4QH4A

The glic pentameric ligand-gated ion channel (wild-type) crystallized in acetate buffer at ph3
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus
total genus 90
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh4A01
4TWHA 4HQPA 5L4HA 3TLSA 1UX2A 2BYNA 4QABA 2LKHA 2QC1B 2WNJA 3U8JA 3EHZA 4QH4A 5TVCA 5CO5A 5J5FA 3EAMA 5SYOA 2YKSA 3ZDHA 3WTKA 3C84A 5KZUA 2XQ8A 4HFHA 4TNWA 5LG3A 3P4WA 2XYSA 4QACA 5HEGA 2M6BA 5J5GA 3LSVA 4ZZBA 4IL4A 3UU4A 3C79A 4QAAA 4UY2A 3WIPA 2XZ6A 5AFJA 2Y57A 3U8NA 2KSRA 3GUAA 2YOEA 5LXBA 4D01A 3TLTA 2BR7A 2BYRA 3WTLA 2XQ9A 5AFNA 2YMEA 5AFLA 2M6IA 3EI0A 4FRRA 4X5TA 3U8KA 4UM1A 4ZZCA 5BP0A 3ZKRA 5AFMA 1I9BA 2XQ5A 2YMDA 3WTMA 3PEOA 2PH9A 4UM3P 2XQ3A 4UM3S 4AFGA 2BYSA 1OEDC 4HFIA 4QH5A 4TWDA 3U8MA 4TWFA 2BG9B 3RIAA 3WTOA 3UU8A 2XQ4A 3UUBA 4Z91A 2BG9C 4WV9A 3PMZA 3JAEA 4ZJSA 4F8HA 4NPPA 2BR8A 3RI5A 3P50A 3TLWA 1UW6A 5FJVA 3RIFA 4ZK4A 2ZJUA 4Z90A 2XQAA 4ILCA 5HEJA 4XHEA 2WNLA 4ZRUA 2XYTA 4ILAA 5L4EA 4HFCA 3UQ7A 5BRXA 2BG9A 5HEUA 3UU6A 5BW2A 2BG9E 2BYPA 4AFTA 2Y54A 4DBMA 5IUXA 3UQ4A 4TNVA 2XQ7A 5HEHA 3RQUA 4A97A 3T4MA 4AFHA 5AINA 5JMEA 1OEDB 3WTNA 2WN9A 2LM2A 2XQ6A 4COFA 4A98A 5AFHA 4BQTA 4EZ1A 4ALXA 2BJ0A 2LLYA 4NZBA 1UV6A 4LMJA 3ZDGA 3JAFA 3TLUA 3SQ9A 4BFQA 5HCMA 4IREA 4ILBA 3SH1A 3IGQA 4HFDA 1OEDA 4HFBA 4HFEA 2VL0A 1OEDE 4PIRA 4XK9A 2XNUA 2LKGA 2BYQA 5J5HA 2XNVA 4LMKA 4ZJTA 2MAWA 4ZK1A 2WNCA 5AFMB 4UM3A 5HCJA 2XZ5A 5J0ZA 4B5DA 4LMLA 2ZJVA 3SIOA 3WTHA 3UU5A 2Y7YA 3RHWA 3U8LA 2YN6A 2Y58A 2W8GA 3WTJA 2WZYA 2X00A 5AFKA 3RQWA 4ZR6A 2XNTA 3WTIA 2UZ6A 5KE4A 4IL9A 5CFBA 2C9TA 2PGZA 2X00D 5J5IA 5L47A 4QH1A 3SQ6A 3JADA 2W8FA 4UXUA 2Y56A 5HEOA 3UU3A 3TLVA
chains in the Genus database with same CATH superfamily
5EZYE 2UXXB 5L4HA 3TLSA 1ZOYA 5J5FA 2ACXA 4O2BE 2QYWA 3Q9DA 2XASB 1YQ4A 2W4XA 1MNDA 1D0ZA 4ASKA 3L09A 5EK4A 4PNIA 4NXNT 4XZCA 2JMHA 3I9WA 3DP7A 1UX5A 3KV9A 3AAEB 2BYSA 1T98A 3N9LA 2LSIA 4BJMA 5FY7A 3UU8A 2X0HA 4I50E 4ZI3C 4X62T 4X1KE 3UQ7A 1LVFA 4IDOA 2BVLA 2BG9E 2JIWA 2NTXA 3UFGA 3NKZA 5AFHA 2ODUA 3J9X1 4GYSA 5EK2A 3BQLA 3HKEE 3KV5A 4B6XA 4B3ST 1HFAA 4U2ZA 3ZMVB 3AE1A 3RIUC 4DV4T 3E0ZA 4L5GA 2LSJA 4PJMA 2XSBA 4HWCA 5J5HA 5JR9B 2D9DA 2Y7YA 3U8LA 2BBJA 2X68A 2BKPA 2WP9A 3HKDE 2KZ7B 1QUUA 2UZ6A 3F2EA 5KE4A 5TAOA 3H37A 2KXPB 3QNUA 1J5ET 2NTYA 5KXJA 3AE6A 3VU7H 3PUZF 4C90A 4LF9T 4DMWA 2UUAT 1LRZA 3AA1B 4L9IA 3QUJA 2YK0A 1MIVA 2XYSA 3UT5E 1XDPA 3VKHA 4UVBB 3IF8B 4DVDA 3N9PA 4FJOA 4JYAT 2W61A 4IE7A 5LGNB 3EVYA 4EV6A 3NWIA 4CI2B 1I9BA 2XQ5A 2V26A 3AEBA 3PUAA 5L3GB 1KNRA 4UM3S 4EOZB 4HFIA 4EIWA 3ZC0A 4X1IE 1IJ5A 4DUZT 4O8SA 5HEJA 4HWFA 3PU8A 5BR8T 3DJBA 2FBWA 2BDEA 4HEAA 5LGTB 2MOZA 5EK3A 2EHOA 4EEBA 2ZM6T 2J62A 3AVSA 4OFZA 4BFQA 1W09A 3ZYMA 3SH1A 5FVKA 3CKDA 3AEAA 4AI6A 2XSAA 1D1AA 3CQCB 4LMKA 5LHGB 3QB5A 3A8YC 2MAWA 1ZV4X 4MALA 5AFMB 3N9NA 3ZT5A 2PFVA 4OYJA 3C98B 2X00A 3HA4A 4N78D 2AXDS 2WM9A 2VQET 3LBXB 2CBIA 5AQTB 3CX7B 3ANWA 2JJ9A 2H3RA 3IHRA 3RYFE 4HKAA 2HPLA 3K3OA 4JI1T 1WFDA 1HNZT 4JI7T 2BR7A 3ETUA 4DBQA 3FZKB 5LHHB 4X5TA 3RPUA 2X9HA 4G63A 5FVLA 3CPZA 2L9QA 4WNKA 2AE9A 3U3IA 3C4ZA 2WAUA 1KNPA 1BR4A 4K0KT 2X9XA 5ABFB 3UQ4A 2LSGA 4NXMT 3I1AA 4ZHQE 1HNXT 3EUHA 4ALXA 2VQFT 3PU3A 1IBKT 1UX4A 2LRKA 4P1NA 3ZSTA 4DV0T 5F5WA 3MA9A 1OEDA 5IHYA 5ABGA 4UF0A 3ZCJA 2BYQA 2V7JA 4O4IE 5L3BB 3K8PC 2LOPA 4TV8E 5LJNA 2PBIA 1IBMT 4JI5T 3WTJA 1XWMA 3NRXA 2JQHA 3B5MA 2C9TA 4YXDA 2WDQA 3AEGA 2CHOA 1R8IA 3N2KE 5AQSB 3HL6A 4HTEA 2HH7A 5SYOA 5JDMA 1W0BA 4NUVA 3AB3B 4F6RC 4TNWA 4QXCB 3C79A 1J1JA 2Y57A 2MPKA 2IIUA 4B3RT 3ZMTB 3P7IA 4P0AA 3MKDA 3JC6D 3ZLIA 3PEOA 4UELA 4QH5A 2LOSA 4TWDA 2NWBA 1HX8A 5AQGB 2XQ4A 4AKIA 2X9YA 1XZYA 3NZPA 5AQLB 1OXZA 1LVKA 3K1SA 4KUMB 3RIFA 3RX6A 4U3CA 4GK0E 4ILCA 5GONE 4U31A 4TX5A 4U7IA 2XYTA 4IT4A 5ETWA 2BS3A 4TZ4C 2Y54A 2DWGA 2XQ7A 4YSZA 3WI3A 2XQ6A 4WBNE 3VHLA 4YTMA 1N33T 2CWYA 1VRBA 4DR3T 4ZS3A 2I59A 1UURA 5C2TA 4H9RC 4HFDA 2HPJA 4HFBA 4MFRA 3OYXA 4H9SE 4EZHA 3FHNA 2Y48B 3PUSA 4AKHA 4O4JE 2IC9A 2V6XA 2CM0A 2FJDA 3WAJA 4DR1T 4AXPA 2W8GA 4IDZA 4CN1A 3B13A 2RPAA 3SQ6A 1WR6A 3I9YA 3UU3A 2WN9A 1NENA 2X9WA 2A9UA 2XHEB 4I4TE 4IDPA 2DWKA 2N2NA 4BA9A 2OA5A 4ILUA 5LG3A 3P4WA 5C3JA 2CBJA 4QAAA 3OBVE 4IL4A 2J4GA 5AQIB 2YOEA 2WDVA 5JQGE 4I0UA 4AQGA 5L3EB 2YMEA 4FRRA 1M62A 2E9XB 3H3MA 4Q25A 5AQFB 4EEDA 2PH9A 3V5UA 2UXCT 1WRDA 3N9QA 3O1JA 3AE4A 3LG7A 4JI0T 2BG9B 1SE7A 1KFYA 2X0YA 3JAEA 4ZJSA 2K5BB 2C0SA 2CXLA 2XY8B 2A2FX 3MJXA 1MIWA 4U72A 4O4LE 5HEUA 3UU6A 2VASA 2KNDA 2XAFB 4A97A 2FJBA 3N2OA 5L2LA 4A98A 4DV5T 5KMGP 1KF6A 2W00A 1UV6A 4DR7T 3BK9A 2PG8A 3PJAJ 3IGQA 4DIDB 3KBTA 4DV6T 2WWUA 3Q2MA 3EDUA 3HI2A 5IYZE 1OWAA 5AFKA 2Y6XA 2ZLYA 2BZBA 1HTJF 2J47A 3AAIA 3TLVA 2CXDA 4JI8T 3ZMUB 4QABA 3OPCA 3OTOT 5CO5A 3PURA 2IAKA 4HE8A 2XQ8A 4OHFA 1CHUA 4QACA 3LSVA 4ZZBA 1ZEEA 3PUYF 3WIPA 3AAAB 2JQQA 3CQXC 1MMAA 4DNDA 2EHOB 2L3LA 5AFLA 3EI0A 3UULA 3NBXX 5E0OA 1UGOA 1N36T 3SFEA 3X1DA 2JPFA 2XZEA 2LHNA 2HHHT 4DR6T 1YQ3A 3RRWA 2ZJUA 4DV3T 1ZP0A 4V1Av 4HWIB 4YHJA 5BW2A 5JMEA 2CPTA 4DO0A 3NZQA 3FXEB 5H6RB 3N5LA 4KHZF 3ZSSA 3ANWB 1HF8A 5FXZA 3SQ9A 2WDRA 2BS2A 2VL8A 3SRZA 2LSYA 3ZT6A 3DTOA 1QLBA 1MIYA 3CX6B 2XNUA 4YJ2E 4DBRA 2ES0A 2KT9A 2WY2A 3AECA 1XDOA 2C5IT 1FJGT 5JR9C 1CUNA 4B5DA 3D0TA 4X64T 3UU5A 3B57A 1WLXA 2CWOA 4IL9A 3MK7C 3Q5XA 4KX6A 1Y64B 4ZI7E 1U4QA 2JRKA 3ZYLA 4UIGA 3FZLB 5CA0E 2NOXA 1M7KA 5FKYA 3SS1A 3U8JA 4AQFC 4AIUA 1KK7A 4UVAB 4EXTA 2W62A 3MACA 5J5GA 3UU4A 3T1HT 5FXVA 2XZ6A 5AFJA 4YSYA 2V6YA 1FMWA 3UUMA 5LXBA 4BJNA 2RA1A 2CRBA 4YY3T 4E7ZA 2ODVA 1B7TA 3WTMA 1W9RA 5HXSA 4UF0B 4CN4A 2WWVA 2OV9A 5J2UE 1MMGA 2H89A 4OYKA 3N2GE 3OKQA 5AQKB 2KINB 1HG5A 5LYJE 2NP9A 5JREA 2XM1A 4YFSA 2A72A 2IDOB 4CXYA 2X0LB 4LFCT 2LEHA 2OLTA 2Q9QA 4LF5T 3JAFA 2QA7A 5HCMA 4IREA 3O9XA 1VCTA 4HN9A 4IHJE 4XK9A 3JCFA 4YJ3E 2VURA 2J1DG 2WNCA 4UM3A 2UUCT 3AEFA 3HKCE 3M65A 4KP3C 2Z6EA 3R6NA 5HXEA 2YDRA 4IE4A 3AVRA 3AEEA 4EZ1A 5HEOA 2WCAA 3VRBA 4CXXA 2V7LA 1YXRA 4J2CA 2H7VC 2W66A 4ZI2D 3ZDHA 4PK5A 3WTKA 2JMKA 4ISSA 4JLEA 3C84A 3SOLA 4IE0A 3CMLA 4ADZA 2K24A 4CI1B 1HS7A 3CK6A 1G73A 4ZZCA 5BP0A 3Q5WA 4UR9A 3FZMB 2YMDA 3ZN0B 3S4UA 3A5XA 1DU2A 3ZMSB 4KI0F 1J5WA 2XAHB 5AQPB 1SA0E 2V1DB 4AKRB 4JI4T 1JNRA 4Z90A 2XQAA 5DJQC 4ILAA 1IAPA 2VKDA 4LF8T 1D1BA 3CIRA 4AKLA 2XAJB 3LK3B 1NAFA 4MLKA 4LF7T 4ILBA 1HX1B 3R84B 1OEDE 4PFPA 5FNVE 3UUNA 4ZJTA 3KBUA 3RHWA 1N32T 2VK9A 3GN5A 4QWNB 5FXXA 3AE7A 2KWHA 4LF6T 3N9OA 5LMNT 5JDQA 1S94A 2FJEA 4HFHA 3RIUA 5CGMA 5HXRA 4UEMA 4IE6A 3NVOA 4UY2A 3AXJB 2RP4A 2X67A 5JDFA 4AQFA 4FI5A 2BYRA 3A7MA 4H9PC 4CXWA 4UM1A 1BR1A 1O3XA 3QOFA 4ZEYA 1SHZC 3MXZA 2V7KA 1ZKEA 4U33A 5KX5E 2X51A 3FBZA 4LFAT 4HFVA 3RKGA 3C50A 4F8HA 2C5KT 4ZOLE 3VRAA 3RRCA 2XJ7A 1WYBA 3TLWA 3U78A 2XAQB 2WB5A 2G0UA 4CZZB 1XNRT 2WMOA 3PDYA 3RQUA 5C8YE 3O1IA 3C4XA 2CLYB 4YT0A 5FY0A 4COFA 2ACZA 1XMOT 2V5CA 3PUQA 3OYZA 4QXHB 2E9XD 5ADXL 2K3WA 5FXWA 3ZEFB 5LCYA 4PIRA 2E5VA 1WCRA 3RLFF 2ZMAA 1QSDA 3ESLA 2FJAA 3P4RA 3PV0F 3RQWA 4YSXA 2XNTA 2LJLA 5AFUL 5JDLA 4HQPA 3LK2B 5JH7E 3EAMA 4QKNA 2YKSA 3CVRA 4PW8A 3JC6C 5KZUA 2VKOA 2IMLA 3QK6A 2M6BA 2K48A 4MBQA 2KMFA 3LBXA 4X66T 1VOMA 4XAXB 4X65T 2M6IA 2V7IA 4KHPT 2E9XC 2UXDT 4U74A 1MMNA 1ZHCA 3U8MA 2BG9C 4UXNB 4B3TT 3FZHB 4YHHT 4X20E 2B1EA 1UW6A 2BVMA 5LG4A 4BAYB 2E5LT 4XHEA 5JDGA 2LRLA 5L4EA 1N34T 3P8CD 2I0MA 4EGWA 1I94T 5IUXA 1D0YA 5LGUB 4WW0A 3H3AA 4HWHA 4H9QC 2X66A 2H88A 3AE5A 3ABVA 2W0GA 5AQOB 5ABHA 2EHOD 2GK9A 3TLUA 2A3DA 5ABFA 2V8SV 3I0QA 4UV9B 2V6YB 4GIWA 3ONLC 2QGSA 2XNVA 2L8KA 4HGAA 5HYAA 2N9DA 5J0ZA 4LMLA 5HWYA 3ONXA 1U5PA 4A5XA 3ZPOA 5CFBA 2VB6A 1D0XA 5JDHA 2X00D 5L3DB 5AQHB 3AE2A 3P4QA 3SWHA 2WMNA 4HWDA 2VVSA 1UX2A 2D0TA 5FMNA 2LKHA 2WNJA 2KLQA 5F8PA 3J7Yq 4GOUA 3AA6B 4EB6E 3PUGA 2WZHA 4ZXLA 2YINA 1FEWA 4WBOA 3F57A 4QHOA 5AQNB 3GA8A 4H9NC 4PFOA 2LT3A 4X1YE 3WTLA 5JTGA 5AFNA 2EHOC 2Q9QB 3ZKRA 2DL1A 3GMIA 2IUBA 3IA3A 5KDMC 4AFGA 4ZS2A 4L0RA 4EZ4A 3WTOA 3ZN1B 1HG2A 2YEVC 4KBMB 5J1GA 4TV9E 4ISTA 3QC9A 5LBMA 3K3NA 4K0UA 3EABA 4GKKT 5JVDE 4AFHA 3TKLB 3QB5K 2WSSV 3AE9A 1W0AA 3ZDGA 5A1LA 3E22E 3KDSE 3ZC1A 1I6ZA 2LKGA 1XNQT 3OJAA 4JBWF 1X79A 3N9MA 2SPCA 2Y58A 1EZ3A 3WAKA 3O4XE 2BKNA 4O4HE 2BYNA 3RYIE 2QRXA 2C5JA 3PUXF 4UV8B 5AQJB 4EAHA 1UK5A 3F31A 1MNEA 4DV7T 3AE8A 4PJNA 1XMQT 3L8RA 2WZIA 4JEHB 1OEDC 4PJJA 4Z91A 5DABA 2UXBT 4WV9A 2W67A 4OK0A 2WU2A 3KV4A 5LB7B 4OX9T 4B3MT 2E9XA 2CA5A 3ZCIA 5HXCA 3Q5DA 1E1HB 4ZRUA 3GN5B 5JRCA 2UUBT 2BG9A 2JQKA 2XUEA 2CE7A 4DBMA 4AFTA 5BMVE 1OEDB 3ZJ1A 4EYYR 2JQ9A 4H9OC 4NZBA 4JUYA 5FYMA 1E7PA 4LMJA 1MMDA 4E7SA 3UUXB 1BR2A 4M1PA 1WR0A 4HFEA 4YTPA 4UVCB 1LKXA 3AA0B 1V9DA 5FY1A 4I43B 2XZ5A 2WZYA 1Z8UA 4U2YA 2MBGA 3GWHA 1FMVA 3RYHE 4TWHA 4DR2T 3FBLA 3ZMZB 4JI6T 2LSKA 4LFBT 2HN1A 1T72A 2W2UA 2DNXA 1HCIA 2ZM2A 1JNZA 2XQ9A 3RH3A 1AJ3A 3PE0A 2KWIB 2UU9T 2QVAA 1GQEA 3PUWF 2CHNA 4NPPA 2IW5B 4AQYT 5FJVA 3M3ZB 4P0BA 4ZK4A 1H7CA 1KEYA 3BQKA 2WU5A 4P09A 4JEUB 4C91A 3IEEA 2PTFA 3WTNA 4IE5A 4BQTA 2V5DA 4IDQA 2BJ0A 2NW7A 2CMRA 3V5SA 5AQUB 2VVNA 1Y01A 3PUVF 5CB4E 5LXTE 3BQIA 2D0UA 2HN2A 4QX7B 3KVAA 2DI4A 5ABEA 2ZJVA 3VR8A 2M67A 1X9BA 4ZI2C 4WZXA 3AEDA 1WYCA 4ZR6A 3WTIA 4QH1A 2W8FA 4UXUA 3G06A 2Y56A 2QC1B 3CX8B 5H6QB 4QH4A 3RYCE 5LA6E 4DV1T 2D2SA 2CEAA 5L3CB 2ZM0A 4NUUA 2NW9A 3U8NA 2DHRA 3TLTA 5JR9A 3AA7B 3CQGB 5LJMA 3NRYA 3HR0A 1UUSA 5J2TE 2WBLA 3UUBA 1NWMX 4QXBB 5HXHA 1D1CA 2BR8A 3P50A 2FUPA 5LNKA 5LOVE 1YKHB 4H63H 2YDQA 3IBPA 2XAGB 4DV2T 2BYPA 1US7B 3EDVA 3T4MA 5AINA 5F3JA 2LM2A 3KFWX 2CLYC 3RKOA 5LBQB 4IIJE 3P4PA 5HAXA 1BR0A 3ETVA 3OVUA 5CA1E 5LP6E 2N1GA 1T7SA 2R6GF 2WS3A 2E8IA 3RC3A 3C64A 1HR0T 4DMVA 2VL0A 2W63A 2PJQA 3FB2A 2MTQA 2V7MA 5L3FB 2VKJA 3ONJA 5AQVB 2NW8A 4JI2T 2P9BA 2IC6A 2YN6A 4YLHA 5LMUT 1FIOA 2XQYA 2F4VT 3KV6A 2K9AA 1YW0A 4LF4T 2I6HA 2Y8DA 5FL1A 2XM2A 5AQRB 2H7OA 3EHZA 5TVCA 3C4WA 2YU1A 3T8OA 3RF1A 4H63V 4CN6A 3GUAA 4IDNA 3U8KA 1UCUA 2BBHA 4AISA 5AFMA 2E2AA 4ERRA 4A56A 2XTLA 2XPKA 2XQ3A 5DQVA 2NR4A 3FZFB 2CXFA 4TWFA 3RIAA 3LDQB 3P4SA 3C51A 3RI5A 3FXDB 3RC8A 2WNLA 2LM9A 4WYVA 5BRXA 4HFCA 1S35A 4YTNA 3ZJ2A 4TNVA 5HEHA 3VKGA 2ZM8A 3K3QC 4GK5E 2YDSA 3LFMA 2Q9QD 3KVBA 3CWZB 1YD8G 1G8XA 4JI3T 4KMCA 2BKOA 3VR9A 2VWAA 4PK4A 2DLRA 5JDNA 5IWAT 4MHCA 4G2AA 5LHIB 2VKHA 3UTKA 5HCJA 3SIOA 3WTHA 4XBFB 4U7YA 2PGZA 4ANJA 2UXNB 3HKBE 5L47A 3JADA 3O1HA 4GYRA 1KNZA 2IHR1 2LE8A 4CQIA 3LJCA 4PJLA 3ZT7A 2YU2A 5JRCB 3I0OA 4CI3B 1IJ6A 5HEGA 4DR5T 2WQYA 4IGUA 3ZYKA 1NEKA 2KSRA 4TN7B 4D01A 3SFDA 2MYSA 5HWXA 4PAGA 2Q9QC 5DQWA 3W15B 3KINB 3T1YT 3AXJA 4UM3P 2B76A 5CJ5A 3AE3A 3RGLA 3PMZA 3MZKB 2LHRA 2DCFA 1IBLT 1SUMB 4PK6A 5FP3A 3PTRB 3UFEA 3L3PA 4TUYE 4NIQA 3LK42 1HNWT 2D5UA 1T8BA 1Z0PA 1L0VA 4I55E 4DR4T 2LLYA 5M4YA 2CCQA 1VCSA 4GKJT 4JV5T 5FL0A 4DUYT 4QX8B 3Q5EA 3L39A 1E2AA 3E08A 4AKGA 5AQQB 4ZK1A 1YKEB 4ZI3D 1IZNB 2BS4A 4Z8XA 4O2AE 5J5IA 5AQMB 3PJAA 4EYUA
chains in the Genus database with same CATH topology
4TWHA 4HQPA 5L4HA 3TLSA 1UX2A 2BYNA 4QABA 2LKHA 2QC1B 2WNJA 3U8JA 3EHZA 4QH4A 5TVCA 5CO5A 5J5FA 3EAMA 5SYOA 2YKSA 3ZDHA 3WTKA 3C84A 5KZUA 2XQ8A 4HFHA 4TNWA 5LG3A 3P4WA 2XYSA 4QACA 5HEGA 2M6BA 5J5GA 3LSVA 4ZZBA 4IL4A 3UU4A 3C79A 4QAAA 4UY2A 3WIPA 2XZ6A 5AFJA 2Y57A 3U8NA 2KSRA 3GUAA 2YOEA 5LXBA 4D01A 3TLTA 2BR7A 2BYRA 3WTLA 2XQ9A 5AFNA 2YMEA 5AFLA 2M6IA 3EI0A 4FRRA 4X5TA 3U8KA 4UM1A 4ZZCA 5BP0A 3ZKRA 5AFMA 1I9BA 2XQ5A 2YMDA 3WTMA 3PEOA 2PH9A 4UM3P 2XQ3A 4UM3S 4AFGA 2BYSA 1OEDC 4HFIA 4QH5A 4TWDA 3U8MA 4TWFA 2BG9B 3RIAA 3WTOA 3UU8A 2XQ4A 3UUBA 4Z91A 2BG9C 4WV9A 3PMZA 3JAEA 4ZJSA 4F8HA 4NPPA 2BR8A 3RI5A 3P50A 3TLWA 1UW6A 5FJVA 3RIFA 4ZK4A 2ZJUA 4Z90A 2XQAA 4ILCA 5HEJA 4XHEA 2WNLA 4ZRUA 2XYTA 4ILAA 5L4EA 4HFCA 3UQ7A 5BRXA 2BG9A 5HEUA 3UU6A 5BW2A 2BG9E 2BYPA 4AFTA 2Y54A 4DBMA 5IUXA 3UQ4A 4TNVA 2XQ7A 5HEHA 3RQUA 4A97A 3T4MA 4AFHA 5AINA 5JMEA 1OEDB 3WTNA 2WN9A 2LM2A 2XQ6A 4COFA 4A98A 5AFHA 4BQTA 4EZ1A 4ALXA 2BJ0A 2LLYA 4NZBA 1UV6A 4LMJA 3ZDGA 3JAFA 3TLUA 3SQ9A 4BFQA 5HCMA 4IREA 4ILBA 3SH1A 3IGQA 4HFDA 1OEDA 4HFBA 4HFEA 2VL0A 1OEDE 4PIRA 4XK9A 2XNUA 2LKGA 2BYQA 5J5HA 2XNVA 4LMKA 4ZJTA 2MAWA 4ZK1A 2WNCA 5AFMB 4UM3A 5HCJA 2XZ5A 5J0ZA 4B5DA 4LMLA 2ZJVA 3SIOA 3WTHA 3UU5A 2Y7YA 3RHWA 3U8LA 2YN6A 2Y58A 2W8GA 3WTJA 2WZYA 2X00A 5AFKA 3RQWA 4ZR6A 2XNTA 3WTIA 2UZ6A 5KE4A 4IL9A 5CFBA 2C9TA 2PGZA 2X00D 5J5IA 5L47A 4QH1A 3SQ6A 3JADA 2W8FA 4UXUA 2Y56A 5HEOA 3UU3A 3TLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TWH A;  4HQP A;  5L4H A;  3TLS A;  1UX2 A;  2BYN A;  4QAB A;  2LKH A;  2QC1 B;  2WNJ A;  3U8J A;  3EHZ A;  4QH4 A;  5TVC A;  5CO5 A;  5J5F A;  3EAM A;  5SYO A;  2YKS A;  3ZDH A;  3WTK A;  3C84 A;  5KZU A;  2XQ8 A;  4HFH A;  4TNW A;  5LG3 A;  3P4W A;  2XYS A;  4QAC A;  5HEG A;  2M6B A;  5J5G A;  3LSV A;  4ZZB A;  4IL4 A;  3UU4 A;  3C79 A;  4QAA A;  4UY2 A;  3WIP A;  2XZ6 A;  5AFJ A;  2Y57 A;  3U8N A;  2KSR A;  3GUA A;  2YOE A;  5LXB A;  4D01 A;  3TLT A;  2BR7 A;  2BYR A;  3WTL A;  2XQ9 A;  5AFN A;  2YME A;  5AFL A;  2M6I A;  3EI0 A;  4FRR A;  4X5T A;  3U8K A;  4UM1 A;  4ZZC A;  5BP0 A;  3ZKR A;  5AFM A;  1I9B A;  2XQ5 A;  2YMD A;  3WTM A;  3PEO A;  2PH9 A;  4UM3 P;  2XQ3 A;  4UM3 S;  4AFG A;  2BYS A;  1OED C;  4HFI A;  4QH5 A;  4TWD A;  3U8M A;  4TWF A;  2BG9 B;  3RIA A;  3WTO A;  3UU8 A;  2XQ4 A;  3UUB A;  4Z91 A;  2BG9 C;  4WV9 A;  3PMZ A;  3JAE A;  4ZJS A;  4F8H A;  4NPP A;  2BR8 A;  3RI5 A;  3P50 A;  3TLW A;  1UW6 A;  5FJV A;  3RIF A;  4ZK4 A;  2ZJU A;  4Z90 A;  2XQA A;  4ILC A;  5HEJ A;  4XHE A;  2WNL A;  4ZRU A;  2XYT A;  4ILA A;  5L4E A;  4HFC A;  3UQ7 A;  5BRX A;  2BG9 A;  5HEU A;  3UU6 A;  5BW2 A;  2BG9 E;  2BYP A;  4AFT A;  2Y54 A;  4DBM A;  5IUX A;  3UQ4 A;  4TNV A;  2XQ7 A;  5HEH A;  3RQU A;  4A97 A;  3T4M A;  4AFH A;  5AIN A;  5JME A;  1OED B;  3WTN A;  2WN9 A;  2LM2 A;  2XQ6 A;  4COF A;  4A98 A;  5AFH A;  4BQT A;  4EZ1 A;  4ALX A;  2BJ0 A;  2LLY A;  4NZB A;  1UV6 A;  4LMJ A;  3ZDG A;  3JAF A;  3TLU A;  3SQ9 A;  4BFQ A;  5HCM A;  4IRE A;  4ILB A;  3SH1 A;  3IGQ A;  4HFD A;  1OED A;  4HFB A;  4HFE A;  2VL0 A;  1OED E;  4PIR A;  4XK9 A;  2XNU A;  2LKG A;  2BYQ A;  5J5H A;  2XNV A;  4LMK A;  4ZJT A;  2MAW A;  4ZK1 A;  2WNC A;  5AFM B;  4UM3 A;  5HCJ A;  2XZ5 A;  5J0Z A;  4B5D A;  4LML A;  2ZJV A;  3SIO A;  3WTH A;  3UU5 A;  2Y7Y A;  3RHW A;  3U8L A;  2YN6 A;  2Y58 A;  2W8G A;  3WTJ A;  2WZY A;  2X00 A;  5AFK A;  3RQW A;  4ZR6 A;  2XNT A;  3WTI A;  2UZ6 A;  5KE4 A;  4IL9 A;  5CFB A;  2C9T A;  2PGZ A;  2X00 D;  5J5I A;  5L47 A;  4QH1 A;  3SQ6 A;  3JAD A;  2W8F A;  4UXU A;  2Y56 A;  5HEO A;  3UU3 A;  3TLV A; 
#chains in the Genus database with same CATH topology
 5EZY E;  2UXX B;  5L4H A;  3TLS A;  1ZOY A;  5J5F A;  2ACX A;  4O2B E;  2QYW A;  3Q9D A;  2XAS B;  1YQ4 A;  2W4X A;  1MND A;  1D0Z A;  4ASK A;  3L09 A;  5EK4 A;  4PNI A;  4NXN T;  4XZC A;  2JMH A;  3I9W A;  3DP7 A;  1UX5 A;  3KV9 A;  3AAE B;  2BYS A;  1T98 A;  3N9L A;  2LSI A;  4BJM A;  5FY7 A;  3UU8 A;  2X0H A;  4I50 E;  4ZI3 C;  4X62 T;  4X1K E;  3UQ7 A;  1LVF A;  4IDO A;  2BVL A;  2BG9 E;  2JIW A;  2NTX A;  3UFG A;  3NKZ A;  5AFH A;  2ODU A;  3J9X 1;  4GYS A;  5EK2 A;  3BQL A;  3HKE E;  3KV5 A;  4B6X A;  4B3S T;  1HFA A;  4U2Z A;  3ZMV B;  3AE1 A;  3RIU C;  4DV4 T;  3E0Z A;  4L5G A;  2LSJ A;  4PJM A;  2XSB A;  4HWC A;  5J5H A;  5JR9 B;  2D9D A;  2Y7Y A;  3U8L A;  2BBJ A;  2X68 A;  2BKP A;  2WP9 A;  3HKD E;  2KZ7 B;  1QUU A;  2UZ6 A;  3F2E A;  5KE4 A;  5TAO A;  3H37 A;  2KXP B;  3QNU A;  1J5E T;  2NTY A;  5KXJ A;  3AE6 A;  3VU7 H;  3PUZ F;  4C90 A;  4LF9 T;  4DMW A;  2UUA T;  1LRZ A;  3AA1 B;  4L9I A;  3QUJ A;  2YK0 A;  1MIV A;  2XYS A;  3UT5 E;  1XDP A;  3VKH A;  4UVB B;  3IF8 B;  4DVD A;  3N9P A;  4FJO A;  4JYA T;  2W61 A;  4IE7 A;  5LGN B;  3EVY A;  4EV6 A;  3NWI A;  4CI2 B;  1I9B A;  2XQ5 A;  2V26 A;  3AEB A;  3PUA A;  5L3G B;  1KNR A;  4UM3 S;  4EOZ B;  4HFI A;  4EIW A;  3ZC0 A;  4X1I E;  1IJ5 A;  4DUZ T;  4O8S A;  5HEJ A;  4HWF A;  3PU8 A;  5BR8 T;  3DJB A;  2FBW A;  2BDE A;  4HEA A;  5LGT B;  2MOZ A;  5EK3 A;  2EHO A;  4EEB A;  2ZM6 T;  2J62 A;  3AVS A;  4OFZ A;  4BFQ A;  1W09 A;  3ZYM A;  3SH1 A;  5FVK A;  3CKD A;  3AEA A;  4AI6 A;  2XSA A;  1D1A A;  3CQC B;  4LMK A;  5LHG B;  3QB5 A;  3A8Y C;  2MAW A;  1ZV4 X;  4MAL A;  5AFM B;  3N9N A;  3ZT5 A;  2PFV A;  4OYJ A;  3C98 B;  2X00 A;  3HA4 A;  4N78 D;  2AXD S;  2WM9 A;  2VQE T;  3LBX B;  2CBI A;  5AQT B;  3CX7 B;  3ANW A;  2JJ9 A;  2H3R A;  3IHR A;  3RYF E;  4HKA A;  2HPL A;  3K3O A;  4JI1 T;  1WFD A;  1HNZ T;  4JI7 T;  2BR7 A;  3ETU A;  4DBQ A;  3FZK B;  5LHH B;  4X5T A;  3RPU A;  2X9H A;  4G63 A;  5FVL A;  3CPZ A;  2L9Q A;  4WNK A;  2AE9 A;  3U3I A;  3C4Z A;  2WAU A;  1KNP A;  1BR4 A;  4K0K T;  2X9X A;  5ABF B;  3UQ4 A;  2LSG A;  4NXM T;  3I1A A;  4ZHQ E;  1HNX T;  3EUH A;  4ALX A;  2VQF T;  3PU3 A;  1IBK T;  1UX4 A;  2LRK A;  4P1N A;  3ZST A;  4DV0 T;  5F5W A;  3MA9 A;  1OED A;  5IHY A;  5ABG A;  4UF0 A;  3ZCJ A;  2BYQ A;  2V7J A;  4O4I E;  5L3B B;  3K8P C;  2LOP A;  4TV8 E;  5LJN A;  2PBI A;  1IBM T;  4JI5 T;  3WTJ A;  1XWM A;  3NRX A;  2JQH A;  3B5M A;  2C9T A;  4YXD A;  2WDQ A;  3AEG A;  2CHO A;  1R8I A;  3N2K E;  5AQS B;  3HL6 A;  4HTE A;  2HH7 A;  5SYO A;  5JDM A;  1W0B A;  4NUV A;  3AB3 B;  4F6R C;  4TNW A;  4QXC B;  3C79 A;  1J1J A;  2Y57 A;  2MPK A;  2IIU A;  4B3R T;  3ZMT B;  3P7I A;  4P0A A;  3MKD A;  3JC6 D;  3ZLI A;  3PEO A;  4UEL A;  4QH5 A;  2LOS A;  4TWD A;  2NWB A;  1HX8 A;  5AQG B;  2XQ4 A;  4AKI A;  2X9Y A;  1XZY A;  3NZP A;  5AQL B;  1OXZ A;  1LVK A;  3K1S A;  4KUM B;  3RIF A;  3RX6 A;  4U3C A;  4GK0 E;  4ILC A;  5GON E;  4U31 A;  4TX5 A;  4U7I A;  2XYT A;  4IT4 A;  5ETW A;  2BS3 A;  4TZ4 C;  2Y54 A;  2DWG A;  2XQ7 A;  4YSZ A;  3WI3 A;  2XQ6 A;  4WBN E;  3VHL A;  4YTM A;  1N33 T;  2CWY A;  1VRB A;  4DR3 T;  4ZS3 A;  2I59 A;  1UUR A;  5C2T A;  4H9R C;  4HFD A;  2HPJ A;  4HFB A;  4MFR A;  3OYX A;  4H9S E;  4EZH A;  3FHN A;  2Y48 B;  3PUS A;  4AKH A;  4O4J E;  2IC9 A;  2V6X A;  2CM0 A;  2FJD A;  3WAJ A;  4DR1 T;  4AXP A;  2W8G A;  4IDZ A;  4CN1 A;  3B13 A;  2RPA A;  3SQ6 A;  1WR6 A;  3I9Y A;  3UU3 A;  2WN9 A;  1NEN A;  2X9W A;  2A9U A;  2XHE B;  4I4T E;  4IDP A;  2DWK A;  2N2N A;  4BA9 A;  2OA5 A;  4ILU A;  5LG3 A;  3P4W A;  5C3J A;  2CBJ A;  4QAA A;  3OBV E;  4IL4 A;  2J4G A;  5AQI B;  2YOE A;  2WDV A;  5JQG E;  4I0U A;  4AQG A;  5L3E B;  2YME A;  4FRR A;  1M62 A;  2E9X B;  3H3M A;  4Q25 A;  5AQF B;  4EED A;  2PH9 A;  3V5U A;  2UXC T;  1WRD A;  3N9Q A;  3O1J A;  3AE4 A;  3LG7 A;  4JI0 T;  2BG9 B;  1SE7 A;  1KFY A;  2X0Y A;  3JAE A;  4ZJS A;  2K5B B;  2C0S A;  2CXL A;  2XY8 B;  2A2F X;  3MJX A;  1MIW A;  4U72 A;  4O4L E;  5HEU A;  3UU6 A;  2VAS A;  2KND A;  2XAF B;  4A97 A;  2FJB A;  3N2O A;  5L2L A;  4A98 A;  4DV5 T;  5KMG P;  1KF6 A;  2W00 A;  1UV6 A;  4DR7 T;  3BK9 A;  2PG8 A;  3PJA J;  3IGQ A;  4DID B;  3KBT A;  4DV6 T;  2WWU A;  3Q2M A;  3EDU A;  3HI2 A;  5IYZ E;  1OWA A;  5AFK A;  2Y6X A;  2ZLY A;  2BZB A;  1HTJ F;  2J47 A;  3AAI A;  3TLV A;  2CXD A;  4JI8 T;  3ZMU B;  4QAB A;  3OPC A;  3OTO T;  5CO5 A;  3PUR A;  2IAK A;  4HE8 A;  2XQ8 A;  4OHF A;  1CHU A;  4QAC A;  3LSV A;  4ZZB A;  1ZEE A;  3PUY F;  3WIP A;  3AAA B;  2JQQ A;  3CQX C;  1MMA A;  4DND A;  2EHO B;  2L3L A;  5AFL A;  3EI0 A;  3UUL A;  3NBX X;  5E0O A;  1UGO A;  1N36 T;  3SFE A;  3X1D A;  2JPF A;  2XZE A;  2LHN A;  2HHH T;  4DR6 T;  1YQ3 A;  3RRW A;  2ZJU A;  4DV3 T;  1ZP0 A;  4V1A v;  4HWI B;  4YHJ A;  5BW2 A;  5JME A;  2CPT A;  4DO0 A;  3NZQ A;  3FXE B;  5H6R B;  3N5L A;  4KHZ F;  3ZSS A;  3ANW B;  1HF8 A;  5FXZ A;  3SQ9 A;  2WDR A;  2BS2 A;  2VL8 A;  3SRZ A;  2LSY A;  3ZT6 A;  3DTO A;  1QLB A;  1MIY A;  3CX6 B;  2XNU A;  4YJ2 E;  4DBR A;  2ES0 A;  2KT9 A;  2WY2 A;  3AEC A;  1XDO A;  2C5I T;  1FJG T;  5JR9 C;  1CUN A;  4B5D A;  3D0T A;  4X64 T;  3UU5 A;  3B57 A;  1WLX A;  2CWO A;  4IL9 A;  3MK7 C;  3Q5X A;  4KX6 A;  1Y64 B;  4ZI7 E;  1U4Q A;  2JRK A;  3ZYL A;  4UIG A;  3FZL B;  5CA0 E;  2NOX A;  1M7K A;  5FKY A;  3SS1 A;  3U8J A;  4AQF C;  4AIU A;  1KK7 A;  4UVA B;  4EXT A;  2W62 A;  3MAC A;  5J5G A;  3UU4 A;  3T1H T;  5FXV A;  2XZ6 A;  5AFJ A;  4YSY A;  2V6Y A;  1FMW A;  3UUM A;  5LXB A;  4BJN A;  2RA1 A;  2CRB A;  4YY3 T;  4E7Z A;  2ODV A;  1B7T A;  3WTM A;  1W9R A;  5HXS A;  4UF0 B;  4CN4 A;  2WWV A;  2OV9 A;  5J2U E;  1MMG A;  2H89 A;  4OYK A;  3N2G E;  3OKQ A;  5AQK B;  2KIN B;  1HG5 A;  5LYJ E;  2NP9 A;  5JRE A;  2XM1 A;  4YFS A;  2A72 A;  2IDO B;  4CXY A;  2X0L B;  4LFC T;  2LEH A;  2OLT A;  2Q9Q A;  4LF5 T;  3JAF A;  2QA7 A;  5HCM A;  4IRE A;  3O9X A;  1VCT A;  4HN9 A;  4IHJ E;  4XK9 A;  3JCF A;  4YJ3 E;  2VUR A;  2J1D G;  2WNC A;  4UM3 A;  2UUC T;  3AEF A;  3HKC E;  3M65 A;  4KP3 C;  2Z6E A;  3R6N A;  5HXE A;  2YDR A;  4IE4 A;  3AVR A;  3AEE A;  4EZ1 A;  5HEO A;  2WCA A;  3VRB A;  4CXX A;  2V7L A;  1YXR A;  4J2C A;  2H7V C;  2W66 A;  4ZI2 D;  3ZDH A;  4PK5 A;  3WTK A;  2JMK A;  4ISS A;  4JLE A;  3C84 A;  3SOL A;  4IE0 A;  3CML A;  4ADZ A;  2K24 A;  4CI1 B;  1HS7 A;  3CK6 A;  1G73 A;  4ZZC A;  5BP0 A;  3Q5W A;  4UR9 A;  3FZM B;  2YMD A;  3ZN0 B;  3S4U A;  3A5X A;  1DU2 A;  3ZMS B;  4KI0 F;  1J5W A;  2XAH B;  5AQP B;  1SA0 E;  2V1D B;  4AKR B;  4JI4 T;  1JNR A;  4Z90 A;  2XQA A;  5DJQ C;  4ILA A;  1IAP A;  2VKD A;  4LF8 T;  1D1B A;  3CIR A;  4AKL A;  2XAJ B;  3LK3 B;  1NAF A;  4MLK A;  4LF7 T;  4ILB A;  1HX1 B;  3R84 B;  1OED E;  4PFP A;  5FNV E;  3UUN A;  4ZJT A;  3KBU A;  3RHW A;  1N32 T;  2VK9 A;  3GN5 A;  4QWN B;  5FXX A;  3AE7 A;  2KWH A;  4LF6 T;  3N9O A;  5LMN T;  5JDQ A;  1S94 A;  2FJE A;  4HFH A;  3RIU A;  5CGM A;  5HXR A;  4UEM A;  4IE6 A;  3NVO A;  4UY2 A;  3AXJ B;  2RP4 A;  2X67 A;  5JDF A;  4AQF A;  4FI5 A;  2BYR A;  3A7M A;  4H9P C;  4CXW A;  4UM1 A;  1BR1 A;  1O3X A;  3QOF A;  4ZEY A;  1SHZ C;  3MXZ A;  2V7K A;  1ZKE A;  4U33 A;  5KX5 E;  2X51 A;  3FBZ A;  4LFA T;  4HFV A;  3RKG A;  3C50 A;  4F8H A;  2C5K T;  4ZOL E;  3VRA A;  3RRC A;  2XJ7 A;  1WYB A;  3TLW A;  3U78 A;  2XAQ B;  2WB5 A;  2G0U A;  4CZZ B;  1XNR T;  2WMO A;  3PDY A;  3RQU A;  5C8Y E;  3O1I A;  3C4X A;  2CLY B;  4YT0 A;  5FY0 A;  4COF A;  2ACZ A;  1XMO T;  2V5C A;  3PUQ A;  3OYZ A;  4QXH B;  2E9X D;  5ADX L;  2K3W A;  5FXW A;  3ZEF B;  5LCY A;  4PIR A;  2E5V A;  1WCR A;  3RLF F;  2ZMA A;  1QSD A;  3ESL A;  2FJA A;  3P4R A;  3PV0 F;  3RQW A;  4YSX A;  2XNT A;  2LJL A;  5AFU L;  5JDL A;  4HQP A;  3LK2 B;  5JH7 E;  3EAM A;  4QKN A;  2YKS A;  3CVR A;  4PW8 A;  3JC6 C;  5KZU A;  2VKO A;  2IML A;  3QK6 A;  2M6B A;  2K48 A;  4MBQ A;  2KMF A;  3LBX A;  4X66 T;  1VOM A;  4XAX B;  4X65 T;  2M6I A;  2V7I A;  4KHP T;  2E9X C;  2UXD T;  4U74 A;  1MMN A;  1ZHC A;  3U8M A;  2BG9 C;  4UXN B;  4B3T T;  3FZH B;  4YHH T;  4X20 E;  2B1E A;  1UW6 A;  2BVM A;  5LG4 A;  4BAY B;  2E5L T;  4XHE A;  5JDG A;  2LRL A;  5L4E A;  1N34 T;  3P8C D;  2I0M A;  4EGW A;  1I94 T;  5IUX A;  1D0Y A;  5LGU B;  4WW0 A;  3H3A A;  4HWH A;  4H9Q C;  2X66 A;  2H88 A;  3AE5 A;  3ABV A;  2W0G A;  5AQO B;  5ABH A;  2EHO D;  2GK9 A;  3TLU A;  2A3D A;  5ABF A;  2V8S V;  3I0Q A;  4UV9 B;  2V6Y B;  4GIW A;  3ONL C;  2QGS A;  2XNV A;  2L8K A;  4HGA A;  5HYA A;  2N9D A;  5J0Z A;  4LML A;  5HWY A;  3ONX A;  1U5P A;  4A5X A;  3ZPO A;  5CFB A;  2VB6 A;  1D0X A;  5JDH A;  2X00 D;  5L3D B;  5AQH B;  3AE2 A;  3P4Q A;  3SWH A;  2WMN A;  4HWD A;  2VVS A;  1UX2 A;  2D0T A;  5FMN A;  2LKH A;  2WNJ A;  2KLQ A;  5F8P A;  3J7Y q;  4GOU A;  3AA6 B;  4EB6 E;  3PUG A;  2WZH A;  4ZXL A;  2YIN A;  1FEW A;  4WBO A;  3F57 A;  4QHO A;  5AQN B;  3GA8 A;  4H9N C;  4PFO A;  2LT3 A;  4X1Y E;  3WTL A;  5JTG A;  5AFN A;  2EHO C;  2Q9Q B;  3ZKR A;  2DL1 A;  3GMI A;  2IUB A;  3IA3 A;  5KDM C;  4AFG A;  4ZS2 A;  4L0R A;  4EZ4 A;  3WTO A;  3ZN1 B;  1HG2 A;  2YEV C;  4KBM B;  5J1G A;  4TV9 E;  4IST A;  3QC9 A;  5LBM A;  3K3N A;  4K0U A;  3EAB A;  4GKK T;  5JVD E;  4AFH A;  3TKL B;  3QB5 K;  2WSS V;  3AE9 A;  1W0A A;  3ZDG A;  5A1L A;  3E22 E;  3KDS E;  3ZC1 A;  1I6Z A;  2LKG A;  1XNQ T;  3OJA A;  4JBW F;  1X79 A;  3N9M A;  2SPC A;  2Y58 A;  1EZ3 A;  3WAK A;  3O4X E;  2BKN A;  4O4H E;  2BYN A;  3RYI E;  2QRX A;  2C5J A;  3PUX F;  4UV8 B;  5AQJ B;  4EAH A;  1UK5 A;  3F31 A;  1MNE A;  4DV7 T;  3AE8 A;  4PJN A;  1XMQ T;  3L8R A;  2WZI A;  4JEH B;  1OED C;  4PJJ A;  4Z91 A;  5DAB A;  2UXB T;  4WV9 A;  2W67 A;  4OK0 A;  2WU2 A;  3KV4 A;  5LB7 B;  4OX9 T;  4B3M T;  2E9X A;  2CA5 A;  3ZCI A;  5HXC A;  3Q5D A;  1E1H B;  4ZRU A;  3GN5 B;  5JRC A;  2UUB T;  2BG9 A;  2JQK A;  2XUE A;  2CE7 A;  4DBM A;  4AFT A;  5BMV E;  1OED B;  3ZJ1 A;  4EYY R;  2JQ9 A;  4H9O C;  4NZB A;  4JUY A;  5FYM A;  1E7P A;  4LMJ A;  1MMD A;  4E7S A;  3UUX B;  1BR2 A;  4M1P A;  1WR0 A;  4HFE A;  4YTP A;  4UVC B;  1LKX A;  3AA0 B;  1V9D A;  5FY1 A;  4I43 B;  2XZ5 A;  2WZY A;  1Z8U A;  4U2Y A;  2MBG A;  3GWH A;  1FMV A;  3RYH E;  4TWH A;  4DR2 T;  3FBL A;  3ZMZ B;  4JI6 T;  2LSK A;  4LFB T;  2HN1 A;  1T72 A;  2W2U A;  2DNX A;  1HCI A;  2ZM2 A;  1JNZ A;  2XQ9 A;  3RH3 A;  1AJ3 A;  3PE0 A;  2KWI B;  2UU9 T;  2QVA A;  1GQE A;  3PUW F;  2CHN A;  4NPP A;  2IW5 B;  4AQY T;  5FJV A;  3M3Z B;  4P0B A;  4ZK4 A;  1H7C A;  1KEY A;  3BQK A;  2WU5 A;  4P09 A;  4JEU B;  4C91 A;  3IEE A;  2PTF A;  3WTN A;  4IE5 A;  4BQT A;  2V5D A;  4IDQ A;  2BJ0 A;  2NW7 A;  2CMR A;  3V5S A;  5AQU B;  2VVN A;  1Y01 A;  3PUV F;  5CB4 E;  5LXT E;  3BQI A;  2D0U A;  2HN2 A;  4QX7 B;  3KVA A;  2DI4 A;  5ABE A;  2ZJV A;  3VR8 A;  2M67 A;  1X9B A;  4ZI2 C;  4WZX A;  3AED A;  1WYC A;  4ZR6 A;  3WTI A;  4QH1 A;  2W8F A;  4UXU A;  3G06 A;  2Y56 A;  2QC1 B;  3CX8 B;  5H6Q B;  4QH4 A;  3RYC E;  5LA6 E;  4DV1 T;  2D2S A;  2CEA A;  5L3C B;  2ZM0 A;  4NUU A;  2NW9 A;  3U8N A;  2DHR A;  3TLT A;  5JR9 A;  3AA7 B;  3CQG B;  5LJM A;  3NRY A;  3HR0 A;  1UUS A;  5J2T E;  2WBL A;  3UUB A;  1NWM X;  4QXB B;  5HXH A;  1D1C A;  2BR8 A;  3P50 A;  2FUP A;  5LNK A;  5LOV E;  1YKH B;  4H63 H;  2YDQ A;  3IBP A;  2XAG B;  4DV2 T;  2BYP A;  1US7 B;  3EDV A;  3T4M A;  5AIN A;  5F3J A;  2LM2 A;  3KFW X;  2CLY C;  3RKO A;  5LBQ B;  4IIJ E;  3P4P A;  5HAX A;  1BR0 A;  3ETV A;  3OVU A;  5CA1 E;  5LP6 E;  2N1G A;  1T7S A;  2R6G F;  2WS3 A;  2E8I A;  3RC3 A;  3C64 A;  1HR0 T;  4DMV A;  2VL0 A;  2W63 A;  2PJQ A;  3FB2 A;  2MTQ A;  2V7M A;  5L3F B;  2VKJ A;  3ONJ A;  5AQV B;  2NW8 A;  4JI2 T;  2P9B A;  2IC6 A;  2YN6 A;  4YLH A;  5LMU T;  1FIO A;  2XQY A;  2F4V T;  3KV6 A;  2K9A A;  1YW0 A;  4LF4 T;  2I6H A;  2Y8D A;  5FL1 A;  2XM2 A;  5AQR B;  2H7O A;  3EHZ A;  5TVC A;  3C4W A;  2YU1 A;  3T8O A;  3RF1 A;  4H63 V;  4CN6 A;  3GUA A;  4IDN A;  3U8K A;  1UCU A;  2BBH A;  4AIS A;  5AFM A;  2E2A A;  4ERR A;  4A56 A;  2XTL A;  2XPK A;  2XQ3 A;  5DQV A;  2NR4 A;  3FZF B;  2CXF A;  4TWF A;  3RIA A;  3LDQ B;  3P4S A;  3C51 A;  3RI5 A;  3FXD B;  3RC8 A;  2WNL A;  2LM9 A;  4WYV A;  5BRX A;  4HFC A;  1S35 A;  4YTN A;  3ZJ2 A;  4TNV A;  5HEH A;  3VKG A;  2ZM8 A;  3K3Q C;  4GK5 E;  2YDS A;  3LFM A;  2Q9Q D;  3KVB A;  3CWZ B;  1YD8 G;  1G8X A;  4JI3 T;  4KMC A;  2BKO A;  3VR9 A;  2VWA A;  4PK4 A;  2DLR A;  5JDN A;  5IWA T;  4MHC A;  4G2A A;  5LHI B;  2VKH A;  3UTK A;  5HCJ A;  3SIO A;  3WTH A;  4XBF B;  4U7Y A;  2PGZ A;  4ANJ A;  2UXN B;  3HKB E;  5L47 A;  3JAD A;  3O1H A;  4GYR A;  1KNZ A;  2IHR 1;  2LE8 A;  4CQI A;  3LJC A;  4PJL A;  3ZT7 A;  2YU2 A;  5JRC B;  3I0O A;  4CI3 B;  1IJ6 A;  5HEG A;  4DR5 T;  2WQY A;  4IGU A;  3ZYK A;  1NEK A;  2KSR A;  4TN7 B;  4D01 A;  3SFD A;  2MYS A;  5HWX A;  4PAG A;  2Q9Q C;  5DQW A;  3W15 B;  3KIN B;  3T1Y T;  3AXJ A;  4UM3 P;  2B76 A;  5CJ5 A;  3AE3 A;  3RGL A;  3PMZ A;  3MZK B;  2LHR A;  2DCF A;  1IBL T;  1SUM B;  4PK6 A;  5FP3 A;  3PTR B;  3UFE A;  3L3P A;  4TUY E;  4NIQ A;  3LK4 2;  1HNW T;  2D5U A;  1T8B A;  1Z0P A;  1L0V A;  4I55 E;  4DR4 T;  2LLY A;  5M4Y A;  2CCQ A;  1VCS A;  4GKJ T;  4JV5 T;  5FL0 A;  4DUY T;  4QX8 B;  3Q5E A;  3L39 A;  1E2A A;  3E08 A;  4AKG A;  5AQQ B;  4ZK1 A;  1YKE B;  4ZI3 D;  1IZN B;  2BS4 A;  4Z8X A;  4O2A E;  5J5I A;  5AQM B;  3PJA A;  4EYU A; 
#chains in the Genus database with same CATH homology
 4TWH A;  4HQP A;  5L4H A;  3TLS A;  1UX2 A;  2BYN A;  4QAB A;  2LKH A;  2QC1 B;  2WNJ A;  3U8J A;  3EHZ A;  4QH4 A;  5TVC A;  5CO5 A;  5J5F A;  3EAM A;  5SYO A;  2YKS A;  3ZDH A;  3WTK A;  3C84 A;  5KZU A;  2XQ8 A;  4HFH A;  4TNW A;  5LG3 A;  3P4W A;  2XYS A;  4QAC A;  5HEG A;  2M6B A;  5J5G A;  3LSV A;  4ZZB A;  4IL4 A;  3UU4 A;  3C79 A;  4QAA A;  4UY2 A;  3WIP A;  2XZ6 A;  5AFJ A;  2Y57 A;  3U8N A;  2KSR A;  3GUA A;  2YOE A;  5LXB A;  4D01 A;  3TLT A;  2BR7 A;  2BYR A;  3WTL A;  2XQ9 A;  5AFN A;  2YME A;  5AFL A;  2M6I A;  3EI0 A;  4FRR A;  4X5T A;  3U8K A;  4UM1 A;  4ZZC A;  5BP0 A;  3ZKR A;  5AFM A;  1I9B A;  2XQ5 A;  2YMD A;  3WTM A;  3PEO A;  2PH9 A;  4UM3 P;  2XQ3 A;  4UM3 S;  4AFG A;  2BYS A;  1OED C;  4HFI A;  4QH5 A;  4TWD A;  3U8M A;  4TWF A;  2BG9 B;  3RIA A;  3WTO A;  3UU8 A;  2XQ4 A;  3UUB A;  4Z91 A;  2BG9 C;  4WV9 A;  3PMZ A;  3JAE A;  4ZJS A;  4F8H A;  4NPP A;  2BR8 A;  3RI5 A;  3P50 A;  3TLW A;  1UW6 A;  5FJV A;  3RIF A;  4ZK4 A;  2ZJU A;  4Z90 A;  2XQA A;  4ILC A;  5HEJ A;  4XHE A;  2WNL A;  4ZRU A;  2XYT A;  4ILA A;  5L4E A;  4HFC A;  3UQ7 A;  5BRX A;  2BG9 A;  5HEU A;  3UU6 A;  5BW2 A;  2BG9 E;  2BYP A;  4AFT A;  2Y54 A;  4DBM A;  5IUX A;  3UQ4 A;  4TNV A;  2XQ7 A;  5HEH A;  3RQU A;  4A97 A;  3T4M A;  4AFH A;  5AIN A;  5JME A;  1OED B;  3WTN A;  2WN9 A;  2LM2 A;  2XQ6 A;  4COF A;  4A98 A;  5AFH A;  4BQT A;  4EZ1 A;  4ALX A;  2BJ0 A;  2LLY A;  4NZB A;  1UV6 A;  4LMJ A;  3ZDG A;  3JAF A;  3TLU A;  3SQ9 A;  4BFQ A;  5HCM A;  4IRE A;  4ILB A;  3SH1 A;  3IGQ A;  4HFD A;  1OED A;  4HFB A;  4HFE A;  2VL0 A;  1OED E;  4PIR A;  4XK9 A;  2XNU A;  2LKG A;  2BYQ A;  5J5H A;  2XNV A;  4LMK A;  4ZJT A;  2MAW A;  4ZK1 A;  2WNC A;  5AFM B;  4UM3 A;  5HCJ A;  2XZ5 A;  5J0Z A;  4B5D A;  4LML A;  2ZJV A;  3SIO A;  3WTH A;  3UU5 A;  2Y7Y A;  3RHW A;  3U8L A;  2YN6 A;  2Y58 A;  2W8G A;  3WTJ A;  2WZY A;  2X00 A;  5AFK A;  3RQW A;  4ZR6 A;  2XNT A;  3WTI A;  2UZ6 A;  5KE4 A;  4IL9 A;  5CFB A;  2C9T A;  2PGZ A;  2X00 D;  5J5I A;  5L47 A;  4QH1 A;  3SQ6 A;  3JAD A;  2W8F A;  4UXU A;  2Y56 A;  5HEO A;  3UU3 A;  3TLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...