2BJ0A

Crystal structure of achbp from bulinus truncatus revals the conserved structural scaffold and sites of variation in nicotinic acetylcholine receptors
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
203
structure length
203
Chain Sequence
QIRWTLLNQITGESDVIPLSNNTPLNVSLNFKLMNIVEADTEKDQVEVVLWTQASWKVPYYSSLLSSSSLDQVSLPVSKMWTPDLSFYNAIAAPELLSADRVVVSKDGSVIYVPSQRVRFTCDLINVDTEPGATCRIKVGSWTHDNKQFALITGEEGVVNIAEYFDSPKFDLLSATQSLNRKKYSCCENMYDDIEITFAFRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycoprotein
molecule keywords ACETYLCHOLINE-BINDING PROTEIN
publication title Crystal Structure of Acetylcholine-Binding Protein from Bulinus Truncatus Reveals the Conserved Structural Scaffold and Sites of Variation in Nicotinic Acetylcholine Receptors.
pubmed doi rcsb
source organism Bulinus truncatus
total genus 50
structure length 203
sequence length 203
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bj0A00
4Z90A 3UUBA 2XQAA 2Y7YA 2ZJVA 3UU4A 2XNTA 2PGZA 2BYQA 4NPPA 5CFBA 3P4WA 5HCMA 4QH4A 5HCJA 5TVCA 3WTHA 2BJ0A 5FJVA 2BG9E 4B5DA 3WTNA 4HFDA 4XK9A 4QH1A 4EZ1A 3EHZA 2XYSA 2XNVA 5LXBA 2BG9C 3TLWA 2BYRA 3WTKA 3TLTA 2BG9B 4ILAA 3RQWA 3U8JA 3ZDHA 2XQ3A 3T4MA 1UX2A 5SYOA 4ZK4A 4IL4A 3WTLA 4D01A 5J0ZA 4XHEA 3ZDGA 3RIFA 3PEOA 2BR7A 4IL9A 2BYNA 4NZBA 3UU6A 2BYPA 3GUAA 2XQ5A 3U8KA 4A97A 4UY2A 4AFGA 3C84A 3ZKRA 4F8HA 3U8LA 5BP0A 3U8MA 4UXUA 5KE4A 4ZZCA 2YKSA 3JADA 5LG3A 5L4EA 2W8GA 5BW2A 4UM3P 4ILCA 4BFQA 3LSVA 3UU3A 5L47A 2YN6A 5J5HA 4HFEA 4AFHA 5KZUA 3JAFA 3WTOA 4TWHA 5AFKA 4QAAA 2XQ7A 3RIAA 4LMLA 4HQPA 5J5FA 2Y56A 5J5GA 4DBMA 4ZJSA 4UM1A 3WIPA 2Y54A 4LMKA 4PIRA 3P50A 3WTJA 4QH5A 4AFTA 5AFMA 3EAMA 5HEUA 4LMJA 4UM3A 3TLVA 2QC1B 4ZJTA 2BR8A 1UW6A 4COFA 4HFCA 3RI5A 3TLUA 5J5IA 5AINA 3WTIA 4ILBA 4IREA 4HFBA 3SQ6A 3TLSA 2XQ6A 4X5TA 2WN9A 3C79A 3SIOA 5BRXA 2W8FA 2XQ4A 3RHWA 5JMEA 4ZZBA 4A98A 2X00A 4QACA 3RQUA 1UV6A 2YMEA 3SQ9A 3UU5A 2X00D 3WTMA 4ALXA 5AFMB 3UQ7A 5HEOA 5AFNA 2YMDA 3SH1A 5IUXA 4TWDA 3IGQA 2ZJUA 4ZR6A 4FRRA 3PMZA 3JAEA 5AFJA 5AFHA 4ZK1A 2XQ9A 2XYTA 4HFIA 2Y57A 5AFLA 4QABA 5HEJA 4HFHA 3UQ4A 4ZRUA 2XZ5A 2UZ6A 2VL0A 2WZYA 3UU8A 5L4HA 5HEHA 2WNCA 5CO5A 2PH9A 4TWFA 1I9BA 5HEGA 2YOEA 4TNVA 4WV9A 3U8NA 4TNWA 2C9TA 2Y58A 4Z91A 2WNJA 2WNLA 2XZ6A 2BG9A 2XQ8A 4UM3S 2BYSA 2XNUA 3EI0A 4BQTA
chains in the Genus database with same CATH superfamily
4Z90A 3UUBA 2XQAA 2Y7YA 2ZJVA 3UU4A 2XNTA 2PGZA 2BYQA 4NPPA 5CFBA 3P4WA 5HCMA 4QH4A 5HCJA 5TVCA 3WTHA 2BJ0A 5FJVA 2BG9E 4B5DA 3WTNA 4HFDA 4XK9A 4QH1A 4EZ1A 3EHZA 2XYSA 2XNVA 5LXBA 2BG9C 3TLWA 2BYRA 3WTKA 3TLTA 2BG9B 4ILAA 3RQWA 3U8JA 3ZDHA 2XQ3A 3T4MA 1UX2A 5SYOA 4ZK4A 4IL4A 3WTLA 4D01A 5J0ZA 4XHEA 3ZDGA 3RIFA 3PEOA 2BR7A 4IL9A 2BYNA 4NZBA 3UU6A 2BYPA 3GUAA 2XQ5A 3U8KA 4A97A 4UY2A 4AFGA 3C84A 3ZKRA 4F8HA 3U8LA 5BP0A 3U8MA 4UXUA 5KE4A 4ZZCA 2YKSA 3JADA 5LG3A 5L4EA 2W8GA 5BW2A 4UM3P 4ILCA 4BFQA 3LSVA 3UU3A 5L47A 2YN6A 5J5HA 4HFEA 4AFHA 5KZUA 3JAFA 3WTOA 4TWHA 5AFKA 4QAAA 2XQ7A 3RIAA 4LMLA 4HQPA 5J5FA 2Y56A 5J5GA 4DBMA 4ZJSA 4UM1A 3WIPA 2Y54A 4LMKA 4PIRA 3P50A 3WTJA 4QH5A 4AFTA 5AFMA 3EAMA 5HEUA 4LMJA 4UM3A 3TLVA 2QC1B 4ZJTA 2BR8A 1UW6A 4COFA 4HFCA 3RI5A 3TLUA 5J5IA 5AINA 3WTIA 4ILBA 4IREA 4HFBA 3SQ6A 3TLSA 2XQ6A 4X5TA 2WN9A 3C79A 3SIOA 5BRXA 2W8FA 2XQ4A 3RHWA 5JMEA 4ZZBA 4A98A 2X00A 4QACA 3RQUA 1UV6A 2YMEA 3SQ9A 3UU5A 2X00D 3WTMA 4ALXA 5AFMB 3UQ7A 5HEOA 5AFNA 2YMDA 3SH1A 5IUXA 4TWDA 3IGQA 2ZJUA 4ZR6A 4FRRA 3PMZA 3JAEA 5AFJA 5AFHA 4ZK1A 2XQ9A 2XYTA 4HFIA 2Y57A 5AFLA 4QABA 5HEJA 4HFHA 3UQ4A 4ZRUA 2XZ5A 2UZ6A 2VL0A 2WZYA 3UU8A 5L4HA 5HEHA 2WNCA 5CO5A 2PH9A 4TWFA 1I9BA 5HEGA 2YOEA 4TNVA 4WV9A 3U8NA 4TNWA 2C9TA 2Y58A 4Z91A 2WNJA 2WNLA 2XZ6A 2BG9A 2XQ8A 4UM3S 2BYSA 2XNUA 3EI0A 4BQTA
chains in the Genus database with same CATH topology
4Z90A 3UUBA 2XQAA 2Y7YA 2ZJVA 3UU4A 2XNTA 2PGZA 2BYQA 4NPPA 5CFBA 3P4WA 5HCMA 4QH4A 5HCJA 5TVCA 3WTHA 2BJ0A 5FJVA 2BG9E 4B5DA 3WTNA 4HFDA 4XK9A 4QH1A 4EZ1A 3EHZA 2XYSA 2XNVA 5LXBA 2BG9C 3TLWA 2BYRA 3WTKA 3TLTA 2BG9B 4ILAA 3RQWA 3U8JA 3ZDHA 2XQ3A 3T4MA 1UX2A 5SYOA 4ZK4A 4IL4A 3WTLA 4D01A 5J0ZA 4XHEA 3ZDGA 3RIFA 3PEOA 2BR7A 4IL9A 2BYNA 4NZBA 3UU6A 2BYPA 3GUAA 2XQ5A 3U8KA 4A97A 4UY2A 4AFGA 3C84A 3ZKRA 4F8HA 3U8LA 5BP0A 3U8MA 4UXUA 5KE4A 4ZZCA 2YKSA 3JADA 5LG3A 5L4EA 2W8GA 5BW2A 4UM3P 4ILCA 4BFQA 3LSVA 3UU3A 5L47A 2YN6A 5J5HA 4HFEA 4AFHA 5KZUA 3JAFA 3WTOA 4TWHA 5AFKA 4QAAA 2XQ7A 3RIAA 4LMLA 4HQPA 5J5FA 2Y56A 5J5GA 4DBMA 4ZJSA 4UM1A 3WIPA 2Y54A 4LMKA 4PIRA 3P50A 3WTJA 4QH5A 4AFTA 5AFMA 3EAMA 5HEUA 4LMJA 4UM3A 3TLVA 2QC1B 4ZJTA 2BR8A 1UW6A 4COFA 4HFCA 3RI5A 3TLUA 5J5IA 5AINA 3WTIA 4ILBA 4IREA 4HFBA 3SQ6A 3TLSA 2XQ6A 4X5TA 2WN9A 3C79A 3SIOA 5BRXA 2W8FA 2XQ4A 3RHWA 5JMEA 4ZZBA 4A98A 2X00A 4QACA 3RQUA 1UV6A 2YMEA 3SQ9A 3UU5A 2X00D 3WTMA 4ALXA 5AFMB 3UQ7A 5HEOA 5AFNA 2YMDA 3SH1A 5IUXA 4TWDA 3IGQA 2ZJUA 4ZR6A 4FRRA 3PMZA 3JAEA 5AFJA 5AFHA 4ZK1A 2XQ9A 2XYTA 4HFIA 2Y57A 5AFLA 4QABA 5HEJA 4HFHA 3UQ4A 4ZRUA 2XZ5A 2UZ6A 2VL0A 2WZYA 3UU8A 5L4HA 5HEHA 2WNCA 5CO5A 2PH9A 4TWFA 1I9BA 5HEGA 2YOEA 4TNVA 4WV9A 3U8NA 4TNWA 2C9TA 2Y58A 4Z91A 2WNJA 2WNLA 2XZ6A 2BG9A 2XQ8A 4UM3S 2BYSA 2XNUA 3EI0A 4BQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z90 A;  3UUB A;  2XQA A;  2Y7Y A;  2ZJV A;  3UU4 A;  2XNT A;  2PGZ A;  2BYQ A;  4NPP A;  5CFB A;  3P4W A;  5HCM A;  4QH4 A;  5HCJ A;  5TVC A;  3WTH A;  2BJ0 A;  5FJV A;  2BG9 E;  4B5D A;  3WTN A;  4HFD A;  4XK9 A;  4QH1 A;  4EZ1 A;  3EHZ A;  2XYS A;  2XNV A;  5LXB A;  2BG9 C;  3TLW A;  2BYR A;  3WTK A;  3TLT A;  2BG9 B;  4ILA A;  3RQW A;  3U8J A;  3ZDH A;  2XQ3 A;  3T4M A;  1UX2 A;  5SYO A;  4ZK4 A;  4IL4 A;  3WTL A;  4D01 A;  5J0Z A;  4XHE A;  3ZDG A;  3RIF A;  3PEO A;  2BR7 A;  4IL9 A;  2BYN A;  4NZB A;  3UU6 A;  2BYP A;  3GUA A;  2XQ5 A;  3U8K A;  4A97 A;  4UY2 A;  4AFG A;  3C84 A;  3ZKR A;  4F8H A;  3U8L A;  5BP0 A;  3U8M A;  4UXU A;  5KE4 A;  4ZZC A;  2YKS A;  3JAD A;  5LG3 A;  5L4E A;  2W8G A;  5BW2 A;  4UM3 P;  4ILC A;  4BFQ A;  3LSV A;  3UU3 A;  5L47 A;  2YN6 A;  5J5H A;  4HFE A;  4AFH A;  5KZU A;  3JAF A;  3WTO A;  4TWH A;  5AFK A;  4QAA A;  2XQ7 A;  3RIA A;  4LML A;  4HQP A;  5J5F A;  2Y56 A;  5J5G A;  4DBM A;  4ZJS A;  4UM1 A;  3WIP A;  2Y54 A;  4LMK A;  4PIR A;  3P50 A;  3WTJ A;  4QH5 A;  4AFT A;  5AFM A;  3EAM A;  5HEU A;  4LMJ A;  4UM3 A;  3TLV A;  2QC1 B;  4ZJT A;  2BR8 A;  1UW6 A;  4COF A;  4HFC A;  3RI5 A;  3TLU A;  5J5I A;  5AIN A;  3WTI A;  4ILB A;  4IRE A;  4HFB A;  3SQ6 A;  3TLS A;  2XQ6 A;  4X5T A;  2WN9 A;  3C79 A;  3SIO A;  5BRX A;  2W8F A;  2XQ4 A;  3RHW A;  5JME A;  4ZZB A;  4A98 A;  2X00 A;  4QAC A;  3RQU A;  1UV6 A;  2YME A;  3SQ9 A;  3UU5 A;  2X00 D;  3WTM A;  4ALX A;  5AFM B;  3UQ7 A;  5HEO A;  5AFN A;  2YMD A;  3SH1 A;  5IUX A;  4TWD A;  3IGQ A;  2ZJU A;  4ZR6 A;  4FRR A;  3PMZ A;  3JAE A;  5AFJ A;  5AFH A;  4ZK1 A;  2XQ9 A;  2XYT A;  4HFI A;  2Y57 A;  5AFL A;  4QAB A;  5HEJ A;  4HFH A;  3UQ4 A;  4ZRU A;  2XZ5 A;  2UZ6 A;  2VL0 A;  2WZY A;  3UU8 A;  5L4H A;  5HEH A;  2WNC A;  5CO5 A;  2PH9 A;  4TWF A;  1I9B A;  5HEG A;  2YOE A;  4TNV A;  4WV9 A;  3U8N A;  4TNW A;  2C9T A;  2Y58 A;  4Z91 A;  2WNJ A;  2WNL A;  2XZ6 A;  2BG9 A;  2XQ8 A;  4UM3 S;  2BYS A;  2XNU A;  3EI0 A;  4BQT A; 
#chains in the Genus database with same CATH topology
 4Z90 A;  3UUB A;  2XQA A;  2Y7Y A;  2ZJV A;  3UU4 A;  2XNT A;  2PGZ A;  2BYQ A;  4NPP A;  5CFB A;  3P4W A;  5HCM A;  4QH4 A;  5HCJ A;  5TVC A;  3WTH A;  2BJ0 A;  5FJV A;  2BG9 E;  4B5D A;  3WTN A;  4HFD A;  4XK9 A;  4QH1 A;  4EZ1 A;  3EHZ A;  2XYS A;  2XNV A;  5LXB A;  2BG9 C;  3TLW A;  2BYR A;  3WTK A;  3TLT A;  2BG9 B;  4ILA A;  3RQW A;  3U8J A;  3ZDH A;  2XQ3 A;  3T4M A;  1UX2 A;  5SYO A;  4ZK4 A;  4IL4 A;  3WTL A;  4D01 A;  5J0Z A;  4XHE A;  3ZDG A;  3RIF A;  3PEO A;  2BR7 A;  4IL9 A;  2BYN A;  4NZB A;  3UU6 A;  2BYP A;  3GUA A;  2XQ5 A;  3U8K A;  4A97 A;  4UY2 A;  4AFG A;  3C84 A;  3ZKR A;  4F8H A;  3U8L A;  5BP0 A;  3U8M A;  4UXU A;  5KE4 A;  4ZZC A;  2YKS A;  3JAD A;  5LG3 A;  5L4E A;  2W8G A;  5BW2 A;  4UM3 P;  4ILC A;  4BFQ A;  3LSV A;  3UU3 A;  5L47 A;  2YN6 A;  5J5H A;  4HFE A;  4AFH A;  5KZU A;  3JAF A;  3WTO A;  4TWH A;  5AFK A;  4QAA A;  2XQ7 A;  3RIA A;  4LML A;  4HQP A;  5J5F A;  2Y56 A;  5J5G A;  4DBM A;  4ZJS A;  4UM1 A;  3WIP A;  2Y54 A;  4LMK A;  4PIR A;  3P50 A;  3WTJ A;  4QH5 A;  4AFT A;  5AFM A;  3EAM A;  5HEU A;  4LMJ A;  4UM3 A;  3TLV A;  2QC1 B;  4ZJT A;  2BR8 A;  1UW6 A;  4COF A;  4HFC A;  3RI5 A;  3TLU A;  5J5I A;  5AIN A;  3WTI A;  4ILB A;  4IRE A;  4HFB A;  3SQ6 A;  3TLS A;  2XQ6 A;  4X5T A;  2WN9 A;  3C79 A;  3SIO A;  5BRX A;  2W8F A;  2XQ4 A;  3RHW A;  5JME A;  4ZZB A;  4A98 A;  2X00 A;  4QAC A;  3RQU A;  1UV6 A;  2YME A;  3SQ9 A;  3UU5 A;  2X00 D;  3WTM A;  4ALX A;  5AFM B;  3UQ7 A;  5HEO A;  5AFN A;  2YMD A;  3SH1 A;  5IUX A;  4TWD A;  3IGQ A;  2ZJU A;  4ZR6 A;  4FRR A;  3PMZ A;  3JAE A;  5AFJ A;  5AFH A;  4ZK1 A;  2XQ9 A;  2XYT A;  4HFI A;  2Y57 A;  5AFL A;  4QAB A;  5HEJ A;  4HFH A;  3UQ4 A;  4ZRU A;  2XZ5 A;  2UZ6 A;  2VL0 A;  2WZY A;  3UU8 A;  5L4H A;  5HEH A;  2WNC A;  5CO5 A;  2PH9 A;  4TWF A;  1I9B A;  5HEG A;  2YOE A;  4TNV A;  4WV9 A;  3U8N A;  4TNW A;  2C9T A;  2Y58 A;  4Z91 A;  2WNJ A;  2WNL A;  2XZ6 A;  2BG9 A;  2XQ8 A;  4UM3 S;  2BYS A;  2XNU A;  3EI0 A;  4BQT A; 
#chains in the Genus database with same CATH homology
 4Z90 A;  3UUB A;  2XQA A;  2Y7Y A;  2ZJV A;  3UU4 A;  2XNT A;  2PGZ A;  2BYQ A;  4NPP A;  5CFB A;  3P4W A;  5HCM A;  4QH4 A;  5HCJ A;  5TVC A;  3WTH A;  2BJ0 A;  5FJV A;  2BG9 E;  4B5D A;  3WTN A;  4HFD A;  4XK9 A;  4QH1 A;  4EZ1 A;  3EHZ A;  2XYS A;  2XNV A;  5LXB A;  2BG9 C;  3TLW A;  2BYR A;  3WTK A;  3TLT A;  2BG9 B;  4ILA A;  3RQW A;  3U8J A;  3ZDH A;  2XQ3 A;  3T4M A;  1UX2 A;  5SYO A;  4ZK4 A;  4IL4 A;  3WTL A;  4D01 A;  5J0Z A;  4XHE A;  3ZDG A;  3RIF A;  3PEO A;  2BR7 A;  4IL9 A;  2BYN A;  4NZB A;  3UU6 A;  2BYP A;  3GUA A;  2XQ5 A;  3U8K A;  4A97 A;  4UY2 A;  4AFG A;  3C84 A;  3ZKR A;  4F8H A;  3U8L A;  5BP0 A;  3U8M A;  4UXU A;  5KE4 A;  4ZZC A;  2YKS A;  3JAD A;  5LG3 A;  5L4E A;  2W8G A;  5BW2 A;  4UM3 P;  4ILC A;  4BFQ A;  3LSV A;  3UU3 A;  5L47 A;  2YN6 A;  5J5H A;  4HFE A;  4AFH A;  5KZU A;  3JAF A;  3WTO A;  4TWH A;  5AFK A;  4QAA A;  2XQ7 A;  3RIA A;  4LML A;  4HQP A;  5J5F A;  2Y56 A;  5J5G A;  4DBM A;  4ZJS A;  4UM1 A;  3WIP A;  2Y54 A;  4LMK A;  4PIR A;  3P50 A;  3WTJ A;  4QH5 A;  4AFT A;  5AFM A;  3EAM A;  5HEU A;  4LMJ A;  4UM3 A;  3TLV A;  2QC1 B;  4ZJT A;  2BR8 A;  1UW6 A;  4COF A;  4HFC A;  3RI5 A;  3TLU A;  5J5I A;  5AIN A;  3WTI A;  4ILB A;  4IRE A;  4HFB A;  3SQ6 A;  3TLS A;  2XQ6 A;  4X5T A;  2WN9 A;  3C79 A;  3SIO A;  5BRX A;  2W8F A;  2XQ4 A;  3RHW A;  5JME A;  4ZZB A;  4A98 A;  2X00 A;  4QAC A;  3RQU A;  1UV6 A;  2YME A;  3SQ9 A;  3UU5 A;  2X00 D;  3WTM A;  4ALX A;  5AFM B;  3UQ7 A;  5HEO A;  5AFN A;  2YMD A;  3SH1 A;  5IUX A;  4TWD A;  3IGQ A;  2ZJU A;  4ZR6 A;  4FRR A;  3PMZ A;  3JAE A;  5AFJ A;  5AFH A;  4ZK1 A;  2XQ9 A;  2XYT A;  4HFI A;  2Y57 A;  5AFL A;  4QAB A;  5HEJ A;  4HFH A;  3UQ4 A;  4ZRU A;  2XZ5 A;  2UZ6 A;  2VL0 A;  2WZY A;  3UU8 A;  5L4H A;  5HEH A;  2WNC A;  5CO5 A;  2PH9 A;  4TWF A;  1I9B A;  5HEG A;  2YOE A;  4TNV A;  4WV9 A;  3U8N A;  4TNW A;  2C9T A;  2Y58 A;  4Z91 A;  2WNJ A;  2WNL A;  2XZ6 A;  2BG9 A;  2XQ8 A;  4UM3 S;  2BYS A;  2XNU A;  3EI0 A;  4BQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...