4QH4A

The glic pentameric ligand-gated ion channel (wild-type) crystallized in acetate buffer at ph3
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 90
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh4A01
4X5TA 4ZZBA 4QH1A 5CFBA 4COFA 2WNCA 3RHWA 4ZZCA 4A97A 3P4WA 5LG3A 2WNJA 4LMKA 2WNLA 5BP0A 2PGZA 5HEHA 4IL4A 3TLUA 2VL0A 5L4HA 2BG9C 4UM1A 3JAEA 4Z91A 4BQTA 5KZUA 3RIAA 5J5FA 4PIRA 3TLVA 4TWFA 4ZRUA 4AFGA 4QAAA 5BRXA 1I9BA 4NPPA 2BYRA 4ZK4A 3SIOA 4B5DA 2Y54A 3JAFA 4TNVA 4IL9A 4ILBA 3TLWA 3U8JA 2XNVA 4D01A 2XYSA 2X00D 3ZDGA 2XQ4A 3UU3A 2X00A 3WTKA 2LKHA 4HQPA 2WN9A 2YMDA 2YN6A 2BJ0A 5AFJA 2BG9B 4Z90A 2BYNA 2XQ5A 2YKSA 4HFHA 2XNUA 3JADA 2YOEA 1UV6A 5SYOA 2Y56A 4AFTA 4UM3S 3UU6A 4UM3A 3U8NA 4EZ1A 3UQ4A 4NZBA 2BG9A 4LMLA 5AINA 4QABA 4HFIA 5TVCA 2XQ8A 4WV9A 4TWDA 3GUAA 4BFQA 4DBMA 2ZJVA 3LSVA 5AFLA 3UU4A 2XZ5A 4HFEA 1UX2A 4FRRA 3WTOA 3U8KA 3UU8A 2XYTA 5IUXA 2M6IA 1OEDC 5HEGA 5L47A 2W8GA 3RI5A 3ZDHA 2Y7YA 4F8HA 3EAMA 4UM3P 2C9TA 2BR7A 2W8FA 2XZ6A 2BYQA 3U8LA 3WTNA 2MAWA 2BYSA 2LKGA 2UZ6A 2WZYA 5HCJA 3SQ6A 4AFHA 4TWHA 3RQUA 4ZJSA 4ZK1A 5KE4A 5HEJA 4HFBA 3T4MA 4XHEA 2QC1B 5J0ZA 5AFHA 4LMJA 5J5HA 1OEDE 2LM2A 5L4EA 2XQAA 2BR8A 3U8MA 2KSRA 3IGQA 4QH5A 5HCMA 4ILCA 4ZR6A 4QACA 4QH4A 2XNTA 4UY2A 2XQ7A 5JMEA 3UUBA 1OEDB 5CO5A 2Y58A 2XQ6A 4HFDA 5HEOA 5J5GA 3WTMA 2PH9A 3WIPA 5AFKA 2LLYA 4ILAA 2M6BA 3ZKRA 1UW6A 5AFNA 3PEOA 3WTJA 2ZJUA 4ALXA 5HEUA 5BW2A 5AFMB 4IREA 4HFCA 3RIFA 3TLSA 1OEDA 2YMEA 3PMZA 4ZJTA 5LXBA 3SH1A 4A98A 3RQWA 3WTLA 3WTIA 3C84A 4TNWA 5AFMA 4XK9A 3P50A 3EI0A 3TLTA 3SQ9A 5FJVA 2XQ3A 3UU5A 2BYPA 2XQ9A 3WTHA 3UQ7A 3EHZA 3C79A 5J5IA 2Y57A 4UXUA 2BG9E
chains in the Genus database with same CATH superfamily
2LJLA 3MA9A 4ZZBA 1R8IA 4TX5A 4A97A 1NENA 2BS4A 4UM1A 4BQTA 5KZUA 2DCFA 2X0HA 4TNVA 2NOXA 5E0OA 3RLFF 1N36T 4JI2T 1ZKEA 3QK6A 2WN9A 3BQKA 3DP7A 3QUJA 4IDZA 1UK5A 4ZEYA 2QYWA 1B7TA 4AFTA 3UU6A 5FXVA 3ZT7A 4QABA 3KV5A 4YSYA 2ES0A 2CA5A 1HNZT 5IUXA 3U78A 4L5GA 2Y7YA 3OYXA 5LA6E 2XZ6A 1EZ3A 4B6XA 3JC6D 4U2YA 5LCYA 2RP4A 5HEOA 2DHRA 4OX9T 4EIWA 3PEOA 3HI2A 4IIJE 4LF5T 3FBZA 3ZCIA 3T1YT 2VQET 5JDGA 1HNXT 3P50A 2ODVA 2W4XA 1GQEA 4YFSA 4AQGA 4LFCT 1D1AA 4ZOLE 2HPLA 1W9RA 3PUXF 2IIUA 2E9XB 2Q9QB 5IWAT 3N5LA 4U3CA 3ZMSB 3TLVA 4HE8A 3FBLA 2A3DA 3SIOA 4DR1T 4YTMA 3N2KE 3PJAJ 3AE7A 4UELA 5LGNB 2J62A 4OK0A 5LHGB 2KINB 4UM3S 5JRCA 2Y6XA 4HFIA 3AE2A 5TAOA 1HG5A 2V7IA 2BS2A 1X9BA 4CI1B 4JI4T 4I50E 5AQPB 3SS1A 2F4VT 3PE0A 2HH7A 2CLYB 1VOMA 4DVDA 2BR7A 3B57A 3NZQA 3IEEA 5LBQB 3RH3A 4YJ3E 2FBWA 5HYAA 5C8YE 1VRBA 2WCAA 2IHR1 3WAKA 2FJBA 4UY2A 3PUVF 2Y58A 3WTMA 2SPCA 2PH9A 2Y8DA 4AISA 2E9XC 1YQ4A 2Q9QC 1VCTA 3RQWA 2K5BB 2NW9A 3SQ9A 2BYPA 5L3GB 1FEWA 2X51A 2DL1A 3FHNA 4Q25A 3CQGB 2CXLA 1W0AA 4EAHA 2LSJA 3C51A 5LMNT 1I9BA 2DWKA 1XWMA 4DR3T 2WWUA 3SFDA 5EK3A 4JI8T 4GK5E 4HKAA 4U72A 3KBUA 4UIGA 2GK9A 2XQ5A 3GA8A 3ZT5A 1SE7A 2CLYC 2KT9A 3P4RA 2BS3A 4EZ1A 2P9BA 5TVCA 3SFEA 2JJ9A 2FJDA 2ZM0A 2H3RA 5AFLA 4ZI3D 3FZLB 3P4SA 3D0TA 4JI0T 3ZDHA 5AQOB 3IBPA 2XSAA 5AQLB 3NRYA 4C91A 3RRCA 1HX8A 2MAWA 4DV6T 4U7IA 5FXZA 3AE6A 2V7LA 3MACA 2VWAA 3T1HT 2BR8A 3AEBA 2LE8A 4U2ZA 3AA1B 3P4QA 5HWXA 1LKXA 5J5GA 4QKNA 2BKOA 2D0UA 1T98A 5BW2A 1JNRA 3K3NA 4HFCA 3CIRA 3PMZA 1YD8G 3SH1A 4A98A 3C84A 4TNWA 1WLXA 3C98B 5JDNA 2LRKA 3EHZA 2BKNA 3CPZA 3PUZF 1IJ6A 5HXRA 5FP3A 3DTOA 4OYKA 4Z91A 2WWVA 5BRXA 3V5SA 3CK6A 4ZK4A 2IAKA 2Y54A 3HKDE 4JEHB 4IL9A 2YDRA 3KBTA 5JQGE 2HN2A 4JV5T 3OYZA 2C5KT 2N2NA 4QXBB 4PNIA 4IDQA 4KX6A 2D0TA 5L2LA 4Z90A 1HF8A 3UUMA 1D0XA 4AQFA 3V5UA 4H9PC 4GOUA 3F2EA 2VB6A 3ANWA 4C90A 2ZJVA 3ZEFB 3PUAA 5F5WA 3CVRA 2ZMAA 5JDMA 2IUBA 4G2AA 4I43B 1NEKA 2BYSA 2LKGA 5HCJA 1IAPA 2M67A 5LG4A 3PURA 2K9AA 1XMQT 3LK42 2XAJB 3HKCE 5L4EA 3U8MA 4ILUA 4ZI2C 3ZJ2A 3G06A 4IDOA 2HPJA 1BR4A 2J4GA 2NP9A 5AFKA 1UW6A 4I4TE 4ISSA 4CXWA 2BDEA 3RIFA 2YMEA 3RIUC 4EGWA 3K1SA 2NWBA 3C4XA 4AKRB 3P4PA 5AQFB 2XQ9A 3WI3A 4WW0A 2LSGA 4DUYT 4PFOA 3PUWF 2CMRA 4YHHT 5LG3A 4WYVA 2FJAA 5HEHA 5L4HA 3QNUA 5J2UE 4B5DA 2KLQA 3AEEA 2ZM6T 1YKEB 5A1LA 2X9HA 2VASA 5AQKB 2MYSA 4H9QC 2E5LT 2WDRA 1BR2A 2Y48B 5LGUB 1HNWT 3I0OA 2H88A 4O4IE 1KFYA 4JI3T 5AQTB 1MNDA 2EHOB 4BA9A 2V26A 3VR9A 1M7KA 1LRZA 2WSSV 3AXJB 3U8LA 2CRBA 2BYQA 4YSZA 2MBGA 4EOZB 1N32T 3VKGA 4EV6A 2DWGA 3A8YC 4X62T 1M62A 3IGQA 1KK7A 4QH4A 1OEDB 1E2AA 4O2AE 2UUAT 2E5VA 3ZYMA 5LB7B 4HWDA 2IDOB 4UF0A 1U4QA 4DMWA 3LK3B 5AFMA 5FVKA 1XDOA 2MOZA 4LFBT 4YJ2E 4JI1T 2Y57A 1W0BA 5CFBA 3RC3A 3GMIA 4HWIB 1I6ZA 4DR5T 3PU3A 2WNLA 5FMNA 5JR9B 3JAEA 4GKJT 3AVSA 2XZEA 5AQGB 2BYRA 2ACXA 3L39A 3JAFA 3NZPA 2X67A 3UT5E 4P1NA 2EHOC 3OVUA 3AECA 3RC8A 4OHFA 4U74A 4WBOA 2BJ0A 4MALA 3RKOA 4JLEA 2VURA 1NAFA 1UV6A 3EDVA 3N9QA 4MHCA 2LEHA 1HCIA 2JQ9A 3N2GE 3UQ4A 2X0YA 1HX1B 3GUAA 5L3FB 4DBMA 3PJAA 2LT3A 3WTOA 5JVDE 1OEDC 2DNXA 4L9IA 2K48A 4KMCA 3OPCA 1BR0A 3LG7A 5J5HA 2LM2A 4AI6A 2IC9A 4QH5A 2BVMA 5JDFA 5FY0A 4OFZA 3K3OA 2VKDA 5HXEA 5HEUA 2ZM8A 4LF7T 2E8IA 3B13A 4E7SA 5JR9C 1XNQT 4UVCB 2LSIA 3LDQB 3AAAB 4GKKT 2WM9A 5LGTB 3ZSTA 1HR0T 3Q5WA 2DI4A 4IE5A 2V6XA 3C4ZA 5J5FA 4QXHB 4CI3B 2OLTA 1YQ3A 3AE9A 1XDPA 3UU3A 3AEDA 2W0GA 1BR1A 1ZHCA 3RX6A 3MZKB 5ABFA 5DQWA 2WZIA 1UURA 5JDHA 3JADA 2YK0A 3CX8B 4IE4A 3N2OA 4B3ST 4WV9A 3UUXB 4ZHQE 4U31A 4F6RC 1WCRA 3OBVE 5ABHA 4P0AA 2W8GA 3N9PA 4F8HA 4H9SE 5H6QB 2W63A 3BK9A 4UVBB 2UXCT 2KXPB 2UUCT 3IHRA 4DV0T 4KBMB 1MMNA 2I6HA 4YT0A 3GN5A 2V5DA 4ASKA 5LOVE 4N78D 2NW7A 2X66A 3KVBA 2A2FX 4QWNB 2IC6A 4LF9T 4JYAT 3O9XA 5LXTE 4O8SA 4EYYR 4EXTA 3UQ7A 1HTJF 5LHIB 2UXDT 1Z8UA 3MKDA 2VKOA 2V6YA 3AE3A 2NTYA 2BG9E 2MTQA 3ONXA 4AXPA 3FXDB 2WP9A 1MIVA 3KV4A 5BP0A 3F31A 3F57A 2CEAA 1V9DA 2HHHT 1O3XA 4TWFA 1S94A 4LF4T 3O1HA 4EYUA 2H7VC 4I0UA 4DR7T 2YMDA 1KNZA 5AFJA 2YDQA 4HFHA 3ZC0A 5HWYA 1YW0A 5LMUT 2N9DA 4IHJE 5FYMA 3QC9A 4UXNB 2WBLA 3UU4A 2WAUA 5EK4A 2WU5A 2XYTA 3RYIE 3H37A 2KWHA 3ZT6A 4H9OC 1W09A 2VQFT 5EK2A 4AFHA 4TWHA 3UFGA 2OV9A 4YTNA 4HFBA 2QC1B 1LVFA 1IZNB 1QUUA 2WS3A 2XQ7A 3AE1A 3WIPA 4O4HE 3ZKRA 2M6BA 5AFNA 1MMDA 3PDYA 3N9NA 4IE6A 1XNRT 4HWFA 3TLSA 5EZYE 4IE0A 5AQMB 1ZP0A 2ZLYA 2HN1A 2J1DG 4G63A 2X68A 2YEVC 3LK2B 5DJQC 5M4YA 4UXUA 1HS7A 3WAJA 5LYJE 3VR8A 3FZMB 2CWOA 4COFA 4O2BE 4JI7T 5AQSB 4BAYB 2VL0A 4IGUA 2E9XA 3ONLC 4PIRA 2L9QA 5AQIB 4TV8E 4BJMA 3RYCE 5DQVA 4ILBA 4FJOA 1G8XA 2K3WA 5FXXA 4ANJA 3AEGA 2CWYA 3HKBE 3FXEB 4AKHA 2BG9B 1MIWA 1T8BA 2YOEA 2JMKA 2X9YA 3VRBA 5AFUL 3FZHB 5J1GA 3L09A 4AKLA 2W61A 3LBXB 3O1JA 4HWCA 3QOFA 3WTNA 2NTXA 2C9TA 3AEAA 5AQQB 2L8KA 4MLKA 3CQCB 2CHNA 4KHPT 3U3IA 3BQIA 1KF6A 1OEDE 5LP6E 4J2CA 1T7SA 4ILCA 5CO5A 5HXHA 2WZHA 2NR4A 3I0QA 2PTFA 3WTJA 2V1DB 4GIWA 4A5XA 1KNRA 2X0LB 4CN4A 1FJGT 4PJJA 5LBMA 4IDNA 3GWHA 3UFEA 2W2UA 1FMVA 5J2TE 4X20E 2BVLA 3ZN0B 5LJNA 4UV9B 2PGZA 2E9XD 4QXCB 2Q9QD 2BG9C 2MPKA 2XM1A 3RIAA 5HXCA 2V8SV 5F8PA 1OXZA 3P7IA 4FI5A 3R84B 2PFVA 3KV6A 5F3JA 2UU9T 2LKHA 2YN6A 2FUPA 2Z6EA 4NIQA 5JDQA 4YHJA 2LHRA 1IBLT 3ZMVB 2Y56A 5ETWA 3C50A 3ETVA 2PJQA 2JQHA 3JC6C 4H9RC 4X66T 3J7Yq 4Z8XA 3A7MA 3K8PC 4JUYA 1NWMX 1WR0A 4BJNA 4WBNE 2CBJA 3KFWX 3Q5EA 2WY2A 2XAHB 4PJLA 4ZK1A 5KE4A 2JMHA 3ZYKA 3T4MA 2L3LA 2CE7A 5AQUB 5FVLA 2CXDA 5L3CB 2LLYA 4ALXA 3X1DA 2H89A 4DNDA 2V5CA 3OJAA 1CHUA 3FB2A 3A5XA 5FJVA 3C79A 1IJ5A 1OWAA 2JIWA 1D1BA 4JEUB 2LSYA 2WNCA 4O4JE 3NWIA 3AB3B 3RIUA 5FL1A 4ZRUA 4QAAA 2CBIA 2VVSA 2C0SA 5ABGA 4D01A 1G73A 3H3AA 2LSKA 4KHZF 2XQ4A 4E7ZA 5JRCB 5AQRB 3VKHA 2V7MA 4DO0A 3OKQA 3EDUA 3Q2MA 1UGOA 4PK4A 2XQ8A 4B3MT 2E2AA 5CB4E 2W00A 3LSVA 2LM9A 1UX2A 4X1YE 3UU8A 3E0ZA 4LF6T 4HGAA 2RA1A 1US7B 5L47A 5LHHB 2WQYA 3UUNA 3RI5A 2WB5A 4NUVA 4DBQA 3HA4A 1D1CA 2WZYA 2BZBA 4ZJSA 2XTLA 5J0ZA 1CUNA 4ZXLA 2OA5A 1YKHB 5JTGA 5HCMA 4QACA 1X79A 1S35A 5JMEA 2XAFB 4HFDA 2CXFA 1WRDA 3I1AA 4OYJA 3CWZB 4IREA 4K0UA 3RYFE 2PBIA 4JBWF 2V7JA 2VKHA 3ZPOA 2CPTA 4TV9E 3WTHA 3I9YA 4HWHA 4ZI2D 2NW8A 4P09A 5ABEA 5KMGP 2AXDS 1HFAA 2C5IT 2ODUA 3P4WA 3KDSE 4IL4A 3TLUA 2WDVA 4HEAA 1WFDA 2YU1A 1FIOA 5IYZE 1XMOT 3E08A 4ZI3C 3ZDGA 4YSXA 5GONE 1SA0E 4YLHA 2UUBT 2FJEA 4UEMA 3M65A 3VHLA 2BYNA 4P0BA 5HAXA 4TUYE 2KNDA 2B1EA 1J5ET 5ADXL 3U8NA 4NZBA 5JH7E 4IDPA 4HN9A 2QGSA 4HFEA 4CQIA 2CCQA 2KWIB 4TZ4C 3PUGA 3BQLA 4X1IE 2R6GF 3AAEB 2EHOA 1QLBA 3ZSSA 4UM3P 3N9MA 2W8FA 3RQUA 4H9NC 3ZLIA 3AXJA 4DR6T 2V7KA 2VL8A 2XQAA 3KV9A 4ZR6A 1KEYA 2LRLA 2A9UA 3AAIA 1U5PA 2YDSA 3ONJA 4B3TT 2BBHA 1OEDA 3CX7B 4ZJTA 3ZC1A 4DMVA 4AIUA 3WTLA 4CZZB 2XPKA 2ZM2A 3TKLB 1KNPA 1LVKA 3MXZA 2JQQA 3PV0F 4HFVA 3AE4A 4O4LE 4PFPA 4IE7A 4CN1A 4X5TA 2WU2A 3J9X1 3RF1A 4KUMB 4K0KT 1WYCA 2BBJA 4DR4T 4YTPA 4ZZCA 2WNJA 4LMKA 3O4XE 1T72A 4HTEA 3AE5A 1J1JA 4UVAB 4NPPA 5DABA 5BMVE 4XAXB 4EB6E 5JR9A 5C3JA 4GYRA 3TLWA 2XNVA 1MNEA 2X9WA 4ERRA 4NUUA 3IF8B 4U33A 3UULA 2D5UA 5FKYA 5FL0A 2XJ7A 4PW8A 3ANWB 2XNUA 4KP3C 5SYOA 1XZYA 1D0ZA 3EUHA 1N33T 3M3ZB 4ZS3A 4H63V 5FY7A 2RPAA 2EHOD 3CKDA 4X64T 3AEFA 4X1KE 4AKIA 3CQXC 3HKEE 3ESLA 5JREA 2UZ6A 3E22E 4IT4A 4I55E 4NXMT 4LMJA 3MJXA 2KSRA 4UV8B 4DV7T 1VCSA 3RRWA 2XNTA 4JI5T 3RKGA 4M1PA 1QSDA 3DJBA 3UTKA 1E1HB 5CA0E 4ZI7E 3EI0A 3TLTA 2XQ3A 3N9OA 5J5IA 1MIYA 4A56A 3NRXA 2KZ7B 5LNKA 1SUMB 2JPFA 1FMWA 2AE9A 4LFAT 4QH1A 2XM2A 3RHWA 3ZMUB 4PAGA 4CXYA 4WZXA 3SWHA 4AQFC 4YY3T 5L3BB 5FY1A 4KI0F 3U8JA 3FZFB 1WYBA 4YXDA 2XAQB 3H3MA 1IBKT 5AQNB 5BR8T 3L8RA 4JI6T 4DUZT 4DV1T 2JRKA 2WDQA 4UM3A 2W67A 2XQYA 2Q9QA 4TN7B 4TWDA 4BFQA 1UCUA 2D9DA 2XHEB 2XUEA 4FRRA 4EZ4A 4QX7B 4ZS2A 4GYSA 3C4WA 3FZKB 2M6IA 5HEGA 5JDLA 3CMLA 3O1IA 3EAMA 3ZYLA 4XBFB 1UX5A 1D0YA 5HEJA 1ZV4X 4XHEA 3ZJ1A 3NBXX 4DIDB 2QRXA 3PU8A 3JCFA 2UXBT 3UUBA 2C5JA 2XQ6A 3ZMTB 4UF0B 3EVYA 5AFMB 2LOSA 1HG2A 2W66A 3I9WA 4CI2B 5KX5E 5KDMC 3WTIA 3AA6B 3Q9DA 3UU5A 3VRAA 1H7CA 4DV4T 2I0MA 3Q5XA 3CX6B 1MMAA 2JQKA 3N9LA 4DV2T 2CHOA 2UXNB 4PJNA 4CXXA 1E7PA 1L0VA 1IBMT 3T8OA 4LF8T 4CN6A 1WR6A 2CM0A 5FNVE 5C2TA 5CA1E 2IW5B 4DBRA 4AKGA 2X00A 4HQPA 3KINB 1YXRA 2VK9A 4PK6A 5CJ5A 4L0RA 4DV5T 2YKSA 4GK0E 1Y64B 2DLRA 3ZMZB 3PUQA 5AINA 4LMLA 2LOPA 1I94T 2BKPA 4XZCA 3AA0B 4EZHA 2YINA 3AE8A 2WMNA 2XASB 2I59A 1DU2A 5L3EB 4WNKA 3SQ6A 4B3RT 3QB5A 3S4UA 4AQYT 5AFHA 3VU7H 4H63H 5CGMA 2D2SA 3K3QC 1SHZC 3NKZA 4ILAA 2XSBA 4ISTA 4NXNT 1MMGA 2QA7A 5H6RB 4XK9A 2ACZA 2UXXB 3PTRB 2PG8A 3MK7C 5AQHB 4UR9A 5AQVB 1N34T 5LJMA 2B76A 1J5WA 2XAGB 3RYHE 5AQJB 3AA7B 4AFGA 5HXSA 2KMFA 3P8CD 5KXJA 1JNZA 4QHOA 2XY8B 3ETUA 3EABA 2H7OA 2XYSA 2G0UA 2X00D 4EEDA 5ABFB 2J47A 4ADZA 3WTKA 3R6NA 1UUSA 1Y01A 3QB5K 3SOLA 2IMLA 5IHYA 4X65T 3HL6A 2BG9A 3AVRA 5L3DB 3ABVA 3KVAA 5FXWA 4PJMA 1AJ3A 4DV3T 2XZ5A 4MBQA 3RPUA 3B5MA 3L3PA 4V1Av 3U8KA 3LFMA 4DR2T 3ZCJA 2YU2A 4QX8B 3LBXA 2N1GA 3OTOT 2VKJA 2X9XA 2VVNA 1UX4A 2A72A 3GN5B 2QVAA 3ZN1B 4MFRA 4PK5A 1ZEEA 3RGLA 3W15B 1Z0PA 3LJCA 3NVOA 2K24A 3PUSA 2ZJUA 2LHNA 3HR0A 3C64A 2W62A 1ZOYA 5LXBA 4EEBA 2V6YB 3Q5DA 3SRZA 3IA3A 2WMOA 4U7YA 3PUYF
chains in the Genus database with same CATH topology
4X5TA 4ZZBA 4QH1A 5CFBA 4COFA 2WNCA 3RHWA 4ZZCA 4A97A 3P4WA 5LG3A 2WNJA 4LMKA 2WNLA 5BP0A 2PGZA 5HEHA 4IL4A 3TLUA 2VL0A 5L4HA 2BG9C 4UM1A 3JAEA 4Z91A 4BQTA 5KZUA 3RIAA 5J5FA 4PIRA 3TLVA 4TWFA 4ZRUA 4AFGA 4QAAA 5BRXA 1I9BA 4NPPA 2BYRA 4ZK4A 3SIOA 4B5DA 2Y54A 3JAFA 4TNVA 4IL9A 4ILBA 3TLWA 3U8JA 2XNVA 4D01A 2XYSA 2X00D 3ZDGA 2XQ4A 3UU3A 2X00A 3WTKA 2LKHA 4HQPA 2WN9A 2YMDA 2YN6A 2BJ0A 5AFJA 2BG9B 4Z90A 2BYNA 2XQ5A 2YKSA 4HFHA 2XNUA 3JADA 2YOEA 1UV6A 5SYOA 2Y56A 4AFTA 4UM3S 3UU6A 4UM3A 3U8NA 4EZ1A 3UQ4A 4NZBA 2BG9A 4LMLA 5AINA 4QABA 4HFIA 5TVCA 2XQ8A 4WV9A 4TWDA 3GUAA 4BFQA 4DBMA 2ZJVA 3LSVA 5AFLA 3UU4A 2XZ5A 4HFEA 1UX2A 4FRRA 3WTOA 3U8KA 3UU8A 2XYTA 5IUXA 2M6IA 1OEDC 5HEGA 5L47A 2W8GA 3RI5A 3ZDHA 2Y7YA 4F8HA 3EAMA 4UM3P 2C9TA 2BR7A 2W8FA 2XZ6A 2BYQA 3U8LA 3WTNA 2MAWA 2BYSA 2LKGA 2UZ6A 2WZYA 5HCJA 3SQ6A 4AFHA 4TWHA 3RQUA 4ZJSA 4ZK1A 5KE4A 5HEJA 4HFBA 3T4MA 4XHEA 2QC1B 5J0ZA 5AFHA 4LMJA 5J5HA 1OEDE 2LM2A 5L4EA 2XQAA 2BR8A 3U8MA 2KSRA 3IGQA 4QH5A 5HCMA 4ILCA 4ZR6A 4QACA 4QH4A 2XNTA 4UY2A 2XQ7A 5JMEA 3UUBA 1OEDB 5CO5A 2Y58A 2XQ6A 4HFDA 5HEOA 5J5GA 3WTMA 2PH9A 3WIPA 5AFKA 2LLYA 4ILAA 2M6BA 3ZKRA 1UW6A 5AFNA 3PEOA 3WTJA 2ZJUA 4ALXA 5HEUA 5BW2A 5AFMB 4IREA 4HFCA 3RIFA 3TLSA 1OEDA 2YMEA 3PMZA 4ZJTA 5LXBA 3SH1A 4A98A 3RQWA 3WTLA 3WTIA 3C84A 4TNWA 5AFMA 4XK9A 3P50A 3EI0A 3TLTA 3SQ9A 5FJVA 2XQ3A 3UU5A 2BYPA 2XQ9A 3WTHA 3UQ7A 3EHZA 3C79A 5J5IA 2Y57A 4UXUA 2BG9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X5T A;  4ZZB A;  4QH1 A;  5CFB A;  4COF A;  2WNC A;  3RHW A;  4ZZC A;  4A97 A;  3P4W A;  5LG3 A;  2WNJ A;  4LMK A;  2WNL A;  5BP0 A;  2PGZ A;  5HEH A;  4IL4 A;  3TLU A;  2VL0 A;  5L4H A;  2BG9 C;  4UM1 A;  3JAE A;  4Z91 A;  4BQT A;  5KZU A;  3RIA A;  5J5F A;  4PIR A;  3TLV A;  4TWF A;  4ZRU A;  4AFG A;  4QAA A;  5BRX A;  1I9B A;  4NPP A;  2BYR A;  4ZK4 A;  3SIO A;  4B5D A;  2Y54 A;  3JAF A;  4TNV A;  4IL9 A;  4ILB A;  3TLW A;  3U8J A;  2XNV A;  4D01 A;  2XYS A;  2X00 D;  3ZDG A;  2XQ4 A;  3UU3 A;  2X00 A;  3WTK A;  2LKH A;  4HQP A;  2WN9 A;  2YMD A;  2YN6 A;  2BJ0 A;  5AFJ A;  2BG9 B;  4Z90 A;  2BYN A;  2XQ5 A;  2YKS A;  4HFH A;  2XNU A;  3JAD A;  2YOE A;  1UV6 A;  5SYO A;  2Y56 A;  4AFT A;  4UM3 S;  3UU6 A;  4UM3 A;  3U8N A;  4EZ1 A;  3UQ4 A;  4NZB A;  2BG9 A;  4LML A;  5AIN A;  4QAB A;  4HFI A;  5TVC A;  2XQ8 A;  4WV9 A;  4TWD A;  3GUA A;  4BFQ A;  4DBM A;  2ZJV A;  3LSV A;  5AFL A;  3UU4 A;  2XZ5 A;  4HFE A;  1UX2 A;  4FRR A;  3WTO A;  3U8K A;  3UU8 A;  2XYT A;  5IUX A;  2M6I A;  1OED C;  5HEG A;  5L47 A;  2W8G A;  3RI5 A;  3ZDH A;  2Y7Y A;  4F8H A;  3EAM A;  4UM3 P;  2C9T A;  2BR7 A;  2W8F A;  2XZ6 A;  2BYQ A;  3U8L A;  3WTN A;  2MAW A;  2BYS A;  2LKG A;  2UZ6 A;  2WZY A;  5HCJ A;  3SQ6 A;  4AFH A;  4TWH A;  3RQU A;  4ZJS A;  4ZK1 A;  5KE4 A;  5HEJ A;  4HFB A;  3T4M A;  4XHE A;  2QC1 B;  5J0Z A;  5AFH A;  4LMJ A;  5J5H A;  1OED E;  2LM2 A;  5L4E A;  2XQA A;  2BR8 A;  3U8M A;  2KSR A;  3IGQ A;  4QH5 A;  5HCM A;  4ILC A;  4ZR6 A;  4QAC A;  4QH4 A;  2XNT A;  4UY2 A;  2XQ7 A;  5JME A;  3UUB A;  1OED B;  5CO5 A;  2Y58 A;  2XQ6 A;  4HFD A;  5HEO A;  5J5G A;  3WTM A;  2PH9 A;  3WIP A;  5AFK A;  2LLY A;  4ILA A;  2M6B A;  3ZKR A;  1UW6 A;  5AFN A;  3PEO A;  3WTJ A;  2ZJU A;  4ALX A;  5HEU A;  5BW2 A;  5AFM B;  4IRE A;  4HFC A;  3RIF A;  3TLS A;  1OED A;  2YME A;  3PMZ A;  4ZJT A;  5LXB A;  3SH1 A;  4A98 A;  3RQW A;  3WTL A;  3WTI A;  3C84 A;  4TNW A;  5AFM A;  4XK9 A;  3P50 A;  3EI0 A;  3TLT A;  3SQ9 A;  5FJV A;  2XQ3 A;  3UU5 A;  2BYP A;  2XQ9 A;  3WTH A;  3UQ7 A;  3EHZ A;  3C79 A;  5J5I A;  2Y57 A;  4UXU A;  2BG9 E; 
#chains in the Genus database with same CATH topology
 2LJL A;  3MA9 A;  4ZZB A;  1R8I A;  4TX5 A;  4A97 A;  1NEN A;  2BS4 A;  4UM1 A;  4BQT A;  5KZU A;  2DCF A;  2X0H A;  4TNV A;  2NOX A;  5E0O A;  3RLF F;  1N36 T;  4JI2 T;  1ZKE A;  3QK6 A;  2WN9 A;  3BQK A;  3DP7 A;  3QUJ A;  4IDZ A;  1UK5 A;  4ZEY A;  2QYW A;  1B7T A;  4AFT A;  3UU6 A;  5FXV A;  3ZT7 A;  4QAB A;  3KV5 A;  4YSY A;  2ES0 A;  2CA5 A;  1HNZ T;  5IUX A;  3U78 A;  4L5G A;  2Y7Y A;  3OYX A;  5LA6 E;  2XZ6 A;  1EZ3 A;  4B6X A;  3JC6 D;  4U2Y A;  5LCY A;  2RP4 A;  5HEO A;  2DHR A;  4OX9 T;  4EIW A;  3PEO A;  3HI2 A;  4IIJ E;  4LF5 T;  3FBZ A;  3ZCI A;  3T1Y T;  2VQE T;  5JDG A;  1HNX T;  3P50 A;  2ODV A;  2W4X A;  1GQE A;  4YFS A;  4AQG A;  4LFC T;  1D1A A;  4ZOL E;  2HPL A;  1W9R A;  3PUX F;  2IIU A;  2E9X B;  2Q9Q B;  5IWA T;  3N5L A;  4U3C A;  3ZMS B;  3TLV A;  4HE8 A;  3FBL A;  2A3D A;  3SIO A;  4DR1 T;  4YTM A;  3N2K E;  3PJA J;  3AE7 A;  4UEL A;  5LGN B;  2J62 A;  4OK0 A;  5LHG B;  2KIN B;  4UM3 S;  5JRC A;  2Y6X A;  4HFI A;  3AE2 A;  5TAO A;  1HG5 A;  2V7I A;  2BS2 A;  1X9B A;  4CI1 B;  4JI4 T;  4I50 E;  5AQP B;  3SS1 A;  2F4V T;  3PE0 A;  2HH7 A;  2CLY B;  1VOM A;  4DVD A;  2BR7 A;  3B57 A;  3NZQ A;  3IEE A;  5LBQ B;  3RH3 A;  4YJ3 E;  2FBW A;  5HYA A;  5C8Y E;  1VRB A;  2WCA A;  2IHR 1;  3WAK A;  2FJB A;  4UY2 A;  3PUV F;  2Y58 A;  3WTM A;  2SPC A;  2PH9 A;  2Y8D A;  4AIS A;  2E9X C;  1YQ4 A;  2Q9Q C;  1VCT A;  3RQW A;  2K5B B;  2NW9 A;  3SQ9 A;  2BYP A;  5L3G B;  1FEW A;  2X51 A;  2DL1 A;  3FHN A;  4Q25 A;  3CQG B;  2CXL A;  1W0A A;  4EAH A;  2LSJ A;  3C51 A;  5LMN T;  1I9B A;  2DWK A;  1XWM A;  4DR3 T;  2WWU A;  3SFD A;  5EK3 A;  4JI8 T;  4GK5 E;  4HKA A;  4U72 A;  3KBU A;  4UIG A;  2GK9 A;  2XQ5 A;  3GA8 A;  3ZT5 A;  1SE7 A;  2CLY C;  2KT9 A;  3P4R A;  2BS3 A;  4EZ1 A;  2P9B A;  5TVC A;  3SFE A;  2JJ9 A;  2FJD A;  2ZM0 A;  2H3R A;  5AFL A;  4ZI3 D;  3FZL B;  3P4S A;  3D0T A;  4JI0 T;  3ZDH A;  5AQO B;  3IBP A;  2XSA A;  5AQL B;  3NRY A;  4C91 A;  3RRC A;  1HX8 A;  2MAW A;  4DV6 T;  4U7I A;  5FXZ A;  3AE6 A;  2V7L A;  3MAC A;  2VWA A;  3T1H T;  2BR8 A;  3AEB A;  2LE8 A;  4U2Z A;  3AA1 B;  3P4Q A;  5HWX A;  1LKX A;  5J5G A;  4QKN A;  2BKO A;  2D0U A;  1T98 A;  5BW2 A;  1JNR A;  3K3N A;  4HFC A;  3CIR A;  3PMZ A;  1YD8 G;  3SH1 A;  4A98 A;  3C84 A;  4TNW A;  1WLX A;  3C98 B;  5JDN A;  2LRK A;  3EHZ A;  2BKN A;  3CPZ A;  3PUZ F;  1IJ6 A;  5HXR A;  5FP3 A;  3DTO A;  4OYK A;  4Z91 A;  2WWV A;  5BRX A;  3V5S A;  3CK6 A;  4ZK4 A;  2IAK A;  2Y54 A;  3HKD E;  4JEH B;  4IL9 A;  2YDR A;  3KBT A;  5JQG E;  2HN2 A;  4JV5 T;  3OYZ A;  2C5K T;  2N2N A;  4QXB B;  4PNI A;  4IDQ A;  4KX6 A;  2D0T A;  5L2L A;  4Z90 A;  1HF8 A;  3UUM A;  1D0X A;  4AQF A;  3V5U A;  4H9P C;  4GOU A;  3F2E A;  2VB6 A;  3ANW A;  4C90 A;  2ZJV A;  3ZEF B;  3PUA A;  5F5W A;  3CVR A;  2ZMA A;  5JDM A;  2IUB A;  4G2A A;  4I43 B;  1NEK A;  2BYS A;  2LKG A;  5HCJ A;  1IAP A;  2M67 A;  5LG4 A;  3PUR A;  2K9A A;  1XMQ T;  3LK4 2;  2XAJ B;  3HKC E;  5L4E A;  3U8M A;  4ILU A;  4ZI2 C;  3ZJ2 A;  3G06 A;  4IDO A;  2HPJ A;  1BR4 A;  2J4G A;  2NP9 A;  5AFK A;  1UW6 A;  4I4T E;  4ISS A;  4CXW A;  2BDE A;  3RIF A;  2YME A;  3RIU C;  4EGW A;  3K1S A;  2NWB A;  3C4X A;  4AKR B;  3P4P A;  5AQF B;  2XQ9 A;  3WI3 A;  4WW0 A;  2LSG A;  4DUY T;  4PFO A;  3PUW F;  2CMR A;  4YHH T;  5LG3 A;  4WYV A;  2FJA A;  5HEH A;  5L4H A;  3QNU A;  5J2U E;  4B5D A;  2KLQ A;  3AEE A;  2ZM6 T;  1YKE B;  5A1L A;  2X9H A;  2VAS A;  5AQK B;  2MYS A;  4H9Q C;  2E5L T;  2WDR A;  1BR2 A;  2Y48 B;  5LGU B;  1HNW T;  3I0O A;  2H88 A;  4O4I E;  1KFY A;  4JI3 T;  5AQT B;  1MND A;  2EHO B;  4BA9 A;  2V26 A;  3VR9 A;  1M7K A;  1LRZ A;  2WSS V;  3AXJ B;  3U8L A;  2CRB A;  2BYQ A;  4YSZ A;  2MBG A;  4EOZ B;  1N32 T;  3VKG A;  4EV6 A;  2DWG A;  3A8Y C;  4X62 T;  1M62 A;  3IGQ A;  1KK7 A;  4QH4 A;  1OED B;  1E2A A;  4O2A E;  2UUA T;  2E5V A;  3ZYM A;  5LB7 B;  4HWD A;  2IDO B;  4UF0 A;  1U4Q A;  4DMW A;  3LK3 B;  5AFM A;  5FVK A;  1XDO A;  2MOZ A;  4LFB T;  4YJ2 E;  4JI1 T;  2Y57 A;  1W0B A;  5CFB A;  3RC3 A;  3GMI A;  4HWI B;  1I6Z A;  4DR5 T;  3PU3 A;  2WNL A;  5FMN A;  5JR9 B;  3JAE A;  4GKJ T;  3AVS A;  2XZE A;  5AQG B;  2BYR A;  2ACX A;  3L39 A;  3JAF A;  3NZP A;  2X67 A;  3UT5 E;  4P1N A;  2EHO C;  3OVU A;  3AEC A;  3RC8 A;  4OHF A;  4U74 A;  4WBO A;  2BJ0 A;  4MAL A;  3RKO A;  4JLE A;  2VUR A;  1NAF A;  1UV6 A;  3EDV A;  3N9Q A;  4MHC A;  2LEH A;  1HCI A;  2JQ9 A;  3N2G E;  3UQ4 A;  2X0Y A;  1HX1 B;  3GUA A;  5L3F B;  4DBM A;  3PJA A;  2LT3 A;  3WTO A;  5JVD E;  1OED C;  2DNX A;  4L9I A;  2K48 A;  4KMC A;  3OPC A;  1BR0 A;  3LG7 A;  5J5H A;  2LM2 A;  4AI6 A;  2IC9 A;  4QH5 A;  2BVM A;  5JDF A;  5FY0 A;  4OFZ A;  3K3O A;  2VKD A;  5HXE A;  5HEU A;  2ZM8 A;  4LF7 T;  2E8I A;  3B13 A;  4E7S A;  5JR9 C;  1XNQ T;  4UVC B;  2LSI A;  3LDQ B;  3AAA B;  4GKK T;  2WM9 A;  5LGT B;  3ZST A;  1HR0 T;  3Q5W A;  2DI4 A;  4IE5 A;  2V6X A;  3C4Z A;  5J5F A;  4QXH B;  4CI3 B;  2OLT A;  1YQ3 A;  3AE9 A;  1XDP A;  3UU3 A;  3AED A;  2W0G A;  1BR1 A;  1ZHC A;  3RX6 A;  3MZK B;  5ABF A;  5DQW A;  2WZI A;  1UUR A;  5JDH A;  3JAD A;  2YK0 A;  3CX8 B;  4IE4 A;  3N2O A;  4B3S T;  4WV9 A;  3UUX B;  4ZHQ E;  4U31 A;  4F6R C;  1WCR A;  3OBV E;  5ABH A;  4P0A A;  2W8G A;  3N9P A;  4F8H A;  4H9S E;  5H6Q B;  2W63 A;  3BK9 A;  4UVB B;  2UXC T;  2KXP B;  2UUC T;  3IHR A;  4DV0 T;  4KBM B;  1MMN A;  2I6H A;  4YT0 A;  3GN5 A;  2V5D A;  4ASK A;  5LOV E;  4N78 D;  2NW7 A;  2X66 A;  3KVB A;  2A2F X;  4QWN B;  2IC6 A;  4LF9 T;  4JYA T;  3O9X A;  5LXT E;  4O8S A;  4EYY R;  4EXT A;  3UQ7 A;  1HTJ F;  5LHI B;  2UXD T;  1Z8U A;  3MKD A;  2VKO A;  2V6Y A;  3AE3 A;  2NTY A;  2BG9 E;  2MTQ A;  3ONX A;  4AXP A;  3FXD B;  2WP9 A;  1MIV A;  3KV4 A;  5BP0 A;  3F31 A;  3F57 A;  2CEA A;  1V9D A;  2HHH T;  1O3X A;  4TWF A;  1S94 A;  4LF4 T;  3O1H A;  4EYU A;  2H7V C;  4I0U A;  4DR7 T;  2YMD A;  1KNZ A;  5AFJ A;  2YDQ A;  4HFH A;  3ZC0 A;  5HWY A;  1YW0 A;  5LMU T;  2N9D A;  4IHJ E;  5FYM A;  3QC9 A;  4UXN B;  2WBL A;  3UU4 A;  2WAU A;  5EK4 A;  2WU5 A;  2XYT A;  3RYI E;  3H37 A;  2KWH A;  3ZT6 A;  4H9O C;  1W09 A;  2VQF T;  5EK2 A;  4AFH A;  4TWH A;  3UFG A;  2OV9 A;  4YTN A;  4HFB A;  2QC1 B;  1LVF A;  1IZN B;  1QUU A;  2WS3 A;  2XQ7 A;  3AE1 A;  3WIP A;  4O4H E;  3ZKR A;  2M6B A;  5AFN A;  1MMD A;  3PDY A;  3N9N A;  4IE6 A;  1XNR T;  4HWF A;  3TLS A;  5EZY E;  4IE0 A;  5AQM B;  1ZP0 A;  2ZLY A;  2HN1 A;  2J1D G;  4G63 A;  2X68 A;  2YEV C;  3LK2 B;  5DJQ C;  5M4Y A;  4UXU A;  1HS7 A;  3WAJ A;  5LYJ E;  3VR8 A;  3FZM B;  2CWO A;  4COF A;  4O2B E;  4JI7 T;  5AQS B;  4BAY B;  2VL0 A;  4IGU A;  2E9X A;  3ONL C;  4PIR A;  2L9Q A;  5AQI B;  4TV8 E;  4BJM A;  3RYC E;  5DQV A;  4ILB A;  4FJO A;  1G8X A;  2K3W A;  5FXX A;  4ANJ A;  3AEG A;  2CWY A;  3HKB E;  3FXE B;  4AKH A;  2BG9 B;  1MIW A;  1T8B A;  2YOE A;  2JMK A;  2X9Y A;  3VRB A;  5AFU L;  3FZH B;  5J1G A;  3L09 A;  4AKL A;  2W61 A;  3LBX B;  3O1J A;  4HWC A;  3QOF A;  3WTN A;  2NTX A;  2C9T A;  3AEA A;  5AQQ B;  2L8K A;  4MLK A;  3CQC B;  2CHN A;  4KHP T;  3U3I A;  3BQI A;  1KF6 A;  1OED E;  5LP6 E;  4J2C A;  1T7S A;  4ILC A;  5CO5 A;  5HXH A;  2WZH A;  2NR4 A;  3I0Q A;  2PTF A;  3WTJ A;  2V1D B;  4GIW A;  4A5X A;  1KNR A;  2X0L B;  4CN4 A;  1FJG T;  4PJJ A;  5LBM A;  4IDN A;  3GWH A;  3UFE A;  2W2U A;  1FMV A;  5J2T E;  4X20 E;  2BVL A;  3ZN0 B;  5LJN A;  4UV9 B;  2PGZ A;  2E9X D;  4QXC B;  2Q9Q D;  2BG9 C;  2MPK A;  2XM1 A;  3RIA A;  5HXC A;  2V8S V;  5F8P A;  1OXZ A;  3P7I A;  4FI5 A;  3R84 B;  2PFV A;  3KV6 A;  5F3J A;  2UU9 T;  2LKH A;  2YN6 A;  2FUP A;  2Z6E A;  4NIQ A;  5JDQ A;  4YHJ A;  2LHR A;  1IBL T;  3ZMV B;  2Y56 A;  5ETW A;  3C50 A;  3ETV A;  2PJQ A;  2JQH A;  3JC6 C;  4H9R C;  4X66 T;  3J7Y q;  4Z8X A;  3A7M A;  3K8P C;  4JUY A;  1NWM X;  1WR0 A;  4BJN A;  4WBN E;  2CBJ A;  3KFW X;  3Q5E A;  2WY2 A;  2XAH B;  4PJL A;  4ZK1 A;  5KE4 A;  2JMH A;  3ZYK A;  3T4M A;  2L3L A;  2CE7 A;  5AQU B;  5FVL A;  2CXD A;  5L3C B;  2LLY A;  4ALX A;  3X1D A;  2H89 A;  4DND A;  2V5C A;  3OJA A;  1CHU A;  3FB2 A;  3A5X A;  5FJV A;  3C79 A;  1IJ5 A;  1OWA A;  2JIW A;  1D1B A;  4JEU B;  2LSY A;  2WNC A;  4O4J E;  3NWI A;  3AB3 B;  3RIU A;  5FL1 A;  4ZRU A;  4QAA A;  2CBI A;  2VVS A;  2C0S A;  5ABG A;  4D01 A;  1G73 A;  3H3A A;  2LSK A;  4KHZ F;  2XQ4 A;  4E7Z A;  5JRC B;  5AQR B;  3VKH A;  2V7M A;  4DO0 A;  3OKQ A;  3EDU A;  3Q2M A;  1UGO A;  4PK4 A;  2XQ8 A;  4B3M T;  2E2A A;  5CB4 E;  2W00 A;  3LSV A;  2LM9 A;  1UX2 A;  4X1Y E;  3UU8 A;  3E0Z A;  4LF6 T;  4HGA A;  2RA1 A;  1US7 B;  5L47 A;  5LHH B;  2WQY A;  3UUN A;  3RI5 A;  2WB5 A;  4NUV A;  4DBQ A;  3HA4 A;  1D1C A;  2WZY A;  2BZB A;  4ZJS A;  2XTL A;  5J0Z A;  1CUN A;  4ZXL A;  2OA5 A;  1YKH B;  5JTG A;  5HCM A;  4QAC A;  1X79 A;  1S35 A;  5JME A;  2XAF B;  4HFD A;  2CXF A;  1WRD A;  3I1A A;  4OYJ A;  3CWZ B;  4IRE A;  4K0U A;  3RYF E;  2PBI A;  4JBW F;  2V7J A;  2VKH A;  3ZPO A;  2CPT A;  4TV9 E;  3WTH A;  3I9Y A;  4HWH A;  4ZI2 D;  2NW8 A;  4P09 A;  5ABE A;  5KMG P;  2AXD S;  1HFA A;  2C5I T;  2ODU A;  3P4W A;  3KDS E;  4IL4 A;  3TLU A;  2WDV A;  4HEA A;  1WFD A;  2YU1 A;  1FIO A;  5IYZ E;  1XMO T;  3E08 A;  4ZI3 C;  3ZDG A;  4YSX A;  5GON E;  1SA0 E;  4YLH A;  2UUB T;  2FJE A;  4UEM A;  3M65 A;  3VHL A;  2BYN A;  4P0B A;  5HAX A;  4TUY E;  2KND A;  2B1E A;  1J5E T;  5ADX L;  3U8N A;  4NZB A;  5JH7 E;  4IDP A;  4HN9 A;  2QGS A;  4HFE A;  4CQI A;  2CCQ A;  2KWI B;  4TZ4 C;  3PUG A;  3BQL A;  4X1I E;  2R6G F;  3AAE B;  2EHO A;  1QLB A;  3ZSS A;  4UM3 P;  3N9M A;  2W8F A;  3RQU A;  4H9N C;  3ZLI A;  3AXJ A;  4DR6 T;  2V7K A;  2VL8 A;  2XQA A;  3KV9 A;  4ZR6 A;  1KEY A;  2LRL A;  2A9U A;  3AAI A;  1U5P A;  2YDS A;  3ONJ A;  4B3T T;  2BBH A;  1OED A;  3CX7 B;  4ZJT A;  3ZC1 A;  4DMV A;  4AIU A;  3WTL A;  4CZZ B;  2XPK A;  2ZM2 A;  3TKL B;  1KNP A;  1LVK A;  3MXZ A;  2JQQ A;  3PV0 F;  4HFV A;  3AE4 A;  4O4L E;  4PFP A;  4IE7 A;  4CN1 A;  4X5T A;  2WU2 A;  3J9X 1;  3RF1 A;  4KUM B;  4K0K T;  1WYC A;  2BBJ A;  4DR4 T;  4YTP A;  4ZZC A;  2WNJ A;  4LMK A;  3O4X E;  1T72 A;  4HTE A;  3AE5 A;  1J1J A;  4UVA B;  4NPP A;  5DAB A;  5BMV E;  4XAX B;  4EB6 E;  5JR9 A;  5C3J A;  4GYR A;  3TLW A;  2XNV A;  1MNE A;  2X9W A;  4ERR A;  4NUU A;  3IF8 B;  4U33 A;  3UUL A;  2D5U A;  5FKY A;  5FL0 A;  2XJ7 A;  4PW8 A;  3ANW B;  2XNU A;  4KP3 C;  5SYO A;  1XZY A;  1D0Z A;  3EUH A;  1N33 T;  3M3Z B;  4ZS3 A;  4H63 V;  5FY7 A;  2RPA A;  2EHO D;  3CKD A;  4X64 T;  3AEF A;  4X1K E;  4AKI A;  3CQX C;  3HKE E;  3ESL A;  5JRE A;  2UZ6 A;  3E22 E;  4IT4 A;  4I55 E;  4NXM T;  4LMJ A;  3MJX A;  2KSR A;  4UV8 B;  4DV7 T;  1VCS A;  3RRW A;  2XNT A;  4JI5 T;  3RKG A;  4M1P A;  1QSD A;  3DJB A;  3UTK A;  1E1H B;  5CA0 E;  4ZI7 E;  3EI0 A;  3TLT A;  2XQ3 A;  3N9O A;  5J5I A;  1MIY A;  4A56 A;  3NRX A;  2KZ7 B;  5LNK A;  1SUM B;  2JPF A;  1FMW A;  2AE9 A;  4LFA T;  4QH1 A;  2XM2 A;  3RHW A;  3ZMU B;  4PAG A;  4CXY A;  4WZX A;  3SWH A;  4AQF C;  4YY3 T;  5L3B B;  5FY1 A;  4KI0 F;  3U8J A;  3FZF B;  1WYB A;  4YXD A;  2XAQ B;  3H3M A;  1IBK T;  5AQN B;  5BR8 T;  3L8R A;  4JI6 T;  4DUZ T;  4DV1 T;  2JRK A;  2WDQ A;  4UM3 A;  2W67 A;  2XQY A;  2Q9Q A;  4TN7 B;  4TWD A;  4BFQ A;  1UCU A;  2D9D A;  2XHE B;  2XUE A;  4FRR A;  4EZ4 A;  4QX7 B;  4ZS2 A;  4GYS A;  3C4W A;  3FZK B;  2M6I A;  5HEG A;  5JDL A;  3CML A;  3O1I A;  3EAM A;  3ZYL A;  4XBF B;  1UX5 A;  1D0Y A;  5HEJ A;  1ZV4 X;  4XHE A;  3ZJ1 A;  3NBX X;  4DID B;  2QRX A;  3PU8 A;  3JCF A;  2UXB T;  3UUB A;  2C5J A;  2XQ6 A;  3ZMT B;  4UF0 B;  3EVY A;  5AFM B;  2LOS A;  1HG2 A;  2W66 A;  3I9W A;  4CI2 B;  5KX5 E;  5KDM C;  3WTI A;  3AA6 B;  3Q9D A;  3UU5 A;  3VRA A;  1H7C A;  4DV4 T;  2I0M A;  3Q5X A;  3CX6 B;  1MMA A;  2JQK A;  3N9L A;  4DV2 T;  2CHO A;  2UXN B;  4PJN A;  4CXX A;  1E7P A;  1L0V A;  1IBM T;  3T8O A;  4LF8 T;  4CN6 A;  1WR6 A;  2CM0 A;  5FNV E;  5C2T A;  5CA1 E;  2IW5 B;  4DBR A;  4AKG A;  2X00 A;  4HQP A;  3KIN B;  1YXR A;  2VK9 A;  4PK6 A;  5CJ5 A;  4L0R A;  4DV5 T;  2YKS A;  4GK0 E;  1Y64 B;  2DLR A;  3ZMZ B;  3PUQ A;  5AIN A;  4LML A;  2LOP A;  1I94 T;  2BKP A;  4XZC A;  3AA0 B;  4EZH A;  2YIN A;  3AE8 A;  2WMN A;  2XAS B;  2I59 A;  1DU2 A;  5L3E B;  4WNK A;  3SQ6 A;  4B3R T;  3QB5 A;  3S4U A;  4AQY T;  5AFH A;  3VU7 H;  4H63 H;  5CGM A;  2D2S A;  3K3Q C;  1SHZ C;  3NKZ A;  4ILA A;  2XSB A;  4IST A;  4NXN T;  1MMG A;  2QA7 A;  5H6R B;  4XK9 A;  2ACZ A;  2UXX B;  3PTR B;  2PG8 A;  3MK7 C;  5AQH B;  4UR9 A;  5AQV B;  1N34 T;  5LJM A;  2B76 A;  1J5W A;  2XAG B;  3RYH E;  5AQJ B;  3AA7 B;  4AFG A;  5HXS A;  2KMF A;  3P8C D;  5KXJ A;  1JNZ A;  4QHO A;  2XY8 B;  3ETU A;  3EAB A;  2H7O A;  2XYS A;  2G0U A;  2X00 D;  4EED A;  5ABF B;  2J47 A;  4ADZ A;  3WTK A;  3R6N A;  1UUS A;  1Y01 A;  3QB5 K;  3SOL A;  2IML A;  5IHY A;  4X65 T;  3HL6 A;  2BG9 A;  3AVR A;  5L3D B;  3ABV A;  3KVA A;  5FXW A;  4PJM A;  1AJ3 A;  4DV3 T;  2XZ5 A;  4MBQ A;  3RPU A;  3B5M A;  3L3P A;  4V1A v;  3U8K A;  3LFM A;  4DR2 T;  3ZCJ A;  2YU2 A;  4QX8 B;  3LBX A;  2N1G A;  3OTO T;  2VKJ A;  2X9X A;  2VVN A;  1UX4 A;  2A72 A;  3GN5 B;  2QVA A;  3ZN1 B;  4MFR A;  4PK5 A;  1ZEE A;  3RGL A;  3W15 B;  1Z0P A;  3LJC A;  3NVO A;  2K24 A;  3PUS A;  2ZJU A;  2LHN A;  3HR0 A;  3C64 A;  2W62 A;  1ZOY A;  5LXB A;  4EEB A;  2V6Y B;  3Q5D A;  3SRZ A;  3IA3 A;  2WMO A;  4U7Y A;  3PUY F; 
#chains in the Genus database with same CATH homology
 4X5T A;  4ZZB A;  4QH1 A;  5CFB A;  4COF A;  2WNC A;  3RHW A;  4ZZC A;  4A97 A;  3P4W A;  5LG3 A;  2WNJ A;  4LMK A;  2WNL A;  5BP0 A;  2PGZ A;  5HEH A;  4IL4 A;  3TLU A;  2VL0 A;  5L4H A;  2BG9 C;  4UM1 A;  3JAE A;  4Z91 A;  4BQT A;  5KZU A;  3RIA A;  5J5F A;  4PIR A;  3TLV A;  4TWF A;  4ZRU A;  4AFG A;  4QAA A;  5BRX A;  1I9B A;  4NPP A;  2BYR A;  4ZK4 A;  3SIO A;  4B5D A;  2Y54 A;  3JAF A;  4TNV A;  4IL9 A;  4ILB A;  3TLW A;  3U8J A;  2XNV A;  4D01 A;  2XYS A;  2X00 D;  3ZDG A;  2XQ4 A;  3UU3 A;  2X00 A;  3WTK A;  2LKH A;  4HQP A;  2WN9 A;  2YMD A;  2YN6 A;  2BJ0 A;  5AFJ A;  2BG9 B;  4Z90 A;  2BYN A;  2XQ5 A;  2YKS A;  4HFH A;  2XNU A;  3JAD A;  2YOE A;  1UV6 A;  5SYO A;  2Y56 A;  4AFT A;  4UM3 S;  3UU6 A;  4UM3 A;  3U8N A;  4EZ1 A;  3UQ4 A;  4NZB A;  2BG9 A;  4LML A;  5AIN A;  4QAB A;  4HFI A;  5TVC A;  2XQ8 A;  4WV9 A;  4TWD A;  3GUA A;  4BFQ A;  4DBM A;  2ZJV A;  3LSV A;  5AFL A;  3UU4 A;  2XZ5 A;  4HFE A;  1UX2 A;  4FRR A;  3WTO A;  3U8K A;  3UU8 A;  2XYT A;  5IUX A;  2M6I A;  1OED C;  5HEG A;  5L47 A;  2W8G A;  3RI5 A;  3ZDH A;  2Y7Y A;  4F8H A;  3EAM A;  4UM3 P;  2C9T A;  2BR7 A;  2W8F A;  2XZ6 A;  2BYQ A;  3U8L A;  3WTN A;  2MAW A;  2BYS A;  2LKG A;  2UZ6 A;  2WZY A;  5HCJ A;  3SQ6 A;  4AFH A;  4TWH A;  3RQU A;  4ZJS A;  4ZK1 A;  5KE4 A;  5HEJ A;  4HFB A;  3T4M A;  4XHE A;  2QC1 B;  5J0Z A;  5AFH A;  4LMJ A;  5J5H A;  1OED E;  2LM2 A;  5L4E A;  2XQA A;  2BR8 A;  3U8M A;  2KSR A;  3IGQ A;  4QH5 A;  5HCM A;  4ILC A;  4ZR6 A;  4QAC A;  4QH4 A;  2XNT A;  4UY2 A;  2XQ7 A;  5JME A;  3UUB A;  1OED B;  5CO5 A;  2Y58 A;  2XQ6 A;  4HFD A;  5HEO A;  5J5G A;  3WTM A;  2PH9 A;  3WIP A;  5AFK A;  2LLY A;  4ILA A;  2M6B A;  3ZKR A;  1UW6 A;  5AFN A;  3PEO A;  3WTJ A;  2ZJU A;  4ALX A;  5HEU A;  5BW2 A;  5AFM B;  4IRE A;  4HFC A;  3RIF A;  3TLS A;  1OED A;  2YME A;  3PMZ A;  4ZJT A;  5LXB A;  3SH1 A;  4A98 A;  3RQW A;  3WTL A;  3WTI A;  3C84 A;  4TNW A;  5AFM A;  4XK9 A;  3P50 A;  3EI0 A;  3TLT A;  3SQ9 A;  5FJV A;  2XQ3 A;  3UU5 A;  2BYP A;  2XQ9 A;  3WTH A;  3UQ7 A;  3EHZ A;  3C79 A;  5J5I A;  2Y57 A;  4UXU A;  2BG9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...