4QH4A

The glic pentameric ligand-gated ion channel (wild-type) crystallized in acetate buffer at ph3
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 90
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh4A01
4ILAA 3UUBA 4IL9A 3P4WA 3TLTA 3UU8A 4TNVA 1I9BA 2XZ5A 2BJ0A 2WNJA 4XHEA 1OEDE 2X00A 3SQ6A 2XYSA 2XQ4A 3UU6A 4HFHA 2XQ8A 3IGQA 4UM3P 4ILCA 3UU4A 4WV9A 3ZDGA 5LXBA 4IREA 4AFGA 5AFJA 2ZJVA 5AFHA 5HEJA 2BYQA 5CFBA 3RQUA 4HFDA 2LM2A 4ILBA 2BG9A 3UU5A 4AFTA 4DBMA 3SQ9A 4QH5A 2WN9A 2WNLA 5J5IA 2XQAA 5IUXA 4UM1A 4HQPA 5CO5A 3SH1A 4ZK4A 5HCMA 3LSVA 3JADA 4LMKA 4QH4A 5TVCA 2XNUA 5HEGA 2UZ6A 3U8JA 2Y56A 5J5HA 2BR8A 5HEHA 2W8FA 4HFEA 4COFA 2KSRA 4ZR6A 3WTNA 4TWFA 2XQ3A 3SIOA 3ZDHA 4HFIA 2YMEA 4QH1A 3WTHA 2LKGA 4NZBA 2YN6A 2Y54A 3RI5A 4A97A 4QABA 3JAEA 2QC1B 3EHZA 2LKHA 4UY2A 3WIPA 4AFHA 4UM3S 4LMLA 3U8MA 2XQ9A 3C79A 2YOEA 4UXUA 2BG9C 2BYSA 2Y57A 4A98A 4QACA 3WTKA 3PMZA 5BP0A 2YMDA 2XQ5A 4F8HA 2Y7YA 3WTOA 2XQ6A 2X00D 3RQWA 5KE4A 4Z91A 3P50A 2XNVA 1OEDB 5L4HA 3RIAA 4HFCA 2M6BA 5J5FA 3TLVA 3EAMA 4Z90A 2C9TA 5BW2A 3U8NA 4ZZCA 2VL0A 4ZK1A 2BG9E 5L4EA 4EZ1A 5AINA 2WZYA 5AFLA 2ZJUA 2BYNA 3WTLA 2PH9A 4ZRUA 5FJVA 5BRXA 3RHWA 2WNCA 4BQTA 2YKSA 2BYRA 4X5TA 2Y58A 5AFNA 4IL4A 2XNTA 5AFMB 3JAFA 4NPPA 5SYOA 1UW6A 3TLWA 5J0ZA 5HEOA 3U8LA 4TWDA 5JMEA 3UU3A 4LMJA 5L47A 5AFMA 2XZ6A 5KZUA 3PEOA 4D01A 5LG3A 3RIFA 3TLSA 1UX2A 2XYTA 4FRRA 4PIRA 4QAAA 3WTMA 3C84A 1OEDC 3UQ4A 3EI0A 4ZJSA 4BFQA 2MAWA 3ZKRA 2PGZA 4ZJTA 2BYPA 3UQ7A 5AFKA 4TNWA 3U8KA 4B5DA 5HEUA 4ZZBA 2W8GA 2BG9B 4HFBA 5J5GA 5HCJA 3TLUA 2BR7A 1OEDA 2LLYA 4XK9A 3WTIA 3T4MA 3WTJA 2XQ7A 3GUAA 4UM3A 4ALXA 2M6IA 1UV6A 4TWHA
chains in the Genus database with same CATH superfamily
4OX9T 4NUVA 4IDOA 3QK6A 1XZYA 5HAXA 2L3LA 2BS2A 2XQ4A 4UF0A 4UM3P 5AQJB 4JI3T 3CX6B 4IE0A 4P09A 5JQGE 3U3IA 2CLYB 4QXCB 1JNZA 2DLRA 2W66A 2J4GA 2V7KA 2XZEA 2BR8A 4ZHQE 3QB5K 2XASB 2QC1B 4AFHA 4LMLA 4K0UA 4QX8B 5LGTB 2J47A 1HF8A 4LF4T 3NRYA 3OVUA 3RGLA 3I1AA 4ZZCA 4GKKT 5FJVA 4JYAT 1IBLT 4O4JE 4CN1A 1UX4A 5AFMB 3QOFA 2CE7A 1XMQT 2VWAA 5JMEA 4X20E 4D01A 1VCSA 1SE7A 5LG3A 1UX2A 4PIRA 4CQIA 3KV6A 4EB6E 3U8KA 3K3OA 4ZZBA 2FJBA 4HFBA 1XDOA 2J62A 1YQ3A 3SOLA 1FJGT 3P4RA 4KI0F 5L3DB 3I0QA 2WNJA 1MIWA 2Y8DA 1VOMA 2XAQB 2WS3A 3F31A 3Q5EA 4ISTA 1HR0T 2E5LT 2E5VA 4TN7B 4DBRA 1XNRT 2DHRA 3OPCA 1E2AA 2PTFA 3QNUA 4P0AA 4EIWA 5L3CB 1MIVA 5CB4E 4ANJA 5C3JA 2E2AA 3N9NA 2CPTA 2CBJA 1HFAA 4AKHA 1MMDA 1FMVA 4NXMT 5JRCB 2LKHA 4YTNA 3CQGB 4YY3T 4X64T 4UVBB 4CI1B 5FNVE 2V6XA 3ZC1A 4ZRUA 2YKSA 2ODVA 1YXRA 3B13A 1M62A 3ANWB 4UV8B 3AA0B 4I55E 1GQEA 4FRRA 3P4SA 3UQ4A 3PU8A 4KMCA 2FJDA 4DR1T 5CA0E 2YU2A 1YQ4A 1ZEEA 5ADXL 2ZM2A 4TWHA 4ZXLA 1I6ZA 2W63A 3PURA 5J1GA 3UU8A 2X51A 1IBKT 3OJAA 1NAFA 3LK3B 4EXTA 4QX7B 2PJQA 4MLKA 1D1CA 2MOZA 4QXHB 1IBMT 3AE8A 3T1YT 4YJ3E 3H37A 1XNQT 4ILUA 3ZT5A 5AFHA 4H9SE 4TZ4C 4JI7T 3PUVF 4AKRB 1N36T 5J5IA 4HQPA 5HCMA 3V5UA 2E9XC 2UZ6A 2RP4A 2ZLYA 2JQQA 4YFSA 2KT9A 3ETUA 2OLTA 4OYJA 3ZT7A 2WDQA 3EHZA 4XAXB 2N2NA 1J1JA 2UXXB 2QGSA 4Q25A 4PK6A 4QXBB 2W0GA 1ZHCA 3RYHE 2Q9QD 4H63H 5ABFB 2LOSA 2Y58A 5AFNA 2NTXA 3TLWA 4DR6T 2IHR1 4PJLA 5AFMA 2AE9A 2BS3A 2BVMA 4ZI2D 3JCFA 5L3FB 4U3CA 3PUZF 4WW0A 4DMVA 1Y64B 2YEVC 1WR6A 3A8YC 5FKYA 1XWMA 5JDMA 1MIYA 1J5WA 3AEAA 3Q2MA 1BR4A 3B57A 5AQQB 3FXEB 2X9XA 4JEUB 4I50E 5FL0A 3AEFA 2V7MA 1JNRA 4YXDA 2CWOA 4LMKA 3VKHA 4EV6A 2UU9T 4COFA 3L39A 3R84B 2YMEA 2XJ7A 3WTHA 3AEDA 5FL1A 3HR0A 5C2TA 3CIRA 1NENA 3C79A 2W61A 1UX5A 4PK4A 3HKEE 2WP9A 2NW8A 3KBUA 5LGNB 2LSYA 4EZHA 2RPAA 1CHUA 2NP9A 5AQSB 4DBQA 4OFZA 3LG7A 2JMHA 2V5CA 2M67A 2NW9A 4X65T 3B5MA 1OEDC 2CEAA 2MAWA 3ZKRA 4ZJTA 5JTGA 2W8GA 5ABHA 4P0BA 2IIUA 2LLYA 5AQVB 4DV0T 3WTIA 4PW8A 3Q5WA 4KHZF 4ALXA 2JQ9A 2YINA 2UXCT 1OEDE 2W2UA 1OWAA 2C5JA 3FZMB 3ZCIA 2X0LB 2Y6XA 4M1PA 5L3BB 3VR9A 5TAOA 1J5ET 4DUYT 5DJQC 2D0TA 1QUUA 2ES0A 3QB5A 5JR9B 5LXTE 4L0RA 1YKHB 1ZV4X 3HI2A 5JDLA 3VRBA 4ZI3C 1OXZA 3AXJB 2MYSA 3GN5B 4HFEA 3J7Yq 4E7ZA 2YN6A 4YTPA 4HWHA 3AE9A 2D5UA 2Z6EA 3CKDA 5KMGP 4CXXA 3WAJA 5IWAT 3ETVA 4O4LE 2K5BB 2WMNA 3QC9A 3FZLB 3C4XA 2JQHA 4LFBT 2WNCA 4HGAA 5FP3A 3KBTA 3T8OA 5HEOA 5AQOB 4IE6A 5L47A 1HCIA 4JI2T 3VKGA 3NZQA 2EHOD 3VHLA 3NVOA 4OHFA 2ZMAA 2XPKA 2CHOA 3K3QC 1IJ6A 5J5GA 3LBXB 4YJ2E 3RC3A 4UM3A 3FBZA 3BQKA 4TNVA 2X00A 2FJEA 2H89A 2HN2A 3UUNA 1HG2A 1B7TA 3CWZB 2Q9QB 1E1HB 3PUGA 2QYWA 4AFGA 2XAHB 4DIDB 2X0HA 2X67A 3RYFE 2BYQA 4I4TE 3AE6A 3D0TA 5FMNA 2BG9A 1UURA 2DWGA 4DR5T 4QH5A 4IHJE 2XQAA 2HPLA 4LF6T 4IDPA 3ANWA 4G63A 5TVCA 2N9DA 5HEGA 2LE8A 5AQGB 4JI1T 3X1DA 3AECA 3N9QA 3U8MA 2YOEA 2XQ6A 5J5FA 2HN1A 3SRZA 2WZHA 2H88A 4DR7T 3RKOA 4BQTA 3ZMVB 4UELA 4DV7T 3MK7C 3HKDE 3VR8A 2LRLA 3AE5A 3UFGA 4NPPA 5E0OA 2IC6A 3GN5A 3O1IA 3UU3A 4IIJE 5JDHA 2ZM6T 3UTKA 3TLSA 5LHGB 2NW7A 2H7OA 4U7IA 5J2TE 3U78A 4H9QC 1DU2A 1HTJF 2LSGA 4HKAA 2AXDS 4YSYA 1QSDA 4DUZT 3KV9A 1KNRA 5JDNA 4IL9A 3DTOA 2G0UA 2WY2A 1I9BA 5AQKB 4X62T 4XHEA 2WU5A 5AQLB 2LRKA 4HEAA 3N9OA 4MFRA 2XQ8A 5FXVA 2DL1A 2X9YA 3NRXA 1KNZA 1W0AA 2X0YA 4ILBA 3RLFF 3UU5A 3SH1A 4DV3T 4UR9A 3NBXX 3BQIA 2D0UA 3OBVE 3KV5A 4PK5A 2W8FA 3AE2A 4V1Av 2UUBT 4DR4T 1HNWT 4CI2B 1MMNA 2V6YB 4B6XA 3WTKA 4JLEA 3LK42 3WTOA 2WWVA 2XNVA 2L8KA 2JJ9A 5BR8T 3U8NA 3RH3A 4XBFB 2ZJUA 5LGUB 1YD8G 4PJNA 3PUQA 4IL4A 5HXRA 2XNTA 1UW6A 2YDSA 3M3ZB 3PUXF 5FXZA 5FY1A 3WTMA 2CXLA 4ZOLE 5IYZE 5EK3A 2W62A 3FZFB 4TNWA 5FYMA 2LOPA 4PFPA 3V5SA 4AKLA 1Z8UA 4F6RC 5L3GB 3GUAA 1UV6A 2V6YA 3LK2B 3RIUA 2I6HA 3JC6C 4AQFA 2XYSA 5EK2A 1M7KA 4FJOA 2CHNA 4UEMA 3RYIE 2H7VC 3UUXB 2E9XD 2BS4A 5LNKA 4O4HE 4NIQA 3VU7H 4DBMA 2WBLA 1WYBA 5AQNB 5ETWA 3AB3B 4I43B 3CK6A 5HEHA 4AKGA 2E9XA 3WTNA 4HFIA 1SHZC 2UUAT 2V5DA 5FXXA 4LFAT 4KUMB 2JPFA 1X9BA 4MALA 3ZJ2A 5BP0A 2VVNA 5IHYA 1OEDB 3DP7A 5LB7B 3K3NA 4UXNB 2BG9E 4GKJT 3KVBA 2WMOA 2LSJA 5FVKA 3AA1B 2ACZA 4YLHA 3FB2A 3K8PC 3AVRA 5LOVE 2LM9A 5J0ZA 3J9X1 2XZ6A 3PV0F 3NKZA 3AAIA 4MHCA 4HWDA 5AFUL 5LBQB 3ZSTA 3UFEA 4BFQA 2PGZA 3HA4A 3UQ7A 2XSAA 2JQKA 3M65A 4HWIB 4DV5T 4GIWA 5AQTB 2DWKA 4AXPA 5J2UE 2CCQA 3F57A 3UUBA 5KXJA 3ZYLA 2BJ0A 4IGUA 3QUJA 4HFHA 4IT4A 2L9QA 2VKDA 4ILCA 4U31A 4XZCA 3ZDGA 4C91A 3N9MA 1E7PA 4DV4T 2CWYA 3ZC0A 2MTQA 2XHEB 3C98B 1WYCA 3SQ9A 3JC6D 4DV6T 2WNLA 4UM1A 3O4XE 2CMRA 4IDZA 4QH4A 5J5HA 2Q9QA 1D0ZA 2V26A 4C90A 1S35A 3HKCE 2Y54A 5LA6E 3I0OA 5M4YA 4UM3S 3CQXC 4JI4T 2XQ9A 2YK0A 5HXSA 4NUUA 2YMDA 1KK7A 5LP6E 3AAEB 4GYRA 4HN9A 2M6BA 2C9TA 1HNXT 1YKEB 4ZS3A 3EUHA 4ZS2A 3FHNA 4X5TA 3ZCJA 1UUSA 5JR9C 2PBIA 5HXEA 5ABEA 3I9YA 2CXDA 1N34T 3KDSE 2XYTA 3TKLB 2UXDT 3PJAJ 3EI0A 3PUYF 1KF6A 3E08A 2XSBA 4GK5E 3SFEA 1OEDA 2CBIA 4ZI2C 3O1HA 3T4MA 3WTJA 2XQ7A 2BBHA 2V1DB 4HWFA 1S94A 3G06A 4IE5A 3E0ZA 2EHOB 4PNIA 3UU6A 4K0KT 3OKQA 2E8IA 5LG4A 3UU4A 2WZIA 1SA0E 3AA7B 3CX8B 1UCUA 5CFBA 2KWIB 1BR0A 5LMUT 2HHHT 3MJXA 4HFDA 4H63V 2BZBA 4L5GA 4TX5A 4H9OC 2WWUA 5LHIB 4ZK4A 1T8BA 2Q9QC 4TWFA 4BAYB 4ZI7E 1I94T 4A97A 1L0VA 5LHHB 1ZKEA 4JUYA 1D0YA 2KINB 3EDUA 2X00D 3LFMA 3PJAA 2H3RA 5C8YE 1U5PA 1KFYA 5KX5E 5CGMA 2CXFA 3ONLC 2E9XB 5SYOA 4B3TT 3U8LA 2BKNA 2P9BA 4AI6A 4ASKA 2IUBA 5EZYE 3ZMSB 2EHOA 1MMAA 1KEYA 3NWIA 3L3PA 3ESLA 3ZMTB 4ERRA 5JVDE 2W00A 5AQIB 1VCTA 2YU1A 3TLTA 4QWNB 3T1HT 2WM9A 5FY7A 2BBJA 2UUCT 4H9RC 5HXCA 3SFDA 4JEHB 4OYKA 4JI0T 3WAKA 4ZEYA 4DV2T 2BDEA 4EGWA 2J1DG 3MKDA 3K1SA 2B1EA 2I0MA 1LVKA 3L8RA 4HE8A 3LJCA 2V8SV 3PE0A 3L09A 2WDRA 3F2EA 2V7LA 3ZT6A 4O8SA 1LKXA 5FVLA 4QKNA 4UVAB 2IW5B 1YW0A 2CRBA 3N9LA 2QVAA 4LF8T 4Z8XA 4ZI3D 1T72A 3AVSA 3ONXA 4GYSA 4A98A 4X66T 2I59A 3PMZA 2BVLA 3N2GE 3HKBE 2WQYA 3RQWA 1D0XA 4U2ZA 1BR1A 3WI3A 3ZYKA 2X68A 5AINA 2K9AA 2WZYA 2NR4A 2PH9A 4LF9T 5BRXA 3RHWA 3AXJA 1IZNB 5JH7E 4AQFC 4BJMA 3C4ZA 3EABA 3RIUC 5KZUA 4EZ4A 2NOXA 5JR9A 4QHOA 2QRXA 3KVAA 4U74A 4AQGA 2XQYA 3GMIA 3SWHA 2KMFA 1FEWA 1HNZT 3LBXA 4YSZA 3C4WA 2EHOC 4IDNA 2M6IA 4DMWA 2VVSA 5JREA 4PAGA 3MXZA 2V7JA 3AEGA 2XZ5A 2UXBT 5AQRB 4EAHA 3SQ6A 4JI5T 3ZN0B 1QLBA 2KNDA 2XY8B 5LXBA 5H6QB 4U2YA 2VKJA 4AISA 3GA8A 5HEJA 2XAJB 5LBMA 5CA1E 3I9WA 4AFTA 5H6RB 5IUXA 2XUEA 3PUWF 4X1YE 2DNXA 2A2FX 4UVCB 1R8IA 2OA5A 1LVFA 5HWXA 4O2BE 5EK4A 3P4PA 3KFWX 1IJ5A 3N2KE 2CM0A 2IAKA 4HWCA 2XQ5A 5KE4A 3HL6A 4EOZB 4A56A 2BKPA 4AQYT 3TLVA 4IE4A 4EZ1A 2BYNA 3WTLA 5GONE 4YSXA 5F5WA 5AQHB 3ABVA 1BR2A 3H3AA 3IF8B 4UV9B 5AQFB 3RKGA 2IMLA 4CI3B 2CLYC 1NWMX 3EVYA 5LJNA 4YHJA 3OYXA 2BG9B 2BKOA 3AE1A 4FI5A 4XK9A 4UF0B 4LF5T 3AE4A 3ZJ1A 2C5IT 2XAFB 1HX1B 4B3MT 5JRCA 2KZ7B 4CN4A 4IREA 3AEBA 3BQLA 3IHRA 4KBMB 2ZJVA 2F4VT 1WCRA 3H3MA 3RQUA 5AQUB 4IDQA 4JI6T 3PUAA 3A7MA 3C51A 4WBOA 5ABGA 4CXYA 1N33T 2XNUA 1VRBA 1UGOA 3N2OA 2SPCA 3ZSSA 4E7SA 3MZKB 4KHPT 3SIOA 2YDQA 4BA9A 5FY0A 3ONJA 4UY2A 2JRKA 4PJJA 2BG9C 2BYSA 2MBGA 2CA5A 4EYUA 2XM1A 4O2AE 4F8HA 2WCAA 2VB6A 1MNDA 3PU3A 3A5XA 4Z90A 3AA6B 4UIGA 2IC9A 1T98A 2LJLA 3Q9DA 2LSIA 1Y01A 4G2AA 2VQET 3FXDB 4GOUA 3RIFA 4QAAA 3ZEFB 3OTOT 3C84A 4HFVA 2V7IA 3VRAA 3P7IA 3PUSA 5JDGA 2K48A 1W09A 2X9HA 2LT3A 2ACXA 3KV4A 1U4QA 5DQVA 2WU2A 2DI4A 2W4XA 4DVDA 5AQMB 2Y48B 4GK0E 3RF1A 4YTMA 2KWHA 2X9WA 1X79A 2W67A 3N5LA 2ZM8A 3MA9A 4WYVA 5HWYA 2GK9A 2QA7A 1FMWA 2JIWA 4DO0A 5AFJA 4TV9E 3ZPOA 2VK9A 3FZHB 4NXNT 5L2LA 2YDRA 5AQPB 2PFVA 3LSVA 4DR2T 3JADA 2LHNA 3PTRB 4O4IE 3ZMUB 3CVRA 4DNDA 3OYZA 2KSRA 3ZDHA 2UXNB 2XQ3A 4NZBA 3RI5A 4U33A 1KNPA 4PJMA 3UULA 1HG5A 5CJ5A 1WRDA 2Y7YA 4H9PC 5DABA 4Z91A 4KP3C 5L4HA 4HFCA 3ZMZB 2C5KT 2WB5A 2VL0A 4IE7A 4ZK1A 2VQFT 2VL8A 1G8XA 1CUNA 3R6NA 3SS1A 2D2SA 2BYRA 5LJMA 2C0SA 2WSSV 2A72A 1G73A 2XM2A 2A9UA 3CX7B 3AE3A 4OK0A 2IDOB 3DJBA 3AAAB 4LFCT 4P1NA 4MBQA 4X1KE 2HH7A 4X1IE 3CQCB 1ZP0A 2LEHA 2KXPB 4AIUA 4DV1T 2VKOA 4BJNA 3ZLIA 3C50A 2B76A 2XTLA 3RPUA 3RRCA 2ZM0A 5A1LA 5JDQA 1HX8A 4HTEA 5LYJE 1V9DA 2FJAA 3BK9A 4LF7T 3KINB 3GWHA 5CO5A 1N32T 2KLQA 4PFOA 5LMNT 3U8JA 2LSKA 4JV5T 2K3WA 3UUMA 2DCFA 1NEKA 4QH1A 4EYYR 5HYAA 1AJ3A 1SUMB 3JAEA 3UT5E 1T7SA 1D1AA 2Y57A 2D9DA 4QACA 5KDMC 3ZYMA 2PG8A 1MNEA 3CMLA 3P8CD 3P50A 2FBWA 3AE7A 3RX6A 5HXHA 3IBPA 2MPKA 5BW2A 5L4EA 3FZKB 1W0BA 3P4QA 5AFLA 1Z0PA 5F3JA 2N1GA 1UK5A 1MMGA 4ADZA 3AEEA 2LHRA 3FBLA 1D1BA 3MACA 4CN6A 3JAFA 4U7YA 4TWDA 4LMJA 4ISSA 1EZ3A 4U72A 4YT0A 2BYPA 2A3DA 3NZPA 1WLXA 5HEUA 5HCJA 3TLUA 2BR7A 2OV9A 3ZN1B 1WR0A 4YHHT 4B5DA 2VKHA 3CPZA 4ILAA 2VASA 3IA3A 3P4WA 3RRWA 2HPJA 5DQWA 4DR3T 1IAPA 4I0UA 3IGQA 4WV9A 4L9IA 3C64A 3Q5DA 4EEDA 3E22E 4CXWA 2XAGB 4H9NC 2JMKA 2FUPA 2LM2A 2WN9A 3S4UA 4KX6A 3LDQB 2K24A 4AKIA 4B3RT 4WBNE 5F8PA 2Y56A 4TV8E 2ODUA 5L3EB 4ZR6A 1US7B 2LKGA 5JDFA 4QABA 4JBWF 5LCYA 4B3ST 3WIPA 2NTYA 3IEEA 4UXUA 3EDVA 3RYCE 1H7CA 1WFDA 3RIAA 2R6GF 3EAMA 4A5XA 1ZOYA 4J2CA 2X66A 3PDYA 4EEBA 1FIOA 3O9XA 3O1JA 4N78D 3W15B 2VURA 5ABFA 1XMOT 4CZZB 3N9PA 2NWBA 2WDVA 5FXWA 3PEOA 4ZJSA 5BMVE 4WZXA 2WAUA 4TUYE 5AFKA 1HS7A 4WNKA 4JI8T 1W9RA 3Q5XA 2RA1A 1LRZA 1XDPA 3RC8A 1O3XA
chains in the Genus database with same CATH topology
4ILAA 3UUBA 4IL9A 3P4WA 3TLTA 3UU8A 4TNVA 1I9BA 2XZ5A 2BJ0A 2WNJA 4XHEA 1OEDE 2X00A 3SQ6A 2XYSA 2XQ4A 3UU6A 4HFHA 2XQ8A 3IGQA 4UM3P 4ILCA 3UU4A 4WV9A 3ZDGA 5LXBA 4IREA 4AFGA 5AFJA 2ZJVA 5AFHA 5HEJA 2BYQA 5CFBA 3RQUA 4HFDA 2LM2A 4ILBA 2BG9A 3UU5A 4AFTA 4DBMA 3SQ9A 4QH5A 2WN9A 2WNLA 5J5IA 2XQAA 5IUXA 4UM1A 4HQPA 5CO5A 3SH1A 4ZK4A 5HCMA 3LSVA 3JADA 4LMKA 4QH4A 5TVCA 2XNUA 5HEGA 2UZ6A 3U8JA 2Y56A 5J5HA 2BR8A 5HEHA 2W8FA 4HFEA 4COFA 2KSRA 4ZR6A 3WTNA 4TWFA 2XQ3A 3SIOA 3ZDHA 4HFIA 2YMEA 4QH1A 3WTHA 2LKGA 4NZBA 2YN6A 2Y54A 3RI5A 4A97A 4QABA 3JAEA 2QC1B 3EHZA 2LKHA 4UY2A 3WIPA 4AFHA 4UM3S 4LMLA 3U8MA 2XQ9A 3C79A 2YOEA 4UXUA 2BG9C 2BYSA 2Y57A 4A98A 4QACA 3WTKA 3PMZA 5BP0A 2YMDA 2XQ5A 4F8HA 2Y7YA 3WTOA 2XQ6A 2X00D 3RQWA 5KE4A 4Z91A 3P50A 2XNVA 1OEDB 5L4HA 3RIAA 4HFCA 2M6BA 5J5FA 3TLVA 3EAMA 4Z90A 2C9TA 5BW2A 3U8NA 4ZZCA 2VL0A 4ZK1A 2BG9E 5L4EA 4EZ1A 5AINA 2WZYA 5AFLA 2ZJUA 2BYNA 3WTLA 2PH9A 4ZRUA 5FJVA 5BRXA 3RHWA 2WNCA 4BQTA 2YKSA 2BYRA 4X5TA 2Y58A 5AFNA 4IL4A 2XNTA 5AFMB 3JAFA 4NPPA 5SYOA 1UW6A 3TLWA 5J0ZA 5HEOA 3U8LA 4TWDA 5JMEA 3UU3A 4LMJA 5L47A 5AFMA 2XZ6A 5KZUA 3PEOA 4D01A 5LG3A 3RIFA 3TLSA 1UX2A 2XYTA 4FRRA 4PIRA 4QAAA 3WTMA 3C84A 1OEDC 3UQ4A 3EI0A 4ZJSA 4BFQA 2MAWA 3ZKRA 2PGZA 4ZJTA 2BYPA 3UQ7A 5AFKA 4TNWA 3U8KA 4B5DA 5HEUA 4ZZBA 2W8GA 2BG9B 4HFBA 5J5GA 5HCJA 3TLUA 2BR7A 1OEDA 2LLYA 4XK9A 3WTIA 3T4MA 3WTJA 2XQ7A 3GUAA 4UM3A 4ALXA 2M6IA 1UV6A 4TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILA A;  3UUB A;  4IL9 A;  3P4W A;  3TLT A;  3UU8 A;  4TNV A;  1I9B A;  2XZ5 A;  2BJ0 A;  2WNJ A;  4XHE A;  1OED E;  2X00 A;  3SQ6 A;  2XYS A;  2XQ4 A;  3UU6 A;  4HFH A;  2XQ8 A;  3IGQ A;  4UM3 P;  4ILC A;  3UU4 A;  4WV9 A;  3ZDG A;  5LXB A;  4IRE A;  4AFG A;  5AFJ A;  2ZJV A;  5AFH A;  5HEJ A;  2BYQ A;  5CFB A;  3RQU A;  4HFD A;  2LM2 A;  4ILB A;  2BG9 A;  3UU5 A;  4AFT A;  4DBM A;  3SQ9 A;  4QH5 A;  2WN9 A;  2WNL A;  5J5I A;  2XQA A;  5IUX A;  4UM1 A;  4HQP A;  5CO5 A;  3SH1 A;  4ZK4 A;  5HCM A;  3LSV A;  3JAD A;  4LMK A;  4QH4 A;  5TVC A;  2XNU A;  5HEG A;  2UZ6 A;  3U8J A;  2Y56 A;  5J5H A;  2BR8 A;  5HEH A;  2W8F A;  4HFE A;  4COF A;  2KSR A;  4ZR6 A;  3WTN A;  4TWF A;  2XQ3 A;  3SIO A;  3ZDH A;  4HFI A;  2YME A;  4QH1 A;  3WTH A;  2LKG A;  4NZB A;  2YN6 A;  2Y54 A;  3RI5 A;  4A97 A;  4QAB A;  3JAE A;  2QC1 B;  3EHZ A;  2LKH A;  4UY2 A;  3WIP A;  4AFH A;  4UM3 S;  4LML A;  3U8M A;  2XQ9 A;  3C79 A;  2YOE A;  4UXU A;  2BG9 C;  2BYS A;  2Y57 A;  4A98 A;  4QAC A;  3WTK A;  3PMZ A;  5BP0 A;  2YMD A;  2XQ5 A;  4F8H A;  2Y7Y A;  3WTO A;  2XQ6 A;  2X00 D;  3RQW A;  5KE4 A;  4Z91 A;  3P50 A;  2XNV A;  1OED B;  5L4H A;  3RIA A;  4HFC A;  2M6B A;  5J5F A;  3TLV A;  3EAM A;  4Z90 A;  2C9T A;  5BW2 A;  3U8N A;  4ZZC A;  2VL0 A;  4ZK1 A;  2BG9 E;  5L4E A;  4EZ1 A;  5AIN A;  2WZY A;  5AFL A;  2ZJU A;  2BYN A;  3WTL A;  2PH9 A;  4ZRU A;  5FJV A;  5BRX A;  3RHW A;  2WNC A;  4BQT A;  2YKS A;  2BYR A;  4X5T A;  2Y58 A;  5AFN A;  4IL4 A;  2XNT A;  5AFM B;  3JAF A;  4NPP A;  5SYO A;  1UW6 A;  3TLW A;  5J0Z A;  5HEO A;  3U8L A;  4TWD A;  5JME A;  3UU3 A;  4LMJ A;  5L47 A;  5AFM A;  2XZ6 A;  5KZU A;  3PEO A;  4D01 A;  5LG3 A;  3RIF A;  3TLS A;  1UX2 A;  2XYT A;  4FRR A;  4PIR A;  4QAA A;  3WTM A;  3C84 A;  1OED C;  3UQ4 A;  3EI0 A;  4ZJS A;  4BFQ A;  2MAW A;  3ZKR A;  2PGZ A;  4ZJT A;  2BYP A;  3UQ7 A;  5AFK A;  4TNW A;  3U8K A;  4B5D A;  5HEU A;  4ZZB A;  2W8G A;  2BG9 B;  4HFB A;  5J5G A;  5HCJ A;  3TLU A;  2BR7 A;  1OED A;  2LLY A;  4XK9 A;  3WTI A;  3T4M A;  3WTJ A;  2XQ7 A;  3GUA A;  4UM3 A;  4ALX A;  2M6I A;  1UV6 A;  4TWH A; 
#chains in the Genus database with same CATH topology
 4OX9 T;  4NUV A;  4IDO A;  3QK6 A;  1XZY A;  5HAX A;  2L3L A;  2BS2 A;  2XQ4 A;  4UF0 A;  4UM3 P;  5AQJ B;  4JI3 T;  3CX6 B;  4IE0 A;  4P09 A;  5JQG E;  3U3I A;  2CLY B;  4QXC B;  1JNZ A;  2DLR A;  2W66 A;  2J4G A;  2V7K A;  2XZE A;  2BR8 A;  4ZHQ E;  3QB5 K;  2XAS B;  2QC1 B;  4AFH A;  4LML A;  4K0U A;  4QX8 B;  5LGT B;  2J47 A;  1HF8 A;  4LF4 T;  3NRY A;  3OVU A;  3RGL A;  3I1A A;  4ZZC A;  4GKK T;  5FJV A;  4JYA T;  1IBL T;  4O4J E;  4CN1 A;  1UX4 A;  5AFM B;  3QOF A;  2CE7 A;  1XMQ T;  2VWA A;  5JME A;  4X20 E;  4D01 A;  1VCS A;  1SE7 A;  5LG3 A;  1UX2 A;  4PIR A;  4CQI A;  3KV6 A;  4EB6 E;  3U8K A;  3K3O A;  4ZZB A;  2FJB A;  4HFB A;  1XDO A;  2J62 A;  1YQ3 A;  3SOL A;  1FJG T;  3P4R A;  4KI0 F;  5L3D B;  3I0Q A;  2WNJ A;  1MIW A;  2Y8D A;  1VOM A;  2XAQ B;  2WS3 A;  3F31 A;  3Q5E A;  4IST A;  1HR0 T;  2E5L T;  2E5V A;  4TN7 B;  4DBR A;  1XNR T;  2DHR A;  3OPC A;  1E2A A;  2PTF A;  3QNU A;  4P0A A;  4EIW A;  5L3C B;  1MIV A;  5CB4 E;  4ANJ A;  5C3J A;  2E2A A;  3N9N A;  2CPT A;  2CBJ A;  1HFA A;  4AKH A;  1MMD A;  1FMV A;  4NXM T;  5JRC B;  2LKH A;  4YTN A;  3CQG B;  4YY3 T;  4X64 T;  4UVB B;  4CI1 B;  5FNV E;  2V6X A;  3ZC1 A;  4ZRU A;  2YKS A;  2ODV A;  1YXR A;  3B13 A;  1M62 A;  3ANW B;  4UV8 B;  3AA0 B;  4I55 E;  1GQE A;  4FRR A;  3P4S A;  3UQ4 A;  3PU8 A;  4KMC A;  2FJD A;  4DR1 T;  5CA0 E;  2YU2 A;  1YQ4 A;  1ZEE A;  5ADX L;  2ZM2 A;  4TWH A;  4ZXL A;  1I6Z A;  2W63 A;  3PUR A;  5J1G A;  3UU8 A;  2X51 A;  1IBK T;  3OJA A;  1NAF A;  3LK3 B;  4EXT A;  4QX7 B;  2PJQ A;  4MLK A;  1D1C A;  2MOZ A;  4QXH B;  1IBM T;  3AE8 A;  3T1Y T;  4YJ3 E;  3H37 A;  1XNQ T;  4ILU A;  3ZT5 A;  5AFH A;  4H9S E;  4TZ4 C;  4JI7 T;  3PUV F;  4AKR B;  1N36 T;  5J5I A;  4HQP A;  5HCM A;  3V5U A;  2E9X C;  2UZ6 A;  2RP4 A;  2ZLY A;  2JQQ A;  4YFS A;  2KT9 A;  3ETU A;  2OLT A;  4OYJ A;  3ZT7 A;  2WDQ A;  3EHZ A;  4XAX B;  2N2N A;  1J1J A;  2UXX B;  2QGS A;  4Q25 A;  4PK6 A;  4QXB B;  2W0G A;  1ZHC A;  3RYH E;  2Q9Q D;  4H63 H;  5ABF B;  2LOS A;  2Y58 A;  5AFN A;  2NTX A;  3TLW A;  4DR6 T;  2IHR 1;  4PJL A;  5AFM A;  2AE9 A;  2BS3 A;  2BVM A;  4ZI2 D;  3JCF A;  5L3F B;  4U3C A;  3PUZ F;  4WW0 A;  4DMV A;  1Y64 B;  2YEV C;  1WR6 A;  3A8Y C;  5FKY A;  1XWM A;  5JDM A;  1MIY A;  1J5W A;  3AEA A;  3Q2M A;  1BR4 A;  3B57 A;  5AQQ B;  3FXE B;  2X9X A;  4JEU B;  4I50 E;  5FL0 A;  3AEF A;  2V7M A;  1JNR A;  4YXD A;  2CWO A;  4LMK A;  3VKH A;  4EV6 A;  2UU9 T;  4COF A;  3L39 A;  3R84 B;  2YME A;  2XJ7 A;  3WTH A;  3AED A;  5FL1 A;  3HR0 A;  5C2T A;  3CIR A;  1NEN A;  3C79 A;  2W61 A;  1UX5 A;  4PK4 A;  3HKE E;  2WP9 A;  2NW8 A;  3KBU A;  5LGN B;  2LSY A;  4EZH A;  2RPA A;  1CHU A;  2NP9 A;  5AQS B;  4DBQ A;  4OFZ A;  3LG7 A;  2JMH A;  2V5C A;  2M67 A;  2NW9 A;  4X65 T;  3B5M A;  1OED C;  2CEA A;  2MAW A;  3ZKR A;  4ZJT A;  5JTG A;  2W8G A;  5ABH A;  4P0B A;  2IIU A;  2LLY A;  5AQV B;  4DV0 T;  3WTI A;  4PW8 A;  3Q5W A;  4KHZ F;  4ALX A;  2JQ9 A;  2YIN A;  2UXC T;  1OED E;  2W2U A;  1OWA A;  2C5J A;  3FZM B;  3ZCI A;  2X0L B;  2Y6X A;  4M1P A;  5L3B B;  3VR9 A;  5TAO A;  1J5E T;  4DUY T;  5DJQ C;  2D0T A;  1QUU A;  2ES0 A;  3QB5 A;  5JR9 B;  5LXT E;  4L0R A;  1YKH B;  1ZV4 X;  3HI2 A;  5JDL A;  3VRB A;  4ZI3 C;  1OXZ A;  3AXJ B;  2MYS A;  3GN5 B;  4HFE A;  3J7Y q;  4E7Z A;  2YN6 A;  4YTP A;  4HWH A;  3AE9 A;  2D5U A;  2Z6E A;  3CKD A;  5KMG P;  4CXX A;  3WAJ A;  5IWA T;  3ETV A;  4O4L E;  2K5B B;  2WMN A;  3QC9 A;  3FZL B;  3C4X A;  2JQH A;  4LFB T;  2WNC A;  4HGA A;  5FP3 A;  3KBT A;  3T8O A;  5HEO A;  5AQO B;  4IE6 A;  5L47 A;  1HCI A;  4JI2 T;  3VKG A;  3NZQ A;  2EHO D;  3VHL A;  3NVO A;  4OHF A;  2ZMA A;  2XPK A;  2CHO A;  3K3Q C;  1IJ6 A;  5J5G A;  3LBX B;  4YJ2 E;  3RC3 A;  4UM3 A;  3FBZ A;  3BQK A;  4TNV A;  2X00 A;  2FJE A;  2H89 A;  2HN2 A;  3UUN A;  1HG2 A;  1B7T A;  3CWZ B;  2Q9Q B;  1E1H B;  3PUG A;  2QYW A;  4AFG A;  2XAH B;  4DID B;  2X0H A;  2X67 A;  3RYF E;  2BYQ A;  4I4T E;  3AE6 A;  3D0T A;  5FMN A;  2BG9 A;  1UUR A;  2DWG A;  4DR5 T;  4QH5 A;  4IHJ E;  2XQA A;  2HPL A;  4LF6 T;  4IDP A;  3ANW A;  4G63 A;  5TVC A;  2N9D A;  5HEG A;  2LE8 A;  5AQG B;  4JI1 T;  3X1D A;  3AEC A;  3N9Q A;  3U8M A;  2YOE A;  2XQ6 A;  5J5F A;  2HN1 A;  3SRZ A;  2WZH A;  2H88 A;  4DR7 T;  3RKO A;  4BQT A;  3ZMV B;  4UEL A;  4DV7 T;  3MK7 C;  3HKD E;  3VR8 A;  2LRL A;  3AE5 A;  3UFG A;  4NPP A;  5E0O A;  2IC6 A;  3GN5 A;  3O1I A;  3UU3 A;  4IIJ E;  5JDH A;  2ZM6 T;  3UTK A;  3TLS A;  5LHG B;  2NW7 A;  2H7O A;  4U7I A;  5J2T E;  3U78 A;  4H9Q C;  1DU2 A;  1HTJ F;  2LSG A;  4HKA A;  2AXD S;  4YSY A;  1QSD A;  4DUZ T;  3KV9 A;  1KNR A;  5JDN A;  4IL9 A;  3DTO A;  2G0U A;  2WY2 A;  1I9B A;  5AQK B;  4X62 T;  4XHE A;  2WU5 A;  5AQL B;  2LRK A;  4HEA A;  3N9O A;  4MFR A;  2XQ8 A;  5FXV A;  2DL1 A;  2X9Y A;  3NRX A;  1KNZ A;  1W0A A;  2X0Y A;  4ILB A;  3RLF F;  3UU5 A;  3SH1 A;  4DV3 T;  4UR9 A;  3NBX X;  3BQI A;  2D0U A;  3OBV E;  3KV5 A;  4PK5 A;  2W8F A;  3AE2 A;  4V1A v;  2UUB T;  4DR4 T;  1HNW T;  4CI2 B;  1MMN A;  2V6Y B;  4B6X A;  3WTK A;  4JLE A;  3LK4 2;  3WTO A;  2WWV A;  2XNV A;  2L8K A;  2JJ9 A;  5BR8 T;  3U8N A;  3RH3 A;  4XBF B;  2ZJU A;  5LGU B;  1YD8 G;  4PJN A;  3PUQ A;  4IL4 A;  5HXR A;  2XNT A;  1UW6 A;  2YDS A;  3M3Z B;  3PUX F;  5FXZ A;  5FY1 A;  3WTM A;  2CXL A;  4ZOL E;  5IYZ E;  5EK3 A;  2W62 A;  3FZF B;  4TNW A;  5FYM A;  2LOP A;  4PFP A;  3V5S A;  4AKL A;  1Z8U A;  4F6R C;  5L3G B;  3GUA A;  1UV6 A;  2V6Y A;  3LK2 B;  3RIU A;  2I6H A;  3JC6 C;  4AQF A;  2XYS A;  5EK2 A;  1M7K A;  4FJO A;  2CHN A;  4UEM A;  3RYI E;  2H7V C;  3UUX B;  2E9X D;  2BS4 A;  5LNK A;  4O4H E;  4NIQ A;  3VU7 H;  4DBM A;  2WBL A;  1WYB A;  5AQN B;  5ETW A;  3AB3 B;  4I43 B;  3CK6 A;  5HEH A;  4AKG A;  2E9X A;  3WTN A;  4HFI A;  1SHZ C;  2UUA T;  2V5D A;  5FXX A;  4LFA T;  4KUM B;  2JPF A;  1X9B A;  4MAL A;  3ZJ2 A;  5BP0 A;  2VVN A;  5IHY A;  1OED B;  3DP7 A;  5LB7 B;  3K3N A;  4UXN B;  2BG9 E;  4GKJ T;  3KVB A;  2WMO A;  2LSJ A;  5FVK A;  3AA1 B;  2ACZ A;  4YLH A;  3FB2 A;  3K8P C;  3AVR A;  5LOV E;  2LM9 A;  5J0Z A;  3J9X 1;  2XZ6 A;  3PV0 F;  3NKZ A;  3AAI A;  4MHC A;  4HWD A;  5AFU L;  5LBQ B;  3ZST A;  3UFE A;  4BFQ A;  2PGZ A;  3HA4 A;  3UQ7 A;  2XSA A;  2JQK A;  3M65 A;  4HWI B;  4DV5 T;  4GIW A;  5AQT B;  2DWK A;  4AXP A;  5J2U E;  2CCQ A;  3F57 A;  3UUB A;  5KXJ A;  3ZYL A;  2BJ0 A;  4IGU A;  3QUJ A;  4HFH A;  4IT4 A;  2L9Q A;  2VKD A;  4ILC A;  4U31 A;  4XZC A;  3ZDG A;  4C91 A;  3N9M A;  1E7P A;  4DV4 T;  2CWY A;  3ZC0 A;  2MTQ A;  2XHE B;  3C98 B;  1WYC A;  3SQ9 A;  3JC6 D;  4DV6 T;  2WNL A;  4UM1 A;  3O4X E;  2CMR A;  4IDZ A;  4QH4 A;  5J5H A;  2Q9Q A;  1D0Z A;  2V26 A;  4C90 A;  1S35 A;  3HKC E;  2Y54 A;  5LA6 E;  3I0O A;  5M4Y A;  4UM3 S;  3CQX C;  4JI4 T;  2XQ9 A;  2YK0 A;  5HXS A;  4NUU A;  2YMD A;  1KK7 A;  5LP6 E;  3AAE B;  4GYR A;  4HN9 A;  2M6B A;  2C9T A;  1HNX T;  1YKE B;  4ZS3 A;  3EUH A;  4ZS2 A;  3FHN A;  4X5T A;  3ZCJ A;  1UUS A;  5JR9 C;  2PBI A;  5HXE A;  5ABE A;  3I9Y A;  2CXD A;  1N34 T;  3KDS E;  2XYT A;  3TKL B;  2UXD T;  3PJA J;  3EI0 A;  3PUY F;  1KF6 A;  3E08 A;  2XSB A;  4GK5 E;  3SFE A;  1OED A;  2CBI A;  4ZI2 C;  3O1H A;  3T4M A;  3WTJ A;  2XQ7 A;  2BBH A;  2V1D B;  4HWF A;  1S94 A;  3G06 A;  4IE5 A;  3E0Z A;  2EHO B;  4PNI A;  3UU6 A;  4K0K T;  3OKQ A;  2E8I A;  5LG4 A;  3UU4 A;  2WZI A;  1SA0 E;  3AA7 B;  3CX8 B;  1UCU A;  5CFB A;  2KWI B;  1BR0 A;  5LMU T;  2HHH T;  3MJX A;  4HFD A;  4H63 V;  2BZB A;  4L5G A;  4TX5 A;  4H9O C;  2WWU A;  5LHI B;  4ZK4 A;  1T8B A;  2Q9Q C;  4TWF A;  4BAY B;  4ZI7 E;  1I94 T;  4A97 A;  1L0V A;  5LHH B;  1ZKE A;  4JUY A;  1D0Y A;  2KIN B;  3EDU A;  2X00 D;  3LFM A;  3PJA A;  2H3R A;  5C8Y E;  1U5P A;  1KFY A;  5KX5 E;  5CGM A;  2CXF A;  3ONL C;  2E9X B;  5SYO A;  4B3T T;  3U8L A;  2BKN A;  2P9B A;  4AI6 A;  4ASK A;  2IUB A;  5EZY E;  3ZMS B;  2EHO A;  1MMA A;  1KEY A;  3NWI A;  3L3P A;  3ESL A;  3ZMT B;  4ERR A;  5JVD E;  2W00 A;  5AQI B;  1VCT A;  2YU1 A;  3TLT A;  4QWN B;  3T1H T;  2WM9 A;  5FY7 A;  2BBJ A;  2UUC T;  4H9R C;  5HXC A;  3SFD A;  4JEH B;  4OYK A;  4JI0 T;  3WAK A;  4ZEY A;  4DV2 T;  2BDE A;  4EGW A;  2J1D G;  3MKD A;  3K1S A;  2B1E A;  2I0M A;  1LVK A;  3L8R A;  4HE8 A;  3LJC A;  2V8S V;  3PE0 A;  3L09 A;  2WDR A;  3F2E A;  2V7L A;  3ZT6 A;  4O8S A;  1LKX A;  5FVL A;  4QKN A;  4UVA B;  2IW5 B;  1YW0 A;  2CRB A;  3N9L A;  2QVA A;  4LF8 T;  4Z8X A;  4ZI3 D;  1T72 A;  3AVS A;  3ONX A;  4GYS A;  4A98 A;  4X66 T;  2I59 A;  3PMZ A;  2BVL A;  3N2G E;  3HKB E;  2WQY A;  3RQW A;  1D0X A;  4U2Z A;  1BR1 A;  3WI3 A;  3ZYK A;  2X68 A;  5AIN A;  2K9A A;  2WZY A;  2NR4 A;  2PH9 A;  4LF9 T;  5BRX A;  3RHW A;  3AXJ A;  1IZN B;  5JH7 E;  4AQF C;  4BJM A;  3C4Z A;  3EAB A;  3RIU C;  5KZU A;  4EZ4 A;  2NOX A;  5JR9 A;  4QHO A;  2QRX A;  3KVA A;  4U74 A;  4AQG A;  2XQY A;  3GMI A;  3SWH A;  2KMF A;  1FEW A;  1HNZ T;  3LBX A;  4YSZ A;  3C4W A;  2EHO C;  4IDN A;  2M6I A;  4DMW A;  2VVS A;  5JRE A;  4PAG A;  3MXZ A;  2V7J A;  3AEG A;  2XZ5 A;  2UXB T;  5AQR B;  4EAH A;  3SQ6 A;  4JI5 T;  3ZN0 B;  1QLB A;  2KND A;  2XY8 B;  5LXB A;  5H6Q B;  4U2Y A;  2VKJ A;  4AIS A;  3GA8 A;  5HEJ A;  2XAJ B;  5LBM A;  5CA1 E;  3I9W A;  4AFT A;  5H6R B;  5IUX A;  2XUE A;  3PUW F;  4X1Y E;  2DNX A;  2A2F X;  4UVC B;  1R8I A;  2OA5 A;  1LVF A;  5HWX A;  4O2B E;  5EK4 A;  3P4P A;  3KFW X;  1IJ5 A;  3N2K E;  2CM0 A;  2IAK A;  4HWC A;  2XQ5 A;  5KE4 A;  3HL6 A;  4EOZ B;  4A56 A;  2BKP A;  4AQY T;  3TLV A;  4IE4 A;  4EZ1 A;  2BYN A;  3WTL A;  5GON E;  4YSX A;  5F5W A;  5AQH B;  3ABV A;  1BR2 A;  3H3A A;  3IF8 B;  4UV9 B;  5AQF B;  3RKG A;  2IML A;  4CI3 B;  2CLY C;  1NWM X;  3EVY A;  5LJN A;  4YHJ A;  3OYX A;  2BG9 B;  2BKO A;  3AE1 A;  4FI5 A;  4XK9 A;  4UF0 B;  4LF5 T;  3AE4 A;  3ZJ1 A;  2C5I T;  2XAF B;  1HX1 B;  4B3M T;  5JRC A;  2KZ7 B;  4CN4 A;  4IRE A;  3AEB A;  3BQL A;  3IHR A;  4KBM B;  2ZJV A;  2F4V T;  1WCR A;  3H3M A;  3RQU A;  5AQU B;  4IDQ A;  4JI6 T;  3PUA A;  3A7M A;  3C51 A;  4WBO A;  5ABG A;  4CXY A;  1N33 T;  2XNU A;  1VRB A;  1UGO A;  3N2O A;  2SPC A;  3ZSS A;  4E7S A;  3MZK B;  4KHP T;  3SIO A;  2YDQ A;  4BA9 A;  5FY0 A;  3ONJ A;  4UY2 A;  2JRK A;  4PJJ A;  2BG9 C;  2BYS A;  2MBG A;  2CA5 A;  4EYU A;  2XM1 A;  4O2A E;  4F8H A;  2WCA A;  2VB6 A;  1MND A;  3PU3 A;  3A5X A;  4Z90 A;  3AA6 B;  4UIG A;  2IC9 A;  1T98 A;  2LJL A;  3Q9D A;  2LSI A;  1Y01 A;  4G2A A;  2VQE T;  3FXD B;  4GOU A;  3RIF A;  4QAA A;  3ZEF B;  3OTO T;  3C84 A;  4HFV A;  2V7I A;  3VRA A;  3P7I A;  3PUS A;  5JDG A;  2K48 A;  1W09 A;  2X9H A;  2LT3 A;  2ACX A;  3KV4 A;  1U4Q A;  5DQV A;  2WU2 A;  2DI4 A;  2W4X A;  4DVD A;  5AQM B;  2Y48 B;  4GK0 E;  3RF1 A;  4YTM A;  2KWH A;  2X9W A;  1X79 A;  2W67 A;  3N5L A;  2ZM8 A;  3MA9 A;  4WYV A;  5HWY A;  2GK9 A;  2QA7 A;  1FMW A;  2JIW A;  4DO0 A;  5AFJ A;  4TV9 E;  3ZPO A;  2VK9 A;  3FZH B;  4NXN T;  5L2L A;  2YDR A;  5AQP B;  2PFV A;  3LSV A;  4DR2 T;  3JAD A;  2LHN A;  3PTR B;  4O4I E;  3ZMU B;  3CVR A;  4DND A;  3OYZ A;  2KSR A;  3ZDH A;  2UXN B;  2XQ3 A;  4NZB A;  3RI5 A;  4U33 A;  1KNP A;  4PJM A;  3UUL A;  1HG5 A;  5CJ5 A;  1WRD A;  2Y7Y A;  4H9P C;  5DAB A;  4Z91 A;  4KP3 C;  5L4H A;  4HFC A;  3ZMZ B;  2C5K T;  2WB5 A;  2VL0 A;  4IE7 A;  4ZK1 A;  2VQF T;  2VL8 A;  1G8X A;  1CUN A;  3R6N A;  3SS1 A;  2D2S A;  2BYR A;  5LJM A;  2C0S A;  2WSS V;  2A72 A;  1G73 A;  2XM2 A;  2A9U A;  3CX7 B;  3AE3 A;  4OK0 A;  2IDO B;  3DJB A;  3AAA B;  4LFC T;  4P1N A;  4MBQ A;  4X1K E;  2HH7 A;  4X1I E;  3CQC B;  1ZP0 A;  2LEH A;  2KXP B;  4AIU A;  4DV1 T;  2VKO A;  4BJN A;  3ZLI A;  3C50 A;  2B76 A;  2XTL A;  3RPU A;  3RRC A;  2ZM0 A;  5A1L A;  5JDQ A;  1HX8 A;  4HTE A;  5LYJ E;  1V9D A;  2FJA A;  3BK9 A;  4LF7 T;  3KIN B;  3GWH A;  5CO5 A;  1N32 T;  2KLQ A;  4PFO A;  5LMN T;  3U8J A;  2LSK A;  4JV5 T;  2K3W A;  3UUM A;  2DCF A;  1NEK A;  4QH1 A;  4EYY R;  5HYA A;  1AJ3 A;  1SUM B;  3JAE A;  3UT5 E;  1T7S A;  1D1A A;  2Y57 A;  2D9D A;  4QAC A;  5KDM C;  3ZYM A;  2PG8 A;  1MNE A;  3CML A;  3P8C D;  3P50 A;  2FBW A;  3AE7 A;  3RX6 A;  5HXH A;  3IBP A;  2MPK A;  5BW2 A;  5L4E A;  3FZK B;  1W0B A;  3P4Q A;  5AFL A;  1Z0P A;  5F3J A;  2N1G A;  1UK5 A;  1MMG A;  4ADZ A;  3AEE A;  2LHR A;  3FBL A;  1D1B A;  3MAC A;  4CN6 A;  3JAF A;  4U7Y A;  4TWD A;  4LMJ A;  4ISS A;  1EZ3 A;  4U72 A;  4YT0 A;  2BYP A;  2A3D A;  3NZP A;  1WLX A;  5HEU A;  5HCJ A;  3TLU A;  2BR7 A;  2OV9 A;  3ZN1 B;  1WR0 A;  4YHH T;  4B5D A;  2VKH A;  3CPZ A;  4ILA A;  2VAS A;  3IA3 A;  3P4W A;  3RRW A;  2HPJ A;  5DQW A;  4DR3 T;  1IAP A;  4I0U A;  3IGQ A;  4WV9 A;  4L9I A;  3C64 A;  3Q5D A;  4EED A;  3E22 E;  4CXW A;  2XAG B;  4H9N C;  2JMK A;  2FUP A;  2LM2 A;  2WN9 A;  3S4U A;  4KX6 A;  3LDQ B;  2K24 A;  4AKI A;  4B3R T;  4WBN E;  5F8P A;  2Y56 A;  4TV8 E;  2ODU A;  5L3E B;  4ZR6 A;  1US7 B;  2LKG A;  5JDF A;  4QAB A;  4JBW F;  5LCY A;  4B3S T;  3WIP A;  2NTY A;  3IEE A;  4UXU A;  3EDV A;  3RYC E;  1H7C A;  1WFD A;  3RIA A;  2R6G F;  3EAM A;  4A5X A;  1ZOY A;  4J2C A;  2X66 A;  3PDY A;  4EEB A;  1FIO A;  3O9X A;  3O1J A;  4N78 D;  3W15 B;  2VUR A;  5ABF A;  1XMO T;  4CZZ B;  3N9P A;  2NWB A;  2WDV A;  5FXW A;  3PEO A;  4ZJS A;  5BMV E;  4WZX A;  2WAU A;  4TUY E;  5AFK A;  1HS7 A;  4WNK A;  4JI8 T;  1W9R A;  3Q5X A;  2RA1 A;  1LRZ A;  1XDP A;  3RC8 A;  1O3X A; 
#chains in the Genus database with same CATH homology
 4ILA A;  3UUB A;  4IL9 A;  3P4W A;  3TLT A;  3UU8 A;  4TNV A;  1I9B A;  2XZ5 A;  2BJ0 A;  2WNJ A;  4XHE A;  1OED E;  2X00 A;  3SQ6 A;  2XYS A;  2XQ4 A;  3UU6 A;  4HFH A;  2XQ8 A;  3IGQ A;  4UM3 P;  4ILC A;  3UU4 A;  4WV9 A;  3ZDG A;  5LXB A;  4IRE A;  4AFG A;  5AFJ A;  2ZJV A;  5AFH A;  5HEJ A;  2BYQ A;  5CFB A;  3RQU A;  4HFD A;  2LM2 A;  4ILB A;  2BG9 A;  3UU5 A;  4AFT A;  4DBM A;  3SQ9 A;  4QH5 A;  2WN9 A;  2WNL A;  5J5I A;  2XQA A;  5IUX A;  4UM1 A;  4HQP A;  5CO5 A;  3SH1 A;  4ZK4 A;  5HCM A;  3LSV A;  3JAD A;  4LMK A;  4QH4 A;  5TVC A;  2XNU A;  5HEG A;  2UZ6 A;  3U8J A;  2Y56 A;  5J5H A;  2BR8 A;  5HEH A;  2W8F A;  4HFE A;  4COF A;  2KSR A;  4ZR6 A;  3WTN A;  4TWF A;  2XQ3 A;  3SIO A;  3ZDH A;  4HFI A;  2YME A;  4QH1 A;  3WTH A;  2LKG A;  4NZB A;  2YN6 A;  2Y54 A;  3RI5 A;  4A97 A;  4QAB A;  3JAE A;  2QC1 B;  3EHZ A;  2LKH A;  4UY2 A;  3WIP A;  4AFH A;  4UM3 S;  4LML A;  3U8M A;  2XQ9 A;  3C79 A;  2YOE A;  4UXU A;  2BG9 C;  2BYS A;  2Y57 A;  4A98 A;  4QAC A;  3WTK A;  3PMZ A;  5BP0 A;  2YMD A;  2XQ5 A;  4F8H A;  2Y7Y A;  3WTO A;  2XQ6 A;  2X00 D;  3RQW A;  5KE4 A;  4Z91 A;  3P50 A;  2XNV A;  1OED B;  5L4H A;  3RIA A;  4HFC A;  2M6B A;  5J5F A;  3TLV A;  3EAM A;  4Z90 A;  2C9T A;  5BW2 A;  3U8N A;  4ZZC A;  2VL0 A;  4ZK1 A;  2BG9 E;  5L4E A;  4EZ1 A;  5AIN A;  2WZY A;  5AFL A;  2ZJU A;  2BYN A;  3WTL A;  2PH9 A;  4ZRU A;  5FJV A;  5BRX A;  3RHW A;  2WNC A;  4BQT A;  2YKS A;  2BYR A;  4X5T A;  2Y58 A;  5AFN A;  4IL4 A;  2XNT A;  5AFM B;  3JAF A;  4NPP A;  5SYO A;  1UW6 A;  3TLW A;  5J0Z A;  5HEO A;  3U8L A;  4TWD A;  5JME A;  3UU3 A;  4LMJ A;  5L47 A;  5AFM A;  2XZ6 A;  5KZU A;  3PEO A;  4D01 A;  5LG3 A;  3RIF A;  3TLS A;  1UX2 A;  2XYT A;  4FRR A;  4PIR A;  4QAA A;  3WTM A;  3C84 A;  1OED C;  3UQ4 A;  3EI0 A;  4ZJS A;  4BFQ A;  2MAW A;  3ZKR A;  2PGZ A;  4ZJT A;  2BYP A;  3UQ7 A;  5AFK A;  4TNW A;  3U8K A;  4B5D A;  5HEU A;  4ZZB A;  2W8G A;  2BG9 B;  4HFB A;  5J5G A;  5HCJ A;  3TLU A;  2BR7 A;  1OED A;  2LLY A;  4XK9 A;  3WTI A;  3T4M A;  3WTJ A;  2XQ7 A;  3GUA A;  4UM3 A;  4ALX A;  2M6I A;  1UV6 A;  4TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...