2BJ0A

Crystal structure of achbp from bulinus truncatus revals the conserved structural scaffold and sites of variation in nicotinic acetylcholine receptors
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
203
structure length
203
Chain Sequence
QIRWTLLNQITGESDVIPLSNNTPLNVSLNFKLMNIVEADTEKDQVEVVLWTQASWKVPYYSSLLSSSSLDQVSLPVSKMWTPDLSFYNAIAAPELLSADRVVVSKDGSVIYVPSQRVRFTCDLINVDTEPGATCRIKVGSWTHDNKQFALITGEEGVVNIAEYFDSPKFDLLSATQSLNRKKYSCCENMYDDIEITFAFRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN
publication title Crystal Structure of Acetylcholine-Binding Protein from Bulinus Truncatus Reveals the Conserved Structural Scaffold and Sites of Variation in Nicotinic Acetylcholine Receptors.
pubmed doi rcsb
source organism Bulinus truncatus
molecule tags Glycoprotein
total genus 50
structure length 203
sequence length 203
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bj0A00
3TLTA 2BR8A 2UZ6A 2Y57A 4TWDA 3SQ9A 3RIFA 5J5HA 3WTMA 4QACA 5CFBA 3WTKA 4UXUA 4QH4A 5AFNA 3U8NA 3JAEA 4LMJA 1I9BA 2XQ5A 5BW2A 2PH9A 3TLWA 3WTIA 2Y54A 3UU3A 2XQ6A 2XQ7A 4A97A 3JADA 3ZDHA 4ZZBA 3EI0A 5AFLA 4IL4A 2XQ4A 4ILAA 4COFA 2BG9C 3RQUA 4ZK1A 4UM3A 2Y56A 5BP0A 2XYTA 4NZBA 2XNVA 3RIAA 2XYSA 3TLVA 2PGZA 2WN9A 2BYSA 5J5IA 2BYRA 4LMLA 5LG3A 2QC1B 2Y58A 2BYQA 5HEOA 2BR7A 2XQ9A 3U8KA 1UX2A 2XNTA 4Z91A 3WIPA 5LXBA 4UM3S 4F8HA 5KZUA 2WNCA 3C79A 3WTHA 4B5DA 3PMZA 4ZJTA 2W8FA 3P50A 4HFDA 4HQPA 2BJ0A 5IUXA 3ZKRA 2BG9A 3SH1A 5AFMA 5AFMB 2X00A 2WNLA 3WTLA 5BRXA 5L4EA 4HFCA 4ZJSA 4UY2A 2X00D 4TNWA 2YMDA 4Z90A 4AFTA 4FRRA 4UM3P 5J5FA 5HCJA 3T4MA 3RI5A 5FJVA 3WTOA 5CO5A 2YMEA 2XZ5A 2YN6A 2BYNA 4ZK4A 4ZRUA 4HFEA 3UQ4A 3LSVA 2BYPA 2XQ3A 4NPPA 4XHEA 4ZZCA 4ILBA 4HFIA 4AFGA 2WNJA 4PIRA 3TLUA 2BG9B 2XQ8A 3C84A 2WZYA 3IGQA 5HEHA 3UU4A 4IL9A 3GUAA 4HFBA 5JMEA 2BG9E 5AFJA 4QH5A 5AFHA 4BFQA 3RHWA 1UV6A 3UUBA 2Y7YA 4X5TA 4QABA 2YOEA 3PEOA 4IREA 3U8LA 4D01A 3P4WA 5L4HA 4LMKA 2C9TA 3UU6A 4DBMA 5L47A 3EHZA 2VL0A 2W8GA 3WTNA 4A98A 5KE4A 3UU5A 4XK9A 5HEGA 2XQAA 5AINA 5J0ZA 3SIOA 4TWHA 4ILCA 2XNUA 4QAAA 3WTJA 5HCMA 5HEJA 5J5GA 4EZ1A 3UU8A 4UM1A 4ALXA 1UW6A 5HEUA 2ZJVA 3U8MA 3SQ6A 3UQ7A 2ZJUA 5AFKA 4TNVA 4WV9A 3RQWA 3TLSA 2YKSA 4BQTA 4ZR6A 4HFHA 4AFHA 5SYOA 3ZDGA 3EAMA 3JAFA 2XZ6A 4QH1A 5TVCA 4TWFA 3U8JA
chains in the Genus database with same CATH superfamily
3TLTA 2BR8A 2UZ6A 2Y57A 4TWDA 3SQ9A 3RIFA 5J5HA 3WTMA 4QACA 5CFBA 3WTKA 4UXUA 4QH4A 5AFNA 3U8NA 3JAEA 4LMJA 1I9BA 2XQ5A 5BW2A 2PH9A 3TLWA 3WTIA 2Y54A 3UU3A 2XQ6A 2XQ7A 4A97A 3JADA 3ZDHA 4ZZBA 3EI0A 5AFLA 4IL4A 2XQ4A 4ILAA 4COFA 2BG9C 3RQUA 4ZK1A 4UM3A 2Y56A 5BP0A 2XYTA 4NZBA 2XNVA 3RIAA 2XYSA 3TLVA 2PGZA 2WN9A 2BYSA 5J5IA 2BYRA 4LMLA 5LG3A 2QC1B 2Y58A 2BYQA 5HEOA 2BR7A 2XQ9A 3U8KA 1UX2A 2XNTA 4Z91A 3WIPA 5LXBA 4UM3S 4F8HA 5KZUA 2WNCA 3C79A 3WTHA 4B5DA 3PMZA 4ZJTA 2W8FA 3P50A 4HFDA 4HQPA 2BJ0A 5IUXA 3ZKRA 2BG9A 3SH1A 5AFMA 5AFMB 2X00A 2WNLA 3WTLA 5BRXA 5L4EA 4HFCA 4ZJSA 4UY2A 2X00D 4TNWA 2YMDA 4Z90A 4AFTA 4FRRA 4UM3P 5J5FA 5HCJA 3T4MA 3RI5A 5FJVA 3WTOA 5CO5A 2YMEA 2XZ5A 2YN6A 2BYNA 4ZK4A 4ZRUA 4HFEA 3UQ4A 3LSVA 2BYPA 2XQ3A 4NPPA 4XHEA 4ZZCA 4ILBA 4HFIA 4AFGA 2WNJA 4PIRA 3TLUA 2BG9B 2XQ8A 3C84A 2WZYA 3IGQA 5HEHA 3UU4A 4IL9A 3GUAA 4HFBA 5JMEA 2BG9E 5AFJA 4QH5A 5AFHA 4BFQA 3RHWA 1UV6A 3UUBA 2Y7YA 4X5TA 4QABA 2YOEA 3PEOA 4IREA 3U8LA 4D01A 3P4WA 5L4HA 4LMKA 2C9TA 3UU6A 4DBMA 5L47A 3EHZA 2VL0A 2W8GA 3WTNA 4A98A 5KE4A 3UU5A 4XK9A 5HEGA 2XQAA 5AINA 5J0ZA 3SIOA 4TWHA 4ILCA 2XNUA 4QAAA 3WTJA 5HCMA 5HEJA 5J5GA 4EZ1A 3UU8A 4UM1A 4ALXA 1UW6A 5HEUA 2ZJVA 3U8MA 3SQ6A 3UQ7A 2ZJUA 5AFKA 4TNVA 4WV9A 3RQWA 3TLSA 2YKSA 4BQTA 4ZR6A 4HFHA 4AFHA 5SYOA 3ZDGA 3EAMA 3JAFA 2XZ6A 4QH1A 5TVCA 4TWFA 3U8JA
chains in the Genus database with same CATH topology
3TLTA 2BR8A 2UZ6A 2Y57A 4TWDA 3SQ9A 3RIFA 5J5HA 3WTMA 4QACA 5CFBA 3WTKA 4UXUA 4QH4A 5AFNA 3U8NA 3JAEA 4LMJA 1I9BA 2XQ5A 5BW2A 2PH9A 3TLWA 3WTIA 2Y54A 3UU3A 2XQ6A 2XQ7A 4A97A 3JADA 3ZDHA 4ZZBA 3EI0A 5AFLA 4IL4A 2XQ4A 4ILAA 4COFA 2BG9C 3RQUA 4ZK1A 4UM3A 2Y56A 5BP0A 2XYTA 4NZBA 2XNVA 3RIAA 2XYSA 3TLVA 2PGZA 2WN9A 2BYSA 5J5IA 2BYRA 4LMLA 5LG3A 2QC1B 2Y58A 2BYQA 5HEOA 2BR7A 2XQ9A 3U8KA 1UX2A 2XNTA 4Z91A 3WIPA 5LXBA 4UM3S 4F8HA 5KZUA 2WNCA 3C79A 3WTHA 4B5DA 3PMZA 4ZJTA 2W8FA 3P50A 4HFDA 4HQPA 2BJ0A 5IUXA 3ZKRA 2BG9A 3SH1A 5AFMA 5AFMB 2X00A 2WNLA 3WTLA 5BRXA 5L4EA 4HFCA 4ZJSA 4UY2A 2X00D 4TNWA 2YMDA 4Z90A 4AFTA 4FRRA 4UM3P 5J5FA 5HCJA 3T4MA 3RI5A 5FJVA 3WTOA 5CO5A 2YMEA 2XZ5A 2YN6A 2BYNA 4ZK4A 4ZRUA 4HFEA 3UQ4A 3LSVA 2BYPA 2XQ3A 4NPPA 4XHEA 4ZZCA 4ILBA 4HFIA 4AFGA 2WNJA 4PIRA 3TLUA 2BG9B 2XQ8A 3C84A 2WZYA 3IGQA 5HEHA 3UU4A 4IL9A 3GUAA 4HFBA 5JMEA 2BG9E 5AFJA 4QH5A 5AFHA 4BFQA 3RHWA 1UV6A 3UUBA 2Y7YA 4X5TA 4QABA 2YOEA 3PEOA 4IREA 3U8LA 4D01A 3P4WA 5L4HA 4LMKA 2C9TA 3UU6A 4DBMA 5L47A 3EHZA 2VL0A 2W8GA 3WTNA 4A98A 5KE4A 3UU5A 4XK9A 5HEGA 2XQAA 5AINA 5J0ZA 3SIOA 4TWHA 4ILCA 2XNUA 4QAAA 3WTJA 5HCMA 5HEJA 5J5GA 4EZ1A 3UU8A 4UM1A 4ALXA 1UW6A 5HEUA 2ZJVA 3U8MA 3SQ6A 3UQ7A 2ZJUA 5AFKA 4TNVA 4WV9A 3RQWA 3TLSA 2YKSA 4BQTA 4ZR6A 4HFHA 4AFHA 5SYOA 3ZDGA 3EAMA 3JAFA 2XZ6A 4QH1A 5TVCA 4TWFA 3U8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLT A;  2BR8 A;  2UZ6 A;  2Y57 A;  4TWD A;  3SQ9 A;  3RIF A;  5J5H A;  3WTM A;  4QAC A;  5CFB A;  3WTK A;  4UXU A;  4QH4 A;  5AFN A;  3U8N A;  3JAE A;  4LMJ A;  1I9B A;  2XQ5 A;  5BW2 A;  2PH9 A;  3TLW A;  3WTI A;  2Y54 A;  3UU3 A;  2XQ6 A;  2XQ7 A;  4A97 A;  3JAD A;  3ZDH A;  4ZZB A;  3EI0 A;  5AFL A;  4IL4 A;  2XQ4 A;  4ILA A;  4COF A;  2BG9 C;  3RQU A;  4ZK1 A;  4UM3 A;  2Y56 A;  5BP0 A;  2XYT A;  4NZB A;  2XNV A;  3RIA A;  2XYS A;  3TLV A;  2PGZ A;  2WN9 A;  2BYS A;  5J5I A;  2BYR A;  4LML A;  5LG3 A;  2QC1 B;  2Y58 A;  2BYQ A;  5HEO A;  2BR7 A;  2XQ9 A;  3U8K A;  1UX2 A;  2XNT A;  4Z91 A;  3WIP A;  5LXB A;  4UM3 S;  4F8H A;  5KZU A;  2WNC A;  3C79 A;  3WTH A;  4B5D A;  3PMZ A;  4ZJT A;  2W8F A;  3P50 A;  4HFD A;  4HQP A;  2BJ0 A;  5IUX A;  3ZKR A;  2BG9 A;  3SH1 A;  5AFM A;  5AFM B;  2X00 A;  2WNL A;  3WTL A;  5BRX A;  5L4E A;  4HFC A;  4ZJS A;  4UY2 A;  2X00 D;  4TNW A;  2YMD A;  4Z90 A;  4AFT A;  4FRR A;  4UM3 P;  5J5F A;  5HCJ A;  3T4M A;  3RI5 A;  5FJV A;  3WTO A;  5CO5 A;  2YME A;  2XZ5 A;  2YN6 A;  2BYN A;  4ZK4 A;  4ZRU A;  4HFE A;  3UQ4 A;  3LSV A;  2BYP A;  2XQ3 A;  4NPP A;  4XHE A;  4ZZC A;  4ILB A;  4HFI A;  4AFG A;  2WNJ A;  4PIR A;  3TLU A;  2BG9 B;  2XQ8 A;  3C84 A;  2WZY A;  3IGQ A;  5HEH A;  3UU4 A;  4IL9 A;  3GUA A;  4HFB A;  5JME A;  2BG9 E;  5AFJ A;  4QH5 A;  5AFH A;  4BFQ A;  3RHW A;  1UV6 A;  3UUB A;  2Y7Y A;  4X5T A;  4QAB A;  2YOE A;  3PEO A;  4IRE A;  3U8L A;  4D01 A;  3P4W A;  5L4H A;  4LMK A;  2C9T A;  3UU6 A;  4DBM A;  5L47 A;  3EHZ A;  2VL0 A;  2W8G A;  3WTN A;  4A98 A;  5KE4 A;  3UU5 A;  4XK9 A;  5HEG A;  2XQA A;  5AIN A;  5J0Z A;  3SIO A;  4TWH A;  4ILC A;  2XNU A;  4QAA A;  3WTJ A;  5HCM A;  5HEJ A;  5J5G A;  4EZ1 A;  3UU8 A;  4UM1 A;  4ALX A;  1UW6 A;  5HEU A;  2ZJV A;  3U8M A;  3SQ6 A;  3UQ7 A;  2ZJU A;  5AFK A;  4TNV A;  4WV9 A;  3RQW A;  3TLS A;  2YKS A;  4BQT A;  4ZR6 A;  4HFH A;  4AFH A;  5SYO A;  3ZDG A;  3EAM A;  3JAF A;  2XZ6 A;  4QH1 A;  5TVC A;  4TWF A;  3U8J A; 
#chains in the Genus database with same CATH topology
 3TLT A;  2BR8 A;  2UZ6 A;  2Y57 A;  4TWD A;  3SQ9 A;  3RIF A;  5J5H A;  3WTM A;  4QAC A;  5CFB A;  3WTK A;  4UXU A;  4QH4 A;  5AFN A;  3U8N A;  3JAE A;  4LMJ A;  1I9B A;  2XQ5 A;  5BW2 A;  2PH9 A;  3TLW A;  3WTI A;  2Y54 A;  3UU3 A;  2XQ6 A;  2XQ7 A;  4A97 A;  3JAD A;  3ZDH A;  4ZZB A;  3EI0 A;  5AFL A;  4IL4 A;  2XQ4 A;  4ILA A;  4COF A;  2BG9 C;  3RQU A;  4ZK1 A;  4UM3 A;  2Y56 A;  5BP0 A;  2XYT A;  4NZB A;  2XNV A;  3RIA A;  2XYS A;  3TLV A;  2PGZ A;  2WN9 A;  2BYS A;  5J5I A;  2BYR A;  4LML A;  5LG3 A;  2QC1 B;  2Y58 A;  2BYQ A;  5HEO A;  2BR7 A;  2XQ9 A;  3U8K A;  1UX2 A;  2XNT A;  4Z91 A;  3WIP A;  5LXB A;  4UM3 S;  4F8H A;  5KZU A;  2WNC A;  3C79 A;  3WTH A;  4B5D A;  3PMZ A;  4ZJT A;  2W8F A;  3P50 A;  4HFD A;  4HQP A;  2BJ0 A;  5IUX A;  3ZKR A;  2BG9 A;  3SH1 A;  5AFM A;  5AFM B;  2X00 A;  2WNL A;  3WTL A;  5BRX A;  5L4E A;  4HFC A;  4ZJS A;  4UY2 A;  2X00 D;  4TNW A;  2YMD A;  4Z90 A;  4AFT A;  4FRR A;  4UM3 P;  5J5F A;  5HCJ A;  3T4M A;  3RI5 A;  5FJV A;  3WTO A;  5CO5 A;  2YME A;  2XZ5 A;  2YN6 A;  2BYN A;  4ZK4 A;  4ZRU A;  4HFE A;  3UQ4 A;  3LSV A;  2BYP A;  2XQ3 A;  4NPP A;  4XHE A;  4ZZC A;  4ILB A;  4HFI A;  4AFG A;  2WNJ A;  4PIR A;  3TLU A;  2BG9 B;  2XQ8 A;  3C84 A;  2WZY A;  3IGQ A;  5HEH A;  3UU4 A;  4IL9 A;  3GUA A;  4HFB A;  5JME A;  2BG9 E;  5AFJ A;  4QH5 A;  5AFH A;  4BFQ A;  3RHW A;  1UV6 A;  3UUB A;  2Y7Y A;  4X5T A;  4QAB A;  2YOE A;  3PEO A;  4IRE A;  3U8L A;  4D01 A;  3P4W A;  5L4H A;  4LMK A;  2C9T A;  3UU6 A;  4DBM A;  5L47 A;  3EHZ A;  2VL0 A;  2W8G A;  3WTN A;  4A98 A;  5KE4 A;  3UU5 A;  4XK9 A;  5HEG A;  2XQA A;  5AIN A;  5J0Z A;  3SIO A;  4TWH A;  4ILC A;  2XNU A;  4QAA A;  3WTJ A;  5HCM A;  5HEJ A;  5J5G A;  4EZ1 A;  3UU8 A;  4UM1 A;  4ALX A;  1UW6 A;  5HEU A;  2ZJV A;  3U8M A;  3SQ6 A;  3UQ7 A;  2ZJU A;  5AFK A;  4TNV A;  4WV9 A;  3RQW A;  3TLS A;  2YKS A;  4BQT A;  4ZR6 A;  4HFH A;  4AFH A;  5SYO A;  3ZDG A;  3EAM A;  3JAF A;  2XZ6 A;  4QH1 A;  5TVC A;  4TWF A;  3U8J A; 
#chains in the Genus database with same CATH homology
 3TLT A;  2BR8 A;  2UZ6 A;  2Y57 A;  4TWD A;  3SQ9 A;  3RIF A;  5J5H A;  3WTM A;  4QAC A;  5CFB A;  3WTK A;  4UXU A;  4QH4 A;  5AFN A;  3U8N A;  3JAE A;  4LMJ A;  1I9B A;  2XQ5 A;  5BW2 A;  2PH9 A;  3TLW A;  3WTI A;  2Y54 A;  3UU3 A;  2XQ6 A;  2XQ7 A;  4A97 A;  3JAD A;  3ZDH A;  4ZZB A;  3EI0 A;  5AFL A;  4IL4 A;  2XQ4 A;  4ILA A;  4COF A;  2BG9 C;  3RQU A;  4ZK1 A;  4UM3 A;  2Y56 A;  5BP0 A;  2XYT A;  4NZB A;  2XNV A;  3RIA A;  2XYS A;  3TLV A;  2PGZ A;  2WN9 A;  2BYS A;  5J5I A;  2BYR A;  4LML A;  5LG3 A;  2QC1 B;  2Y58 A;  2BYQ A;  5HEO A;  2BR7 A;  2XQ9 A;  3U8K A;  1UX2 A;  2XNT A;  4Z91 A;  3WIP A;  5LXB A;  4UM3 S;  4F8H A;  5KZU A;  2WNC A;  3C79 A;  3WTH A;  4B5D A;  3PMZ A;  4ZJT A;  2W8F A;  3P50 A;  4HFD A;  4HQP A;  2BJ0 A;  5IUX A;  3ZKR A;  2BG9 A;  3SH1 A;  5AFM A;  5AFM B;  2X00 A;  2WNL A;  3WTL A;  5BRX A;  5L4E A;  4HFC A;  4ZJS A;  4UY2 A;  2X00 D;  4TNW A;  2YMD A;  4Z90 A;  4AFT A;  4FRR A;  4UM3 P;  5J5F A;  5HCJ A;  3T4M A;  3RI5 A;  5FJV A;  3WTO A;  5CO5 A;  2YME A;  2XZ5 A;  2YN6 A;  2BYN A;  4ZK4 A;  4ZRU A;  4HFE A;  3UQ4 A;  3LSV A;  2BYP A;  2XQ3 A;  4NPP A;  4XHE A;  4ZZC A;  4ILB A;  4HFI A;  4AFG A;  2WNJ A;  4PIR A;  3TLU A;  2BG9 B;  2XQ8 A;  3C84 A;  2WZY A;  3IGQ A;  5HEH A;  3UU4 A;  4IL9 A;  3GUA A;  4HFB A;  5JME A;  2BG9 E;  5AFJ A;  4QH5 A;  5AFH A;  4BFQ A;  3RHW A;  1UV6 A;  3UUB A;  2Y7Y A;  4X5T A;  4QAB A;  2YOE A;  3PEO A;  4IRE A;  3U8L A;  4D01 A;  3P4W A;  5L4H A;  4LMK A;  2C9T A;  3UU6 A;  4DBM A;  5L47 A;  3EHZ A;  2VL0 A;  2W8G A;  3WTN A;  4A98 A;  5KE4 A;  3UU5 A;  4XK9 A;  5HEG A;  2XQA A;  5AIN A;  5J0Z A;  3SIO A;  4TWH A;  4ILC A;  2XNU A;  4QAA A;  3WTJ A;  5HCM A;  5HEJ A;  5J5G A;  4EZ1 A;  3UU8 A;  4UM1 A;  4ALX A;  1UW6 A;  5HEU A;  2ZJV A;  3U8M A;  3SQ6 A;  3UQ7 A;  2ZJU A;  5AFK A;  4TNV A;  4WV9 A;  3RQW A;  3TLS A;  2YKS A;  4BQT A;  4ZR6 A;  4HFH A;  4AFH A;  5SYO A;  3ZDG A;  3EAM A;  3JAF A;  2XZ6 A;  4QH1 A;  5TVC A;  4TWF A;  3U8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...