA 2V1DB 2HH7A 1BR0A 4U2ZA 2LOSA 1BR2A 2W8FA 5AFKA 2FJAA 2D0UA 4GK5E 2Y54A 3NRYA 2VKOA 3JAFA 1OEDC 2NWBA 4HKAA 4JI7T 2NW7A 4PK5A 5KZUA 1JNZA 1KNZA 4DR5T 3KDSE 1YW0A 5ABFB 2QC1B 3SH1A 4ZK1A 4WNKA 2WY2A 4YSXA 3RGLA 5JDMA 4PJNA 2UZ6A 4PK6A 2K5BB 1QLBA 1IBLT 2V8SV 3EDUA 2J62A 3O4XE 5FY0A 4J2CA 3U8MA 3ZCJA 3TLTA 4UXUA 3PE0A 3FXEB 3P8CD 4KBMB 4ZEYA 4Q25A 3QNUA 4A97A 4DV4T 1W0BA 4O4HE 3PUQA 4QACA 5EK4A 1HNWT 4NPPA 4EV6A 2E2AA 4TWHA 4TV9E 3EUHA 3AEGA 4ZJSA 4UVBB 5AQIB 3PUGA 4DR1T 3I9YA 3L3PA 1ZKEA 2VL8A 4HN9A 2WDQA 1HS7A 3FZHB 3CX6B 1OEDA 2Q9QB 3Q9DA 3RIUC 3MJXA 5LCYA 4AKGA 3RX6A 5LMUT 2XTLA 3Q2MA 4QH5A 2WBLA 5ADXL 2ES0A 3RYCE 4JI3T 3HKDE 3U8JA 2B1EA 3QB5A 5CB4E 3CVRA 5L2LA 1S35A 2XQ3A 2XAJB 4JI2T 4BA9A 3EDVA 4X62T 4GIWA 3PEOA 2C5JA 4WV9A 3ZMZB 1MMGA 1XMOT 3N9LA 2KWHA 2L3LA 5FL0A 2QYWA 2E8IA 4NXNT 3LBXB 4A5XA 4HFCA 2QA7A 3AXJA 5CGMA 3UU8A 2N1GA 3JADA 3CX7B 4AQGA 3JC6D 3ZJ2A 2KMFA 3F2EA 2BJ0A 2XQ9A 2X0HA 4QHOA 4KP3C 1BR1A 3CWZB 3SWHA 3FZMB 4GKKT 4G2AA 3UUNA 3OKQA 4P0AA 5JDNA 4IDNA 5LHGB 4DUYT 3MXZA 4PFOA 2JRKA 2JQQA 2UU9T 3I1AA 3TKLB 1IBMT 1HX8A 5FVKA 2MPKA 2CBIA 5J2UE 3PU8A 5FY1A 5BR8T 2H7VC 2IUBA 2YINA 2M6BA 2PTFA 3UU5A 4OHFA 3ZT5A 2VKHA 5AQTB 2XQ5A 4YHHT 2V7KA 3Q5DA 3U8LA 2XASB 2WQYA 2BG9B 2MYSA 1MIVA 2ZM0A 2WS3A 4DV2T 5BRXA 1YQ4A 2YU1A 4UM1A 1MIWA 3FZKB 2UXCT 5DQVA 3A8YC 4CN6A 4AKIA 2K24A 4QKNA 4U7IA 3GUAA 4UVCB 4ADZA 5JTGA 2BG9A 3AAAB 2WP9A 4QXBB 1UV6A 2WNJA 3DJBA 3B5MA 1ZHCA 3ZC0A 2VK9A 2XPKA 3ZT6A 2XAGB 4B6XA 5LJMA 4TNWA 3LJCA 5HXHA 3D0TA 2YDSA 2BS4A 3BQIA 4CQIA 3WTNA 2JQKA 4DBMA 4ILBA 3P4PA 4PJLA 4B3TT 3SFEA 3TLWA 2DLRA 3UT5E 3I0QA 3SIOA 4P09A 2M67A 2FUPA 1R8IA 3GA8A 4KI0F 2EHOC 2E5VA 3WI3A 1IBKT 2I6HA 4I55E 4PNIA 4IE7A 2K3WA 3A5XA 5EZYE 1UX5A 3VRAA 1Z8UA 1YD8G 4IL4A 4UY2A 2W62A 2BS3A 3O1HA 3GN5A 1MMDA 4YLHA 2WDVA 2X66A 5J1GA 3VU7H 3NVOA 1AJ3A 2LJLA 2PG8A 4AXPA 4MLKA 3P4QA 2IW5B 4A56A 3WTMA 2V7IA 4ZI3C 2KSRA 2SPCA 2JQ9A 3KBUA 4OX9T 4ERRA 3AE1A 5FVLA 2BKNA 3ZN0B 1IJ5A 2VQET 3EVYA 3WAKA 2DI4A 1V9DA 2BBHA 3HI2A 2KLQA 2R6GF 2IC9A 4ZS2A 1HG5A 2W67A 2XHEB 4EZHA 4NIQA 3F31A 5AQRB 5LNKA 2E5LT 2XJ7A 1FMVA 3FZFB 4ZZCA 1VRBA 4KUMB 3B57A 3ONXA 2H3RA 2LM9A 4P0BA 2XSBA 3N2KE 1SE7A 3N9PA 3NKZA 4JEHB 5LBQB 4DIDB 3JAEA 4GYRA 4AI6A 2VURA 2WNCA 3LK42 4YHJA 2YMDA 2CPTA 5IUXA 4DMVA 1MNDA 1M7KA 5M4YA 2XZ5A 2WDRA 2NP9A 3WAJA 1J1JA 2AXDS 5J0ZA 3AEEA 2CBJA 2BDEA 2DCFA 3PUAA 3AEAA 1YKHB 5LGNB 4MHCA 1XDOA 1HFAA 5TAOA 3FZLB 1SHZC 2LEHA 5HXSA 4H9PC 1ZEEA 4IIJE 3RIFA 5ABHA 3RPUA 3RHWA 4L5GA 4HWHA 4XBFB 5HXCA 4YJ2E 1OEDE 3WTOA 4I0UA 2WB5A 3VRBA 2JQHA 4AKRB 3CX8B 2BKOA 3T8OA 3ZC1A 3ZJ1A 3ZMVB 5LGUB 2G0UA 4K0UA 2ODVA 4QABA 2XQAA 4IE0A 2VKDA 2LKHA 3AE6A 4JLEA 2LSYA 1ZP0A 3BK9A 2MBGA 4CI2B 4O2AE 3OTOT 3PJAA 5HEOA 3C79A 5JRCB 2OA5A 4AQFC 2QVAA 4CZZB 5L4EA 3CQXC 2F4VT 4YFSA 2M6IA 4ZI3D 1CUNA 1KNPA 4ZI2C 1UCUA 3H3MA 2W8GA 3K8PC 3RIUA 4KMCA 4YJ3E 3ONLC 3RC3A 3VKGA 4DV6T 2VASA 1KK7A 5FXZA 2WN9A 2ACZA 5CA0E 2YDQA 1T72A 1E7PA 5JVDE 1NWMX 1IAPA 5AQNB 3UUBA 1LKXA 4U2YA 3E22E 3OBVE 3T1HT 1N36T 2D5UA 3S4UA 4DBQA 4NUUA 3ONJA 1D1CA 3E0ZA 5AQLB 5FNVE 2JMKA 5HXRA 5FY7A 5AFNA 3GN5B 3V5UA 1OWAA 5EK2A 5FXXA 3J7Yq 4ZK4A 1T7SA 1D1AA 4PJMA 2EHOB 1J5ET 5KMGP 5AQVB 4BJMA 2BR8A 4QH1A 1N34T 1WRDA 2BG9E 2RP4A 1W0AA 3AA0B 1KF6A 1X9BA 5JDFA 2ODUA 3L8RA 3PDYA 2WZIA 5L3BB 5ABEA 4NUVA 2CLYB 2XZEA 5LP6E 4ISSA 1MMNA 2N9DA 2X00A 4TN7B 2XM1A 3ABVA 4WZXA 1X79A 3AVRA 1SUMB 3PTRB 2CE7A 5JREA 5HXEA 4BQTA 5FP3A 4CN4A 4GOUA 1US7B 3TLSA 4DV7T 3KVBA 1CHUA 3UU4A 4UIGA 2V6YB 3O9XA 2BYQA 1N32T 2B76A 2BVMA 2W66A 2YMEA 3ZKRA 3PURA 4IDOA 5CFBA 5L3GB 5AQQB 5H6RB 1XZYA 2JMHA 4U33A 4YY3T 2HN1A 3IA3A 2VKJA 3RKOA 2CHOA 2W0GA 3HR0A 2Y57A 3KVAA 3JCFA 4O2BE 1QSDA 4PK4A 3C4XA 3Q5WA 5CO5A 2QGSA 3PUSA 5LOVE 3PUYF 4UV8B 5JH7E 2X9WA 2X0YA 3UQ7A 4IDPA 2YEVC 5J5IA 4LFBT 4PJJA 4LF6T 4DV5T 1NEKA 3LSVA 5LG3A 4IE4A 2DHRA 1UGOA 2XAFB 2J1DG 3AAEB 3MK7C 3RKGA 4C90A 4WW0A 2NR4A 2BR7A 4JI1T 2WZHA 2NTXA 2V5CA 4LMKA 5KDMC 3CQGB 2KT9A 1HX1B 4Z8XA 3ZDHA 3NBXX 1UK5A 2CXDA 2V7MA 4M1PA 3RI5A 5LHIB 5AFHA 4U72A 3RQUA 4YT0A 3WTLA 2PH9A 5L3DB 3AE7A 5HEUA 4X64T 1IZNB 2FJBA 2YOEA 3WTHA 3ESLA 3VR9A 4A98A 1WR6A 5TVCA 3TLVA 1J5WA 2FJEA 4IDQA 2UUBT 2ZJVA 5AQFB 5L3CB 3N2GE 4ILAA 4XHEA 3IHRA 5LBMA 3V5SA 2XNUA 4TV8E 4AIUA 3NZPA 4EXTA 3VHLA 2X00D 4P1NA 3DP7A 2CXFA 3P4SA 2Y6XA 1W9RA 4NZBA 2XZ6A 3L39A 3ZMTB 5AQOB 3K3OA
chains in the Genus database with same CATH topology
5FJVA 2XQAA 3RQWA 3UQ7A 5J5IA 5KE4A 1UX2A 4HFCA 4COFA 2LKHA 2UZ6A 4TNWA 2WNLA 3UU8A 4TNVA 3LSVA 2BR8A 3SQ6A 3WTJA 5SYOA 4QAAA 2XYTA 5LG3A 3JADA 4QH1A 2BG9C 2YKSA 5AINA 3ZDGA 5HEOA 4AFTA 5HCJA 3C79A 4ZZCA 3WTNA 4DBMA 2BG9E 2VL0A 4ILBA 5L4EA 3U8MA 2BJ0A 2XQ9A 2LM2A 2BR7A 4HFDA 3WTIA 3TLTA 2M6IA 4IREA 4QH4A 4UXUA 4HFHA 4IL9A 3TLWA 2XQ7A 3U8KA 5J5FA 4LMKA 2XQ6A 2XQ4A 4TWFA 2W8GA 2ZJUA 3JAEA 4D01A 2WNCA 3U8NA 3ZDHA 5BW2A 5BP0A 3T4MA 3EI0A 4A97A 4AFGA 2X00A 3SIOA 3C84A 2YMDA 2LKGA 5LXBA 4QACA 5HEGA 4LMLA 1OEDB 5IUXA 5AFJA 2LLYA 4NPPA 5HEHA 4TWHA 2WN9A 2XYSA 2XZ5A 3RI5A 4HQPA 3UU6A 4ZJSA 4XK9A 2XQ8A 5AFHA 4LMJA 4BQTA 4PIRA 3RQUA 3P4WA 3PMZA 4ZJTA 3WTLA 4Z91A 4ILCA 3UUBA 4ZRUA 5J0ZA 2PH9A 4EZ1A 3TLSA 5HEUA 2Y7YA 2XNVA 4IL4A 2M6BA 3UU5A 2BYNA 2Y56A 2C9TA 5J5GA 4UY2A 4HFIA 4F8HA 3WIPA 1OEDA 3UU4A 4UM3P 2YOEA 4ZR6A 2XQ5A 2WZYA 3WTHA 4A98A 3IGQA 5TVCA 3TLVA 3UQ4A 5HCMA 4ZZBA 1UW6A 2BYQA 2Y58A 3U8LA 3TLUA 2YMEA 3ZKRA 3EAMA 2BG9B 2BYPA 2W8FA 2ZJVA 4Z90A 5BRXA 3RIFA 5AFKA 5J5HA 3P50A 5CFBA 4ILAA 4QH5A 4UM1A 4XHEA 4X5TA 2XNUA 2BYSA 4FRRA 5L4HA 2PGZA 2Y54A 3RHWA 4HFEA 3U8JA 5AFMB 4UM3A 3JAFA 1OEDC 3UU3A 4HFBA 3WTMA 2XNTA 4UM3S 2XQ3A 5AFMA 1OEDE 2KSRA 3WTKA 2X00D 3WTOA 4B5DA 5AFNA 5JMEA 5KZUA 2MAWA 2Y57A 3GUAA 3PEOA 5L47A 4NZBA 1I9BA 2BG9A 4WV9A 4ALXA 2XZ6A 2QC1B 1UV6A 3SH1A 5CO5A 2WNJA 5HEJA 4BFQA 4ZK1A 4AFHA 3EHZA 4ZK4A 2YN6A 4TWDA 3RIAA 2BYRA 5AFLA 3SQ9A 4QABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJV A;  2XQA A;  3RQW A;  3UQ7 A;  5J5I A;  5KE4 A;  1UX2 A;  4HFC A;  4COF A;  2LKH A;  2UZ6 A;  4TNW A;  2WNL A;  3UU8 A;  4TNV A;  3LSV A;  2BR8 A;  3SQ6 A;  3WTJ A;  5SYO A;  4QAA A;  2XYT A;  5LG3 A;  3JAD A;  4QH1 A;  2BG9 C;  2YKS A;  5AIN A;  3ZDG A;  5HEO A;  4AFT A;  5HCJ A;  3C79 A;  4ZZC A;  3WTN A;  4DBM A;  2BG9 E;  2VL0 A;  4ILB A;  5L4E A;  3U8M A;  2BJ0 A;  2XQ9 A;  2LM2 A;  2BR7 A;  4HFD A;  3WTI A;  3TLT A;  2M6I A;  4IRE A;  4QH4 A;  4UXU A;  4HFH A;  4IL9 A;  3TLW A;  2XQ7 A;  3U8K A;  5J5F A;  4LMK A;  2XQ6 A;  2XQ4 A;  4TWF A;  2W8G A;  2ZJU A;  3JAE A;  4D01 A;  2WNC A;  3U8N A;  3ZDH A;  5BW2 A;  5BP0 A;  3T4M A;  3EI0 A;  4A97 A;  4AFG A;  2X00 A;  3SIO A;  3C84 A;  2YMD A;  2LKG A;  5LXB A;  4QAC A;  5HEG A;  4LML A;  1OED B;  5IUX A;  5AFJ A;  2LLY A;  4NPP A;  5HEH A;  4TWH A;  2WN9 A;  2XYS A;  2XZ5 A;  3RI5 A;  4HQP A;  3UU6 A;  4ZJS A;  4XK9 A;  2XQ8 A;  5AFH A;  4LMJ A;  4BQT A;  4PIR A;  3RQU A;  3P4W A;  3PMZ A;  4ZJT A;  3WTL A;  4Z91 A;  4ILC A;  3UUB A;  4ZRU A;  5J0Z A;  2PH9 A;  4EZ1 A;  3TLS A;  5HEU A;  2Y7Y A;  2XNV A;  4IL4 A;  2M6B A;  3UU5 A;  2BYN A;  2Y56 A;  2C9T A;  5J5G A;  4UY2 A;  4HFI A;  4F8H A;  3WIP A;  1OED A;  3UU4 A;  4UM3 P;  2YOE A;  4ZR6 A;  2XQ5 A;  2WZY A;  3WTH A;  4A98 A;  3IGQ A;  5TVC A;  3TLV A;  3UQ4 A;  5HCM A;  4ZZB A;  1UW6 A;  2BYQ A;  2Y58 A;  3U8L A;  3TLU A;  2YME A;  3ZKR A;  3EAM A;  2BG9 B;  2BYP A;  2W8F A;  2ZJV A;  4Z90 A;  5BRX A;  3RIF A;  5AFK A;  5J5H A;  3P50 A;  5CFB A;  4ILA A;  4QH5 A;  4UM1 A;  4XHE A;  4X5T A;  2XNU A;  2BYS A;  4FRR A;  5L4H A;  2PGZ A;  2Y54 A;  3RHW A;  4HFE A;  3U8J A;  5AFM B;  4UM3 A;  3JAF A;  1OED C;  3UU3 A;  4HFB A;  3WTM A;  2XNT A;  4UM3 S;  2XQ3 A;  5AFM A;  1OED E;  2KSR A;  3WTK A;  2X00 D;  3WTO A;  4B5D A;  5AFN A;  5JME A;  5KZU A;  2MAW A;  2Y57 A;  3GUA A;  3PEO A;  5L47 A;  4NZB A;  1I9B A;  2BG9 A;  4WV9 A;  4ALX A;  2XZ6 A;  2QC1 B;  1UV6 A;  3SH1 A;  5CO5 A;  2WNJ A;  5HEJ A;  4BFQ A;  4ZK1 A;  4AFH A;  3EHZ A;  4ZK4 A;  2YN6 A;  4TWD A;  3RIA A;  2BYR A;  5AFL A;  3SQ9 A;  4QAB A; 
#chains in the Genus database with same CATH topology
 4EGW A;  3FHN A;  3SOL A;  4ILU A;  2WNL A;  2I0M A;  3MKD A;  4LF4 T;  1HNZ T;  2IDO B;  4QX7 B;  4XAX B;  5LYJ E;  2LM2 A;  3U3I A;  2VWA A;  3NZQ A;  4HFH A;  1D0Y A;  2LHN A;  2XQ6 A;  3AE5 A;  4O4J E;  4U31 A;  3RRW A;  3EI0 A;  2NTY A;  4DR2 T;  5JR9 A;  4X1I E;  3HKB E;  4HWF A;  2X9Y A;  2X68 A;  2XAQ B;  3J9X 1;  4NXM T;  4L0R A;  2CM0 A;  2RPA A;  2UXD T;  3H3A A;  5F8P A;  4ILC A;  4JV5 T;  4MAL A;  3T1Y T;  1FIO A;  2XNV A;  4H9N C;  4AQY T;  3LK2 B;  3C50 A;  4IT4 A;  4UM3 P;  4O8S A;  3M65 A;  1HTJ F;  3UQ4 A;  4PW8 A;  4IE5 A;  4ZZB A;  2WM9 A;  3ZYL A;  3MAC A;  3ZCI A;  4HWI B;  2X9X A;  2N2N A;  3P50 A;  2BYS A;  2J47 A;  5L4H A;  2WMO A;  4LFC T;  3ANW A;  3WTK A;  2X51 A;  2GK9 A;  4B5D A;  4JI8 T;  3KV4 A;  4TX5 A;  5AQU B;  1XMQ T;  1FMW A;  1LVK A;  4ALX A;  2Z6E A;  4I4T E;  2HPJ A;  4PAG A;  2OV9 A;  2YN6 A;  1MIY A;  3RRC A;  2DWK A;  1HG2 A;  4X65 T;  1XWM A;  5HCJ A;  3H37 A;  3O1I A;  3AAI A;  2V6Y A;  2A9U A;  5F3J A;  4DR6 T;  3P4R A;  2XQ4 A;  4F6R C;  5BW2 A;  4AFG A;  5H6Q B;  2HHH T;  4JI0 T;  3C84 A;  4EEB A;  1WFD A;  5AFJ A;  3E08 A;  5GON E;  4ZI2 D;  4AIS A;  4ASK A;  2BVL A;  4H63 V;  4ZJT A;  3PJA J;  3PUX F;  2XSA A;  4EZ1 A;  3NWI A;  3BQL A;  3AED A;  2YU2 A;  4DV3 T;  5AQK B;  5JR9 B;  2UUA T;  1VOM A;  3ZST A;  3UTK A;  3JC6 C;  3FBZ A;  1LVF A;  4IGU A;  5FXW A;  4B3R T;  1WCR A;  4QXH B;  1D0Z A;  2WMN A;  4FRR A;  4X1Y E;  4UM3 A;  4TUY E;  2ZM6 T;  5CA1 E;  3SFD A;  2ZM2 A;  4LFA T;  4UF0 B;  4DO0 A;  2IML A;  3SRZ A;  2D0T A;  3LG7 A;  4EOZ B;  2BBJ A;  3PUV F;  5AFU L;  4EZ4 A;  1D0X A;  4TWD A;  1H7C A;  2BYR A;  5ABG A;  2LOP A;  4PFP A;  4TZ4 C;  2ZLY A;  5BMV E;  4ZS3 A;  1KNR A;  3ZT7 A;  1G73 A;  2WU5 A;  4QAA A;  2XYT A;  1EZ3 A;  4UF0 A;  2D2S A;  2Y8D A;  5JDL A;  3QK6 A;  5IHY A;  3CML A;  4QH4 A;  3B13 A;  4DMW A;  4IL9 A;  1XNR T;  1Y64 B;  2KXP B;  3O1J A;  3ZN1 B;  3UFG A;  2WAU A;  2HPL A;  2UXX B;  1DU2 A;  4H63 H;  4DND A;  4LML A;  2LLY A;  4HQP A;  2JPF A;  4ZOL E;  2H7O A;  2XQ8 A;  2V7L A;  1Y01 A;  2YDR A;  3PMZ A;  4B3M T;  2ZM8 A;  3LFM A;  3GMI A;  4ZXL A;  2MOZ A;  2Y56 A;  3WIP A;  2C0S A;  3G06 A;  4X66 T;  4ZR6 A;  3RYH E;  4DV0 T;  4OYK A;  5CJ5 A;  1UW6 A;  3ETU A;  3HKE E;  4EIW A;  4YTP A;  5J5H A;  4X5T A;  3K3Q C;  2IC6 A;  2C5I T;  2MTQ A;  2BS2 A;  4U3C A;  2OLT A;  1XDP A;  3PUZ F;  5JME A;  2MAW A;  3ZEF B;  2WWV A;  3AE8 A;  1G8X A;  2KND A;  3VKH A;  5HEJ A;  3X1D A;  2W61 A;  3EHZ A;  2K9A A;  3RQW A;  2E9X C;  2UUC T;  2XM2 A;  4EAH A;  5AQH B;  3M3Z B;  2XQY A;  3N9M A;  4XZC A;  1N33 T;  4U7Y A;  4AKH A;  5LA6 E;  4HFD A;  1IJ6 A;  2A2F X;  4CI1 B;  1E2A A;  5JDH A;  2W2U A;  1Z0P A;  4HEA A;  4ZHQ E;  2LSK A;  3T4M A;  3PV0 F;  1O3X A;  4JI6 T;  5HEH A;  3AVS A;  1WYB A;  5HYA A;  3ETV A;  2FBW A;  4Z91 A;  3AA1 B;  1U4Q A;  3ANW B;  3A7M A;  1HCI A;  2WU2 A;  2LSJ A;  3ZYM A;  3K3N A;  2XAH B;  1HR0 T;  3RF1 A;  2E9X B;  1I6Z A;  4UXN B;  2PFV A;  3CIR A;  2D9D A;  5AQS B;  2BYP A;  4Z90 A;  2WSS V;  1VCS A;  2L8K A;  2PGZ A;  5LB7 B;  5AFM B;  2CHN A;  5A1L A;  4GK0 E;  3U78 A;  1UUS A;  4GKJ T;  3EAB A;  5LMN T;  4H9O C;  3RLF F;  3AE3 A;  3N5L A;  2WWU A;  2CA5 A;  1YKE B;  3QB5 K;  4CN1 A;  2V26 A;  1L0V A;  3RIA A;  4V1A v;  4CI3 B;  5FJV A;  1UX2 A;  1W09 A;  2CCQ A;  1VCT A;  2H89 A;  2W4X A;  2BKP A;  1GQE A;  2IAK A;  3OYX A;  1D1B A;  2NW8 A;  3LK3 B;  3MZK B;  4QWN B;  1U5P A;  2LRL A;  1KFY A;  4AFT A;  2VL0 A;  3L09 A;  1T8B A;  4AKL A;  2X0L B;  3AA6 B;  3WTI A;  2PBI A;  3NRX A;  3P7I A;  2E9X A;  4HWD A;  3C4Z A;  5KX5 E;  2CWO A;  5HEG A;  3UFE A;  1ZOY A;  2DWG A;  5AQG B;  5LGT B;  1HF8 A;  2KWI B;  3VR8 A;  5LXT E;  2RA1 A;  4ZRU A;  3AE9 A;  3DTO A;  3KV5 A;  4HTE A;  4QX8 B;  2EHO A;  2L9Q A;  4HFI A;  3HA4 A;  4YSZ A;  3OJA A;  1UUR A;  5JDG A;  1FEW A;  4E7Z A;  2WZY A;  2CRB A;  3CKD A;  4CXX A;  3FBL A;  3ZLI A;  2UXB T;  3Q5X A;  4HWC A;  2UXN B;  2H88 A;  3QC9 A;  1OXZ A;  5C3J A;  2XNT A;  4U74 A;  4UEM A;  5ABF A;  5JDQ A;  5IYZ E;  3C64 A;  1NEN A;  2A3D A;  2LRK A;  4BFQ A;  3AA7 B;  3W15 B;  1I94 T;  2V6X A;  5HAX A;  5AFL A;  1MNE A;  3RH3 A;  2VB6 A;  1B7T A;  2PJQ A;  3I9W A;  4MFR A;  2E9X D;  4BAY B;  2LHR A;  4IST A;  3MA9 A;  5LG4 A;  4IRE A;  3KV9 A;  2XQ7 A;  5J5F A;  3KBT A;  4K0K T;  5LJN A;  3GWH A;  2DNX A;  5LHH B;  3AXJ B;  1OED B;  2IHR 1;  1FJG T;  1YXR A;  5L3F B;  4MBQ A;  2ACX A;  2V7J A;  4PIR A;  4FJO A;  5FXV A;  5AQJ B;  3UUM A;  4UEL A;  4GYS A;  2CXL A;  3N9O A;  2BYN A;  4X20 E;  2Q9Q D;  2Y48 B;  2XY8 B;  4WBO A;  2IIU A;  5JRC A;  4I43 B;  4HE8 A;  2KIN B;  5FMN A;  3ZYK A;  2HN2 A;  3RC8 A;  4HFE A;  1UX4 A;  3LBX A;  2NOX A;  3UU3 A;  2X67 A;  3AE2 A;  3RYI E;  2VQF T;  5FL1 A;  2KZ7 B;  4IE6 A;  2NW9 A;  4DVD A;  5AQM B;  5FYM A;  3C4W A;  3OPC A;  2BZB A;  4OYJ A;  2JIW A;  2Q9Q C;  4IHJ E;  3KV6 A;  3AE4 A;  5AQP B;  4E7S A;  3ZDG A;  4QXC B;  2C5K T;  4KX6 A;  4DV1 T;  3N9Q A;  3R84 B;  4JI5 T;  2LE8 A;  3RYF E;  4WBN E;  3N9N A;  2JJ9 A;  3UUX B;  4H9S E;  3UUL A;  2LKG A;  1S94 A;  1SA0 E;  3F57 A;  3C98 B;  2V5D A;  3R6N A;  3PUW F;  3HL6 A;  2LT3 A;  4LF7 T;  1M62 A;  2Y7Y A;  2K48 A;  3Q5E A;  2C9T A;  4F8H A;  3K1S A;  4DUZ T;  4H9Q C;  2Y58 A;  1WR0 A;  1XNQ T;  4UV9 B;  5EK3 A;  1NAF A;  5J2T E;  5HWX A;  3QUJ A;  5C8Y E;  4AQF A;  4YTN A;  5IWA T;  2AE9 A;  5E0O A;  2A72 A;  4UM3 S;  2VVN A;  3FB2 A;  4FI5 A;  4JEU B;  4O4L E;  5L47 A;  4HGA A;  1ZV4 X;  5KXJ A;  3SS1 A;  4JI4 T;  5F5W A;  3PU3 A;  3SQ9 A;  4B3S T;  3AEF A;  4LF5 T;  4COF A;  2DL1 A;  4UVA B;  3SQ6 A;  3WTJ A;  5SYO A;  4N78 D;  2BG9 C;  1JNR A;  2XUE A;  4C91 A;  3IEE A;  4YTM A;  5AIN A;  4CXY A;  3BQK A;  2FJD A;  3HKC E;  2CWY A;  4EED A;  4JBW F;  3OVU A;  4X1K E;  3I0O A;  5JR9 C;  3U8K A;  4TWF A;  4IDZ A;  2X9H A;  3OYZ A;  4EYY R;  3N2O A;  4G63 A;  2P9B A;  1T98 A;  1WYC A;  5HWY A;  4JYA T;  2XYS A;  5L3E B;  3UU6 A;  1MMA A;  4XK9 A;  3ZPO A;  2QRX A;  3C51 A;  3P4W A;  4BJN A;  3CQC B;  5ETW A;  5DJQ C;  4LF9 T;  5J5G A;  5FKY A;  3QOF A;  3IGQ A;  5HCM A;  3TLU A;  2CLY C;  3EAM A;  4O4I E;  1LRZ A;  3IBP A;  1BR4 A;  1YQ3 A;  3FXD B;  2I59 A;  4YSY A;  4HFB A;  5AFM A;  4UR9 A;  4EB6 E;  2LSI A;  2WCA A;  4OK0 A;  3KFW X;  2ZMA A;  4ANJ A;  1I9B A;  4WYV A;  1KEY A;  4YXD A;  1HNX T;  4AFH A;  4HFV A;  2W00 A;  5DAB A;  4EYU A;  5KE4 A;  4DBR A;  1WLX A;  3CPZ A;  4TNV A;  3LDQ B;  2YKS A;  1E1H B;  4ZI7 E;  3AEC A;  3IF8 B;  4JUY A;  3KIN B;  3ZSS A;  3AEB A;  4KHP T;  4CXW A;  4I50 E;  4DR3 T;  2ZJU A;  4DR7 T;  3ZMU B;  4D01 A;  3U8N A;  3AB3 B;  5BP0 A;  4L9I A;  4H9R C;  2Q9Q A;  2CMR A;  5LXB A;  2VVS A;  2J4G A;  4KHZ F;  2LSG A;  3CK6 A;  2W63 A;  5JQG E;  4LMJ A;  4DR4 T;  2YK0 A;  3ZMS B;  4LF8 T;  1QUU A;  2CEA A;  2EHO D;  5DQW A;  4OFZ A;  5C2T A;  2V1D B;  2HH7 A;  1BR0 A;  4U2Z A;  2LOS A;  1BR2 A;  2W8F A;  5AFK A;  2FJA A;  2D0U A;  4GK5 E;  2Y54 A;  3NRY A;  2VKO A;  3JAF A;  1OED C;  2NWB A;  4HKA A;  4JI7 T;  2NW7 A;  4PK5 A;  5KZU A;  1JNZ A;  1KNZ A;  4DR5 T;  3KDS E;  1YW0 A;  5ABF B;  2QC1 B;  3SH1 A;  4ZK1 A;  4WNK A;  2WY2 A;  4YSX A;  3RGL A;  5JDM A;  4PJN A;  2UZ6 A;  4PK6 A;  2K5B B;  1QLB A;  1IBL T;  2V8S V;  3EDU A;  2J62 A;  3O4X E;  5FY0 A;  4J2C A;  3U8M A;  3ZCJ A;  3TLT A;  4UXU A;  3PE0 A;  3FXE B;  3P8C D;  4KBM B;  4ZEY A;  4Q25 A;  3QNU A;  4A97 A;  4DV4 T;  1W0B A;  4O4H E;  3PUQ A;  4QAC A;  5EK4 A;  1HNW T;  4NPP A;  4EV6 A;  2E2A A;  4TWH A;  4TV9 E;  3EUH A;  3AEG A;  4ZJS A;  4UVB B;  5AQI B;  3PUG A;  4DR1 T;  3I9Y A;  3L3P A;  1ZKE A;  2VL8 A;  4HN9 A;  2WDQ A;  1HS7 A;  3FZH B;  3CX6 B;  1OED A;  2Q9Q B;  3Q9D A;  3RIU C;  3MJX A;  5LCY A;  4AKG A;  3RX6 A;  5LMU T;  2XTL A;  3Q2M A;  4QH5 A;  2WBL A;  5ADX L;  2ES0 A;  3RYC E;  4JI3 T;  3HKD E;  3U8J A;  2B1E A;  3QB5 A;  5CB4 E;  3CVR A;  5L2L A;  1S35 A;  2XQ3 A;  2XAJ B;  4JI2 T;  4BA9 A;  3EDV A;  4X62 T;  4GIW A;  3PEO A;  2C5J A;  4WV9 A;  3ZMZ B;  1MMG A;  1XMO T;  3N9L A;  2KWH A;  2L3L A;  5FL0 A;  2QYW A;  2E8I A;  4NXN T;  3LBX B;  4A5X A;  4HFC A;  2QA7 A;  3AXJ A;  5CGM A;  3UU8 A;  2N1G A;  3JAD A;  3CX7 B;  4AQG A;  3JC6 D;  3ZJ2 A;  2KMF A;  3F2E A;  2BJ0 A;  2XQ9 A;  2X0H A;  4QHO A;  4KP3 C;  1BR1 A;  3CWZ B;  3SWH A;  3FZM B;  4GKK T;  4G2A A;  3UUN A;  3OKQ A;  4P0A A;  5JDN A;  4IDN A;  5LHG B;  4DUY T;  3MXZ A;  4PFO A;  2JRK A;  2JQQ A;  2UU9 T;  3I1A A;  3TKL B;  1IBM T;  1HX8 A;  5FVK A;  2MPK A;  2CBI A;  5J2U E;  3PU8 A;  5FY1 A;  5BR8 T;  2H7V C;  2IUB A;  2YIN A;  2M6B A;  2PTF A;  3UU5 A;  4OHF A;  3ZT5 A;  2VKH A;  5AQT B;  2XQ5 A;  4YHH T;  2V7K A;  3Q5D A;  3U8L A;  2XAS B;  2WQY A;  2BG9 B;  2MYS A;  1MIV A;  2ZM0 A;  2WS3 A;  4DV2 T;  5BRX A;  1YQ4 A;  2YU1 A;  4UM1 A;  1MIW A;  3FZK B;  2UXC T;  5DQV A;  3A8Y C;  4CN6 A;  4AKI A;  2K24 A;  4QKN A;  4U7I A;  3GUA A;  4UVC B;  4ADZ A;  5JTG A;  2BG9 A;  3AAA B;  2WP9 A;  4QXB B;  1UV6 A;  2WNJ A;  3DJB A;  3B5M A;  1ZHC A;  3ZC0 A;  2VK9 A;  2XPK A;  3ZT6 A;  2XAG B;  4B6X A;  5LJM A;  4TNW A;  3LJC A;  5HXH A;  3D0T A;  2YDS A;  2BS4 A;  3BQI A;  4CQI A;  3WTN A;  2JQK A;  4DBM A;  4ILB A;  3P4P A;  4PJL A;  4B3T T;  3SFE A;  3TLW A;  2DLR A;  3UT5 E;  3I0Q A;  3SIO A;  4P09 A;  2M67 A;  2FUP A;  1R8I A;  3GA8 A;  4KI0 F;  2EHO C;  2E5V A;  3WI3 A;  1IBK T;  2I6H A;  4I55 E;  4PNI A;  4IE7 A;  2K3W A;  3A5X A;  5EZY E;  1UX5 A;  3VRA A;  1Z8U A;  1YD8 G;  4IL4 A;  4UY2 A;  2W62 A;  2BS3 A;  3O1H A;  3GN5 A;  1MMD A;  4YLH A;  2WDV A;  2X66 A;  5J1G A;  3VU7 H;  3NVO A;  1AJ3 A;  2LJL A;  2PG8 A;  4AXP A;  4MLK A;  3P4Q A;  2IW5 B;  4A56 A;  3WTM A;  2V7I A;  4ZI3 C;  2KSR A;  2SPC A;  2JQ9 A;  3KBU A;  4OX9 T;  4ERR A;  3AE1 A;  5FVL A;  2BKN A;  3ZN0 B;  1IJ5 A;  2VQE T;  3EVY A;  3WAK A;  2DI4 A;  1V9D A;  2BBH A;  3HI2 A;  2KLQ A;  2R6G F;  2IC9 A;  4ZS2 A;  1HG5 A;  2W67 A;  2XHE B;  4EZH A;  4NIQ A;  3F31 A;  5AQR B;  5LNK A;  2E5L T;  2XJ7 A;  1FMV A;  3FZF B;  4ZZC A;  1VRB A;  4KUM B;  3B57 A;  3ONX A;  2H3R A;  2LM9 A;  4P0B A;  2XSB A;  3N2K E;  1SE7 A;  3N9P A;  3NKZ A;  4JEH B;  5LBQ B;  4DID B;  3JAE A;  4GYR A;  4AI6 A;  2VUR A;  2WNC A;  3LK4 2;  4YHJ A;  2YMD A;  2CPT A;  5IUX A;  4DMV A;  1MND A;  1M7K A;  5M4Y A;  2XZ5 A;  2WDR A;  2NP9 A;  3WAJ A;  1J1J A;  2AXD S;  5J0Z A;  3AEE A;  2CBJ A;  2BDE A;  2DCF A;  3PUA A;  3AEA A;  1YKH B;  5LGN B;  4MHC A;  1XDO A;  1HFA A;  5TAO A;  3FZL B;  1SHZ C;  2LEH A;  5HXS A;  4H9P C;  1ZEE A;  4IIJ E;  3RIF A;  5ABH A;  3RPU A;  3RHW A;  4L5G A;  4HWH A;  4XBF B;  5HXC A;  4YJ2 E;  1OED E;  3WTO A;  4I0U A;  2WB5 A;  3VRB A;  2JQH A;  4AKR B;  3CX8 B;  2BKO A;  3T8O A;  3ZC1 A;  3ZJ1 A;  3ZMV B;  5LGU B;  2G0U A;  4K0U A;  2ODV A;  4QAB A;  2XQA A;  4IE0 A;  2VKD A;  2LKH A;  3AE6 A;  4JLE A;  2LSY A;  1ZP0 A;  3BK9 A;  2MBG A;  4CI2 B;  4O2A E;  3OTO T;  3PJA A;  5HEO A;  3C79 A;  5JRC B;  2OA5 A;  4AQF C;  2QVA A;  4CZZ B;  5L4E A;  3CQX C;  2F4V T;  4YFS A;  2M6I A;  4ZI3 D;  1CUN A;  1KNP A;  4ZI2 C;  1UCU A;  3H3M A;  2W8G A;  3K8P C;  3RIU A;  4KMC A;  4YJ3 E;  3ONL C;  3RC3 A;  3VKG A;  4DV6 T;  2VAS A;  1KK7 A;  5FXZ A;  2WN9 A;  2ACZ A;  5CA0 E;  2YDQ A;  1T72 A;  1E7P A;  5JVD E;  1NWM X;  1IAP A;  5AQN B;  3UUB A;  1LKX A;  4U2Y A;  3E22 E;  3OBV E;  3T1H T;  1N36 T;  2D5U A;  3S4U A;  4DBQ A;  4NUU A;  3ONJ A;  1D1C A;  3E0Z A;  5AQL B;  5FNV E;  2JMK A;  5HXR A;  5FY7 A;  5AFN A;  3GN5 B;  3V5U A;  1OWA A;  5EK2 A;  5FXX A;  3J7Y q;  4ZK4 A;  1T7S A;  1D1A A;  4PJM A;  2EHO B;  1J5E T;  5KMG P;  5AQV B;  4BJM A;  2BR8 A;  4QH1 A;  1N34 T;  1WRD A;  2BG9 E;  2RP4 A;  1W0A A;  3AA0 B;  1KF6 A;  1X9B A;  5JDF A;  2ODU A;  3L8R A;  3PDY A;  2WZI A;  5L3B B;  5ABE A;  4NUV A;  2CLY B;  2XZE A;  5LP6 E;  4ISS A;  1MMN A;  2N9D A;  2X00 A;  4TN7 B;  2XM1 A;  3ABV A;  4WZX A;  1X79 A;  3AVR A;  1SUM B;  3PTR B;  2CE7 A;  5JRE A;  5HXE A;  4BQT A;  5FP3 A;  4CN4 A;  4GOU A;  1US7 B;  3TLS A;  4DV7 T;  3KVB A;  1CHU A;  3UU4 A;  4UIG A;  2V6Y B;  3O9X A;  2BYQ A;  1N32 T;  2B76 A;  2BVM A;  2W66 A;  2YME A;  3ZKR A;  3PUR A;  4IDO A;  5CFB A;  5L3G B;  5AQQ B;  5H6R B;  1XZY A;  2JMH A;  4U33 A;  4YY3 T;  2HN1 A;  3IA3 A;  2VKJ A;  3RKO A;  2CHO A;  2W0G A;  3HR0 A;  2Y57 A;  3KVA A;  3JCF A;  4O2B E;  1QSD A;  4PK4 A;  3C4X A;  3Q5W A;  5CO5 A;  2QGS A;  3PUS A;  5LOV E;  3PUY F;  4UV8 B;  5JH7 E;  2X9W A;  2X0Y A;  3UQ7 A;  4IDP A;  2YEV C;  5J5I A;  4LFB T;  4PJJ A;  4LF6 T;  4DV5 T;  1NEK A;  3LSV A;  5LG3 A;  4IE4 A;  2DHR A;  1UGO A;  2XAF B;  2J1D G;  3AAE B;  3MK7 C;  3RKG A;  4C90 A;  4WW0 A;  2NR4 A;  2BR7 A;  4JI1 T;  2WZH A;  2NTX A;  2V5C A;  4LMK A;  5KDM C;  3CQG B;  2KT9 A;  1HX1 B;  4Z8X A;  3ZDH A;  3NBX X;  1UK5 A;  2CXD A;  2V7M A;  4M1P A;  3RI5 A;  5LHI B;  5AFH A;  4U72 A;  3RQU A;  4YT0 A;  3WTL A;  2PH9 A;  5L3D B;  3AE7 A;  5HEU A;  4X64 T;  1IZN B;  2FJB A;  2YOE A;  3WTH A;  3ESL A;  3VR9 A;  4A98 A;  1WR6 A;  5TVC A;  3TLV A;  1J5W A;  2FJE A;  4IDQ A;  2UUB T;  2ZJV A;  5AQF B;  5L3C B;  3N2G E;  4ILA A;  4XHE A;  3IHR A;  5LBM A;  3V5S A;  2XNU A;  4TV8 E;  4AIU A;  3NZP A;  4EXT A;  3VHL A;  2X00 D;  4P1N A;  3DP7 A;  2CXF A;  3P4S A;  2Y6X A;  1W9R A;  4NZB A;  2XZ6 A;  3L39 A;  3ZMT B;  5AQO B;  3K3O A; 
#chains in the Genus database with same CATH homology
 5FJV A;  2XQA A;  3RQW A;  3UQ7 A;  5J5I A;  5KE4 A;  1UX2 A;  4HFC A;  4COF A;  2LKH A;  2UZ6 A;  4TNW A;  2WNL A;  3UU8 A;  4TNV A;  3LSV A;  2BR8 A;  3SQ6 A;  3WTJ A;  5SYO A;  4QAA A;  2XYT A;  5LG3 A;  3JAD A;  4QH1 A;  2BG9 C;  2YKS A;  5AIN A;  3ZDG A;  5HEO A;  4AFT A;  5HCJ A;  3C79 A;  4ZZC A;  3WTN A;  4DBM A;  2BG9 E;  2VL0 A;  4ILB A;  5L4E A;  3U8M A;  2BJ0 A;  2XQ9 A;  2LM2 A;  2BR7 A;  4HFD A;  3WTI A;  3TLT A;  2M6I A;  4IRE A;  4QH4 A;  4UXU A;  4HFH A;  4IL9 A;  3TLW A;  2XQ7 A;  3U8K A;  5J5F A;  4LMK A;  2XQ6 A;  2XQ4 A;  4TWF A;  2W8G A;  2ZJU A;  3JAE A;  4D01 A;  2WNC A;  3U8N A;  3ZDH A;  5BW2 A;  5BP0 A;  3T4M A;  3EI0 A;  4A97 A;  4AFG A;  2X00 A;  3SIO A;  3C84 A;  2YMD A;  2LKG A;  5LXB A;  4QAC A;  5HEG A;  4LML A;  1OED B;  5IUX A;  5AFJ A;  2LLY A;  4NPP A;  5HEH A;  4TWH A;  2WN9 A;  2XYS A;  2XZ5 A;  3RI5 A;  4HQP A;  3UU6 A;  4ZJS A;  4XK9 A;  2XQ8 A;  5AFH A;  4LMJ A;  4BQT A;  4PIR A;  3RQU A;  3P4W A;  3PMZ A;  4ZJT A;  3WTL A;  4Z91 A;  4ILC A;  3UUB A;  4ZRU A;  5J0Z A;  2PH9 A;  4EZ1 A;  3TLS A;  5HEU A;  2Y7Y A;  2XNV A;  4IL4 A;  2M6B A;  3UU5 A;  2BYN A;  2Y56 A;  2C9T A;  5J5G A;  4UY2 A;  4HFI A;  4F8H A;  3WIP A;  1OED A;  3UU4 A;  4UM3 P;  2YOE A;  4ZR6 A;  2XQ5 A;  2WZY A;  3WTH A;  4A98 A;  3IGQ A;  5TVC A;  3TLV A;  3UQ4 A;  5HCM A;  4ZZB A;  1UW6 A;  2BYQ A;  2Y58 A;  3U8L A;  3TLU A;  2YME A;  3ZKR A;  3EAM A;  2BG9 B;  2BYP A;  2W8F A;  2ZJV A;  4Z90 A;  5BRX A;  3RIF A;  5AFK A;  5J5H A;  3P50 A;  5CFB A;  4ILA A;  4QH5 A;  4UM1 A;  4XHE A;  4X5T A;  2XNU A;  2BYS A;  4FRR A;  5L4H A;  2PGZ A;  2Y54 A;  3RHW A;  4HFE A;  3U8J A;  5AFM B;  4UM3 A;  3JAF A;  1OED C;  3UU3 A;  4HFB A;  3WTM A;  2XNT A;  4UM3 S;  2XQ3 A;  5AFM A;  1OED E;  2KSR A;  3WTK A;  2X00 D;  3WTO A;  4B5D A;  5AFN A;  5JME A;  5KZU A;  2MAW A;  2Y57 A;  3GUA A;  3PEO A;  5L47 A;  4NZB A;  1I9B A;  2BG9 A;  4WV9 A;  4ALX A;  2XZ6 A;  2QC1 B;  1UV6 A;  3SH1 A;  5CO5 A;  2WNJ A;  5HEJ A;  4BFQ A;  4ZK1 A;  4AFH A;  3EHZ A;  4ZK4 A;  2YN6 A;  4TWD A;  3RIA A;  2BYR A;  5AFL A;  3SQ9 A;  4QAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...