2XQAA

Pentameric ligand gated ion channel glic in complex with tetrabutylantimony (tbsb)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
total genus 73
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xqaA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xqaA01
2BYPA 3EHZA 4UM3S 3WTIA 4ILAA 4QABA 5AFMA 4BQTA 2XQ8A 5AFNA 3JAFA 3UU3A 4Z91A 3UU4A 3SQ6A 2W8GA 4IL9A 3GUAA 4ILCA 3P4WA 3WTKA 3LSVA 4LMKA 1I9BA 2MAWA 3TLVA 3JADA 2BR8A 4HFCA 1UW6A 5LG3A 2Y7YA 3WTJA 5L4HA 4EZ1A 5AFLA 4D01A 4A97A 1OEDA 2XQAA 1OEDC 4Z90A 3UU6A 3C79A 4ZRUA 3U8NA 5AINA 4F8HA 2XQ3A 3ZDHA 2XZ6A 5J5FA 2BYNA 3SQ9A 2LKGA 2XYTA 4A98A 4NPPA 5FJVA 5BRXA 4TWDA 2YOEA 5L4EA 4TNVA 2UZ6A 2C9TA 3EI0A 5HEOA 4FRRA 2YN6A 4UM3A 2YMDA 2LM2A 4COFA 3SIOA 3JAEA 3UQ7A 5BP0A 4AFGA 2WZYA 2WNJA 1OEDE 2X00A 5AFMB 2LLYA 2BJ0A 3TLUA 4HFIA 5AFJA 3RQWA 4UM3P 3TLSA 3WTLA 4ALXA 2M6BA 4HFBA 3U8MA 2BYSA 2Y54A 4XK9A 4ZK4A 4XHEA 5HCMA 2BYQA 4AFHA 5AFHA 2PGZA 2Y58A 5L47A 3UUBA 4QH4A 5J5IA 5CFBA 1OEDB 2ZJVA 4PIRA 4ZR6A 5J5GA 5SYOA 2XQ6A 4QACA 2XQ7A 3WTHA 5BW2A 4BFQA 2Y56A 5HEGA 3WTOA 3PMZA 4AFTA 2VL0A 2XNUA 3EAMA 4TWFA 3T4MA 5KZUA 2BG9A 3WTNA 2BR7A 4LMLA 2BYRA 3WTMA 4IREA 2XNVA 5KE4A 5IUXA 3C84A 5LXBA 1UV6A 2XZ5A 4NZBA 4QAAA 3U8JA 3U8LA 4UM1A 2M6IA 2WNCA 2W8FA 3PEOA 5HCJA 3RHWA 3U8KA 3WIPA 5J0ZA 2BG9E 4TWHA 3TLTA 2KSRA 3UU5A 3RIAA 3ZDGA 5AFKA 4HQPA 5J5HA 4HFHA 4ZZCA 4ILBA 3ZKRA 2ZJUA 4HFDA 5CO5A 4ZJSA 5HEJA 2X00D 4UXUA 3P50A 2XQ4A 2PH9A 4WV9A 3TLWA 2BG9C 2LKHA 4ZJTA 4LMJA 5HEHA 4QH1A 2BG9B 2YMEA 4ZZBA 2Y57A 5JMEA 2XNTA 2YKSA 3IGQA 4DBMA 3UU8A 4UY2A 4QH5A 5TVCA 4B5DA 2XQ5A 5HEUA 3RIFA 4HFEA 4IL4A 2XYSA 4X5TA 2XQ9A 2WNLA 2WN9A 3RI5A 3UQ4A 1UX2A 3SH1A 4TNWA 4ZK1A 3RQUA 2QC1B
chains in the Genus database with same CATH superfamily
5LNKA 1D1CA 4Q25A 3PJAJ 3RRWA 3AECA 5FYMA 4B3MT 3UU4A 4YXDA 4FI5A 4X65T 1SUMB 3NKZA 3PUVF 4YJ3E 1MMNA 3KVAA 5AQQB 5CB4E 3KDSE 3O1IA 2XZ6A 5L4EA 4TNVA 5JDLA 2YMDA 3MKDA 2X66A 5BR8T 4UM3P 3PUQA 3AA1B 2NW9A 2WDRA 3N9LA 3ONJA 4HFVA 2WAUA 4PK6A 4ZS2A 4GIWA 3WTHA 4YHJA 1IBLT 3PMZA 2I0MA 4YLHA 1W9RA 4JV5T 5AQPB 2Z6EA 5JDFA 5FVLA 2W61A 3U3IA 2WQYA 5LG4A 1MMDA 3DTOA 4AI6A 5AFKA 3O1JA 5CA1E 4PFPA 3CX6B 4ISSA 2XQ4A 3TLWA 4ZJTA 3OYXA 4QWNB 4ZZBA 3AB3B 3EDVA 3UFGA 4GK0E 3H3MA 1BR2A 4B5DA 3ZT7A 4X5TA 2XQ9A 2LSJA 1WRDA 3PJAA 2E9XD 5LYJE 2V7JA 2YU1A 3IHRA 2N1GA 2X67A 1HF8A 1HG5A 3JADA 2IUBA 2ACXA 3WTJA 3SOLA 3BK9A 3AAAB 2CLYB 2IHR1 2CA5A 2R6GF 3QB5A 3KFWX 4U33A 2BS3A 2UZ6A 1WYCA 4COFA 2WP9A 4HWFA 2H3RA 2NW7A 2LLYA 2BZBA 2XM1A 2QVAA 3RIUC 4AFHA 5AFHA 1YD8G 2W67A 5L47A 5J5IA 1M62A 3FBZA 4BFQA 5J2TE 4JI0T 1WCRA 2CEAA 4P09A 2CHNA 1D1BA 2RP4A 3U8JA 3ZN0B 2X0YA 2XQYA 2BG9E 5FY7A 4HQPA 3VKGA 1Z0PA 2LHNA 3PE0A 3LK42 4Z8XA 3UULA 4ANJA 2NWBA 1LVKA 2XY8B 5C2TA 2BDEA 5AQMB 2D5UA 3AVRA 4CXWA 2OA5A 5ABGA 1H7CA 4DV1T 3ZC1A 2QC1B 2V6XA 3WTIA 1D0XA 2L3LA 2PFVA 3AVSA 4TN7B 3E08A 3LSVA 3RPUA 2WS3A 2HH7A 4I0UA 2RPAA 5AQLB 2X9YA 5LGUB 3PUWF 1UX4A 2IIUA 5EK4A 1E7PA 2JQKA 2V6YB 5C8YE 3A5XA 1IJ5A 5LJNA 2BVMA 2N2NA 1HCIA 2WNJA 1OEDE 5TAOA 2PG8A 3TLUA 5AFJA 2L8KA 2J47A 3ZMZB 1VCSA 4I50E 2VL8A 4K0UA 3NZPA 2PGZA 2I6HA 4EZHA 2QA7A 4DNDA 3N9QA 3GMIA 3CK6A 3H37A 4PJLA 1T7SA 2UUCT 4UM1A 3V5UA 5AQTB 2BKNA 1FJGT 2VQFT 2Q9QD 4DR4T 3Q5DA 4HFDA 1D0YA 2V5DA 2X00D 1E1HB 3ETUA 4ZXLA 2XHEB 3M3ZB 2XAJB 2LSIA 5FVKA 4EYYR 5JVDE 3S4UA 1W0AA 1W09A 3ZC0A 4QABA 2OLTA 5H6RB 2NTYA 5L4HA 3RYCE 3T1HT 2Y6XA 4NUVA 2XQAA 2WY2A 4UR9A 4DV0T 2A72A 3N2KE 3K3OA 4FRRA 2PTFA 4PNIA 3JAEA 4U74A 5AQFB 5AFMB 2CCQA 3WTLA 4PW8A 4TX5A 1NENA 2HHHT 1MNEA 4HE8A 4IDNA 4QH4A 2WB5A 4M1PA 4HWHA 2E9XC 2IC9A 1N32T 5KZUA 3CMLA 3M65A 4JI7T 4YJ2E 4CQIA 2XUEA 4CZZB 3AAIA 2WCAA 4X1YE 4EB6E 5IWAT 3ONLC 4AISA 3U8LA 1QLBA 4AXPA 3ZPOA 3WIPA 2CXLA 1U5PA 5KXJA 4LFBT 3QB5K 4NXNT 2H7OA 1WLXA 5LHIB 4DVDA 4X66T 2LSGA 2E9XB 1CHUA 5ABHA 5L3DB 3RYFE 4BJNA 3PUXF 3AE8A 4EEDA 1FEWA 2NP9A 1BR0A 1M7KA 4IL4A 2X68A 1XNQT 3ANWB 4DUYT 3AEBA 4UXNB 4X62T 2E5VA 4ILAA 5ABEA 2KNDA 3SQ6A 3FXEB 2W0GA 1UX5A 2CBJA 4A97A 2YEVC 2ODUA 4NUUA 1QUUA 2JIWA 1OWAA 2NTXA 3EDUA 3QNUA 2VK9A 2MYSA 3P4PA 2WM9A 2AE9A 4HFIA 4LF4T 4ZI3D 1KNPA 5FXZA 2VKOA 4XHEA 5HWXA 4LFAT 3RIUA 5LOVE 3U78A 2VKDA 3UUBA 2XQ6A 1HNXT 2IMLA 3I0QA 5ADXL 5DQWA 1MNDA 3GN5B 3KV6A 2XNUA 4TWFA 2YK0A 4GYRA 2W62A 2XZ5A 4NZBA 3JC6C 3DP7A 3F2EA 3RX6A 2JRKA 3U8KA 4JI4T 3AE4A 3TLTA 3OYZA 3RIAA 4H9SE 3CX8B 2YINA 4AKHA 3AE6A 4OYKA 3N2GE 4X1IE 3AE3A 2C5JA 4U72A 4MFRA 3P7IA 2V6YA 2WWUA 4CN1A 4HWDA 5LCYA 4TNWA 4IDZA 1T8BA 4IIJE 2YDRA 4TZ4C 5FXVA 4BQTA 3DJBA 3GUAA 3ZJ1A 1IAPA 3B57A 5H6QB 3KINB 3K1SA 5AINA 2ZMAA 2ZM0A 4A98A 3CX7B 3LK2B 1VRBA 2BS4A 2Q9QC 3X1DA 3ZLIA 3PU3A 4UF0B 2YN6A 3EUHA 3AEGA 2ACZA 2WZYA 3KBTA 3FZKB 1HNZT 1ZEEA 4DUZT 2KT9A 1HR0T 3FBLA 3U8MA 5A1LA 1ZV4X 4ZK4A 4DBRA 3WAJA 4PK5A 2X0LB 1SE7A 4X64T 2QRXA 4HWCA 1XMOT 5AQVB 5AQSB 1XNRT 2Q9QB 3BQKA 2RA1A 4DR1T 2J1DG 5HXEA 3PUZF 3UTKA 5AQGB 3I1AA 4QAAA 3RH3A 2JPFA 1SA0E 2E8IA 2WDQA 1XMQT 2W8FA 4BAYB 4IDOA 1XZYA 2WBLA 5JR9C 3VRBA 2YU2A 2XJ7A 4QXBB 2VKJA 1CUNA 5HEJA 3A7MA 4WBOA 2LT3A 2LOSA 5HEHA 2XNTA 1D0ZA 1WYBA 4E7SA 2JJ9A 2W4XA 2XTLA 4YTMA 3AXJB 1WFDA 5FKYA 3O9XA 3VKHA 4HEAA 3RRCA 5JR9B 4AKIA 2WZHA 4YT0A 2A3DA 5AFMA 3OBVE 3RF1A 4WNKA 3J9X1 2C0SA 2MAWA 2IW5B 1XDOA 3SRZA 2Y7YA 4O4JE 2CLYC 5C3JA 5HYAA 3LG7A 4N78D 3C4WA 1LKXA 3ZYLA 4EGWA 4MLKA 3AE7A 5IHYA 5FP3A 4TV8E 2UXBT 2LM2A 5BP0A 4O4IE 5KDMC 3UUXB 4QXCB 3ZT6A 3AEFA 5AQHB 4DR5T 2BYSA 1MIYA 4JBWF 1HX1B 2E9XA 3H3AA 2BBHA 3J7Yq 1FIOA 2K3WA 4I55E 2VL0A 2ES0A 4LMLA 1MIWA 4UVCB 2M67A 3ZJ2A 5LXBA 3AE1A 2M6IA 1Y64B 3TKLB 4DR2T 2EHOD 2HN2A 4C91A 3RC3A 4ILBA 4YSXA 2XM2A 3EVYA 2PH9A 1UUSA 2YMEA 4ZI3C 2CPTA 2DL1A 1YQ4A 5TVCA 4U2ZA 1JNRA 1ZP0A 1US7B 4KBMB 3I9YA 5LG3A 4O8SA 1N34T 5L3BB 3OKQA 2XQ8A 3AE5A 5L3CB 2CWYA 3WTKA 1KK7A 3P4RA 3ZMTB 4LMKA 3HKCE 2X9WA 2JMKA 3QK6A 1YQ3A 2CHOA 3UU6A 3C79A 5CA0E 4F8HA 4YFSA 3F57A 2UU9T 3ZDHA 2CXDA 2LKGA 3B5MA 4JEUB 2UXCT 5FJVA 3GN5A 2J62A 4I43B 5LBQB 2HPJA 4UM3A 2WU5A 3HR0A 4KUMB 5AQUB 2E5LT 3PURA 3LJCA 4ZR6A 2ZJVA 3IEEA 3CQCB 1YXRA 3PUYF 3ESLA 2LE8A 3F31A 2BR7A 2UXNB 5KE4A 2BKOA 4QX8B 2LRLA 4JI3T 2WNCA 5L3EB 4P0AA 2PBIA 2IAKA 3ZDGA 5CO5A 2MBGA 5JDMA 1MMAA 1V9DA 4UXUA 4G2AA 4ZI2D 4ZHQE 3Q9DA 5J2UE 1Y01A 4GK5E 4TV9E 4P1NA 4UF0A 4O4LE 3KV9A 2DHRA 4UM3S 3VRAA 3UU3A 1KNRA 4Z91A 3L3PA 2JQHA 4LF6T 1SHZC 1FMWA 2WU2A 3N5LA 4XAXB 4B6XA 3P4QA 3UFEA 2Q9QA 4TWDA 4ZI7E 4BJMA 1BR1A 1MMGA 4GOUA 2WDVA 3UQ7A 2K24A 2X00A 4ISTA 3PU8A 2BJ0A 5LXTE 2Y54A 5HCMA 3MK7C 2DNXA 2V7KA 4G63A 1ZKEA 3SFEA 2X9HA 2XAGB 3KV4A 3EAMA 3HKEE 3AAEB 3A8YC 2X9XA 3OVUA 3ZN1B 2C5IT 5JTGA 4MBQA 3VU7H 1KFYA 1I6ZA 4IE4A 3AXJA 4QHOA 5JR9A 2XASB 3VR9A 3CVRA 3ONXA 5KX5E 4EZ4A 5LGTB 3C50A 4V1Av 2JMHA 2BG9B 4PK4A 2KWHA 4H63H 3UU8A 2V7IA 5FL0A 3K8PC 2XYSA 2BKPA 4O2AE 3UQ4A 4CN6A 4IDPA 2DLRA 2W2UA 5FNVE 3JAFA 4NIQA 3P4WA 5JDQA 5F3JA 1OEDC 4PJJA 2DI4A 2CBIA 2JQQA 3N9MA 3FZHB 4AQYT 1L0VA 2EHOC 3ABVA 3GWHA 3NVOA 4IE6A 4UV9B 3SIOA 3NBXX 4WW0A 1BR4A 4DO0A 1LRZA 2V26A 2LM9A 3ZEFB 3PUGA 4IE0A 4GYSA 1UCUA 5FMNA 4KHPT 3QC9A 5LA6E 1OEDB 4PIRA 5CGMA 4QACA 3ZYKA 2Y56A 2EHOB 2NR4A 3WTNA 1EZ3A 4EYUA 3MZKB 4B3TT 3BQLA 3GA8A 2K5BB 2H88A 2A9UA 5J0ZA 4IGUA 4A56A 3R84B 5LJMA 3FZMB 5F8PA 3CIRA 5CJ5A 2N9DA 4U7YA 3RC8A 5HXHA 5AFUL 3ZMUB 4LMJA 3LBXB 2XZEA 4AQFC 5JMEA 3Q5XA 4LF9T 1N33T 3N9OA 4LF8T 3W15B 4OFZA 5HXCA 4NPPA 2BS2A 2UUAT 2VQET 4X1KE 1WR6A 5L2LA 3LFMA 5LGNB 5JREA 2OV9A 2FJDA 5FXXA 4HKAA 1S94A 4YHHT 4CI3B 2LSYA 2WMNA 3ZCJA 2BYNA 4H63V 3C64A 3UT5E 4XBFB 5GONE 1HNWT 4O2BE 2Y48B 3RQWA 2ODVA 5E0OA 2VKHA 4ZI2C 2YDQA 2P9BA 4JI8T 3RKGA 5HXRA 2LOPA 3IA3A 4EEBA 1YW0A 5CFBA 1HG2A 3AA6B 2CXFA 2J4GA 2QYWA 3WTOA 2X51A 3KBUA 4WBNE 3ZT5A 4ERRA 4L9IA 5IUXA 3VR8A 2LJLA 3RLFF 5ETWA 3RHWA 2SPCA 3ZMSB 4CXYA 2XAQB 2KSRA 1MIVA 2D9DA 3NRXA 3RYHE 4DV4T 4KX6A 2KXPB 1O3XA 3MA9A 3AA0B 1J5ET 2BBJA 3CKDA 3L09A 4OX9T 2WN9A 2GK9A 4TUYE 4CN4A 3HI2A 2BYPA 3EHZA 3PDYA 2K9AA 4MHCA 4CI2B 4JUYA 5JDNA 3PUSA 2Y8DA 2VVSA 4IL9A 2LSKA 5M4YA 4YSYA 4U31A 2FUPA 1UW6A 2MPKA 4EZ1A 5AFLA 2W00A 4O4HE 4OHFA 2UXXB 4Z90A 3NRYA 4AIUA 1VCTA 3SQ9A 2XPKA 2W63A 5HEOA 2BVLA 4KHZF 4ZEYA 4J2CA 3O1HA 3OJAA 4ILUA 4AQGA 4EV6A 4ALXA 3NZQA 2M6BA 3FZFB 4OK0A 2VASA 3AEDA 5AQRB 2D2SA 3KVBA 1LVFA 4AFTA 5BMVE 4IT4A 2BG9A 4B3RT 4IREA 5EK3A 5FL1A 2I59A 3JCFA 4GKJT 1UV6A 4DR3T 4HWIB 1NWMX 5AQKB 4HFHA 1NEKA 2XSBA 2ZJUA 2FBWA 5LP6E 4QXHB 4JEHB 2LKHA 4DV2T 4JLEA 2Y57A 3BQIA 1UGOA 4DMVA 3P4SA 4DBMA 4UY2A 3Q5EA 2XQ5A 2WNLA 3ANWA 2D0UA 1Z8UA 4ZK1A 2ZM2A 4DR6T 2KLQA 2KWIB 4HGAA 1IJ6A 4UVBB 4CI1B 4YTPA 2K48A 4ILCA 2CM0A 3TLVA 3Q2MA 2WWVA 1OEDA 4CXXA 4EOZB 4ZRUA 5J5FA 5LMUT 2EHOA 4DV5T 3C4XA 3T1YT 3EI0A 3ZCIA 5LHGB 3KV5A 4JI2T 4EXTA 4K0KT 2V5CA 4L0RA 3N9NA 2L9QA 1N36T 5LMNT 2HPLA 4JI5T 4HFBA 4JI1T 2B76A 2IC6A 2XQ7A 3FHNA 4H9NC 1GQEA 5BW2A 3I0OA 4H9QC 4KMCA 3T4MA 3LBXA 1IBMT 5FXWA 3WTMA 2XNVA 2V7LA 4HN9A 2W66A 4PFOA 4AKRB 5AQJB 2FJEA 5HCJA 4WYVA 3E0ZA 2CWOA 4ZZCA 4H9PC 5AQIB 1X9BA 4ASKA 4ZJSA 4OYJA 3WI3A 2V1DB 3PTRB 3P50A 5LHHB 2G0UA 2XAFB 4QH1A 5EZYE 4AQFA 4DIDB 2MOZA 3JC6D 2YKSA 5ABFB 2UUBT 5LBMA 2KINB 3I9WA 3RIFA 2VB6A 3MJXA 4H9OC 5JDGA 2WSSV 1IBKT 3AEAA 4GKKT 1I94T 1QSDA 1T72A 4JYAT 1I9BA 4ZOLE 4HFCA 2X0HA 1UK5A 1XWMA 2LRKA 5JRCB 3U8NA 2ZM8A 1ZHCA 5BRXA 5EK2A 4DBQA 3AA7B 1B7TA 1W0BA 1VOMA 1HX8A 2CE7A 1AJ3A 4AFGA 3OPCA 2VVNA 3EABA 4FJOA 4UELA 3FXDB 3ZMVB 3E22E 3RYIE 4X20E 3UUNA 3SWHA 2JQ9A 3R6NA 2KMFA 4BA9A 5J5GA 5SYOA 2B1EA 2CMRA 1U4QA 1XDPA 2DWKA 2MTQA 4DV7T 3CPZA 3RGLA 4HTEA 4H9RC 3C84A 2ZM6T 2VURA 2KZ7B 3MACA 3QUJA 3HKBE 1G8XA 3D0TA 4AKLA 3IBPA 3UU5A 4WZXA 2DWGA 1G73A 4XZCA 4QX7B 3N9PA 3O4XE 1YKHB 4WV9A 2BG9C 3K3QC 2VWAA 3IGQA 2FJAA 2IDOB 2ZLYA 3N2OA 3SH1A 4DR7T 5KMGP 5LB7B 4C90A 3NWIA 4ADZA 3HKDE 1KEYA 2W8GA 4JI6T 2DCFA 2QGSA 3CWZB 3LDQB 4D01A 3K3NA 4UIGA 1HFAA 2C5KT 4NXMT 3IF8B 4L5GA 2XAHB 2XYTA 5AQNB 3C98B 2C9TA 2A2FX 2WZIA 4P0BA 2H7VC 2NW8A 3L8RA 4E7ZA 4KI0F 1ZOYA 4IE7A 3TLSA 4A5XA 5HXSA 3FB2A 2AXDS 1T98A 2BYQA 4IHJE 2Y58A 5HAXA 3AE2A 5HWYA 3G06A 1KNZA 5HEGA 2YDSA 3OTOT 5FY0A 3ZSSA 5L3GB 2FJBA 3B13A 3RKOA 1UURA 2V7MA 3ZSTA 2XSAA 1IZNB 4LF7T 1YKEB 4PJMA 4B3ST 3PEOA 3AE9A 4LF5T 3ETVA 3MXZA 5J5HA 3SFDA 1HTJF 1KF6A 5J1GA 3Q5WA 1J1JA 3V5SA 4U7IA 4F6RC 3AEEA 3VHLA 4YSZA 3SS1A 4QH5A 2NOXA 2H89A 4ZS3A 5F5WA 1E2AA 3C51A 1UX2A 3RQUA 5JDHA 5DQVA 3CQGB 3PV0F 5AFNA 3FZLB 4UVAB 2BR8A 3QOFA 5DABA 5JQGE 3T8OA 2XQ3A 2UXDT 3C4ZA 2YOEA 2LHRA 1DU2A 4U2YA 4KP3C 4QKNA 1S35A 2D0TA 3ZYMA 4AKGA 3UUMA 4IE5A 5DJQC 5L3FB 4YTNA 2E2AA 4UV8B 4YY3T 3HL6A 1D1AA 4XK9A 3LK3B 4PJNA 1WR0A 2HN1A 4PAGA 1NAFA 4DMWA 2LEHA 1OXZA 5JH7E 3CQXC 2BYRA 5ABFA 3WAKA 1JNZA 3PUAA 5AQOB 4EIWA 1FMVA 1R8IA 5IYZE 2CRBA 2F4VT 4MALA 4U3CA 3HA4A 4TWHA 1X79A 5FY1A 4LFCT 1J5WA 1HS7A 3ZKRA 2V8SV 3L39A 4EAHA 4DV3T 5JRCA 3P8CD 2PJQA 5HEUA 4I4TE 4HFEA 4IDQA 2WMOA 3RI5A 4UEMA 4DV6T
chains in the Genus database with same CATH topology
2BYPA 3EHZA 4UM3S 3WTIA 4ILAA 4QABA 5AFMA 4BQTA 2XQ8A 5AFNA 3JAFA 3UU3A 4Z91A 3UU4A 3SQ6A 2W8GA 4IL9A 3GUAA 4ILCA 3P4WA 3WTKA 3LSVA 4LMKA 1I9BA 2MAWA 3TLVA 3JADA 2BR8A 4HFCA 1UW6A 5LG3A 2Y7YA 3WTJA 5L4HA 4EZ1A 5AFLA 4D01A 4A97A 1OEDA 2XQAA 1OEDC 4Z90A 3UU6A 3C79A 4ZRUA 3U8NA 5AINA 4F8HA 2XQ3A 3ZDHA 2XZ6A 5J5FA 2BYNA 3SQ9A 2LKGA 2XYTA 4A98A 4NPPA 5FJVA 5BRXA 4TWDA 2YOEA 5L4EA 4TNVA 2UZ6A 2C9TA 3EI0A 5HEOA 4FRRA 2YN6A 4UM3A 2YMDA 2LM2A 4COFA 3SIOA 3JAEA 3UQ7A 5BP0A 4AFGA 2WZYA 2WNJA 1OEDE 2X00A 5AFMB 2LLYA 2BJ0A 3TLUA 4HFIA 5AFJA 3RQWA 4UM3P 3TLSA 3WTLA 4ALXA 2M6BA 4HFBA 3U8MA 2BYSA 2Y54A 4XK9A 4ZK4A 4XHEA 5HCMA 2BYQA 4AFHA 5AFHA 2PGZA 2Y58A 5L47A 3UUBA 4QH4A 5J5IA 5CFBA 1OEDB 2ZJVA 4PIRA 4ZR6A 5J5GA 5SYOA 2XQ6A 4QACA 2XQ7A 3WTHA 5BW2A 4BFQA 2Y56A 5HEGA 3WTOA 3PMZA 4AFTA 2VL0A 2XNUA 3EAMA 4TWFA 3T4MA 5KZUA 2BG9A 3WTNA 2BR7A 4LMLA 2BYRA 3WTMA 4IREA 2XNVA 5KE4A 5IUXA 3C84A 5LXBA 1UV6A 2XZ5A 4NZBA 4QAAA 3U8JA 3U8LA 4UM1A 2M6IA 2WNCA 2W8FA 3PEOA 5HCJA 3RHWA 3U8KA 3WIPA 5J0ZA 2BG9E 4TWHA 3TLTA 2KSRA 3UU5A 3RIAA 3ZDGA 5AFKA 4HQPA 5J5HA 4HFHA 4ZZCA 4ILBA 3ZKRA 2ZJUA 4HFDA 5CO5A 4ZJSA 5HEJA 2X00D 4UXUA 3P50A 2XQ4A 2PH9A 4WV9A 3TLWA 2BG9C 2LKHA 4ZJTA 4LMJA 5HEHA 4QH1A 2BG9B 2YMEA 4ZZBA 2Y57A 5JMEA 2XNTA 2YKSA 3IGQA 4DBMA 3UU8A 4UY2A 4QH5A 5TVCA 4B5DA 2XQ5A 5HEUA 3RIFA 4HFEA 4IL4A 2XYSA 4X5TA 2XQ9A 2WNLA 2WN9A 3RI5A 3UQ4A 1UX2A 3SH1A 4TNWA 4ZK1A 3RQUA 2QC1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYP A;  3EHZ A;  4UM3 S;  3WTI A;  4ILA A;  4QAB A;  5AFM A;  4BQT A;  2XQ8 A;  5AFN A;  3JAF A;  3UU3 A;  4Z91 A;  3UU4 A;  3SQ6 A;  2W8G A;  4IL9 A;  3GUA A;  4ILC A;  3P4W A;  3WTK A;  3LSV A;  4LMK A;  1I9B A;  2MAW A;  3TLV A;  3JAD A;  2BR8 A;  4HFC A;  1UW6 A;  5LG3 A;  2Y7Y A;  3WTJ A;  5L4H A;  4EZ1 A;  5AFL A;  4D01 A;  4A97 A;  1OED A;  2XQA A;  1OED C;  4Z90 A;  3UU6 A;  3C79 A;  4ZRU A;  3U8N A;  5AIN A;  4F8H A;  2XQ3 A;  3ZDH A;  2XZ6 A;  5J5F A;  2BYN A;  3SQ9 A;  2LKG A;  2XYT A;  4A98 A;  4NPP A;  5FJV A;  5BRX A;  4TWD A;  2YOE A;  5L4E A;  4TNV A;  2UZ6 A;  2C9T A;  3EI0 A;  5HEO A;  4FRR A;  2YN6 A;  4UM3 A;  2YMD A;  2LM2 A;  4COF A;  3SIO A;  3JAE A;  3UQ7 A;  5BP0 A;  4AFG A;  2WZY A;  2WNJ A;  1OED E;  2X00 A;  5AFM B;  2LLY A;  2BJ0 A;  3TLU A;  4HFI A;  5AFJ A;  3RQW A;  4UM3 P;  3TLS A;  3WTL A;  4ALX A;  2M6B A;  4HFB A;  3U8M A;  2BYS A;  2Y54 A;  4XK9 A;  4ZK4 A;  4XHE A;  5HCM A;  2BYQ A;  4AFH A;  5AFH A;  2PGZ A;  2Y58 A;  5L47 A;  3UUB A;  4QH4 A;  5J5I A;  5CFB A;  1OED B;  2ZJV A;  4PIR A;  4ZR6 A;  5J5G A;  5SYO A;  2XQ6 A;  4QAC A;  2XQ7 A;  3WTH A;  5BW2 A;  4BFQ A;  2Y56 A;  5HEG A;  3WTO A;  3PMZ A;  4AFT A;  2VL0 A;  2XNU A;  3EAM A;  4TWF A;  3T4M A;  5KZU A;  2BG9 A;  3WTN A;  2BR7 A;  4LML A;  2BYR A;  3WTM A;  4IRE A;  2XNV A;  5KE4 A;  5IUX A;  3C84 A;  5LXB A;  1UV6 A;  2XZ5 A;  4NZB A;  4QAA A;  3U8J A;  3U8L A;  4UM1 A;  2M6I A;  2WNC A;  2W8F A;  3PEO A;  5HCJ A;  3RHW A;  3U8K A;  3WIP A;  5J0Z A;  2BG9 E;  4TWH A;  3TLT A;  2KSR A;  3UU5 A;  3RIA A;  3ZDG A;  5AFK A;  4HQP A;  5J5H A;  4HFH A;  4ZZC A;  4ILB A;  3ZKR A;  2ZJU A;  4HFD A;  5CO5 A;  4ZJS A;  5HEJ A;  2X00 D;  4UXU A;  3P50 A;  2XQ4 A;  2PH9 A;  4WV9 A;  3TLW A;  2BG9 C;  2LKH A;  4ZJT A;  4LMJ A;  5HEH A;  4QH1 A;  2BG9 B;  2YME A;  4ZZB A;  2Y57 A;  5JME A;  2XNT A;  2YKS A;  3IGQ A;  4DBM A;  3UU8 A;  4UY2 A;  4QH5 A;  5TVC A;  4B5D A;  2XQ5 A;  5HEU A;  3RIF A;  4HFE A;  4IL4 A;  2XYS A;  4X5T A;  2XQ9 A;  2WNL A;  2WN9 A;  3RI5 A;  3UQ4 A;  1UX2 A;  3SH1 A;  4TNW A;  4ZK1 A;  3RQU A;  2QC1 B; 
#chains in the Genus database with same CATH topology
 5LNK A;  1D1C A;  4Q25 A;  3PJA J;  3RRW A;  3AEC A;  5FYM A;  4B3M T;  3UU4 A;  4YXD A;  4FI5 A;  4X65 T;  1SUM B;  3NKZ A;  3PUV F;  4YJ3 E;  1MMN A;  3KVA A;  5AQQ B;  5CB4 E;  3KDS E;  3O1I A;  2XZ6 A;  5L4E A;  4TNV A;  5JDL A;  2YMD A;  3MKD A;  2X66 A;  5BR8 T;  4UM3 P;  3PUQ A;  3AA1 B;  2NW9 A;  2WDR A;  3N9L A;  3ONJ A;  4HFV A;  2WAU A;  4PK6 A;  4ZS2 A;  4GIW A;  3WTH A;  4YHJ A;  1IBL T;  3PMZ A;  2I0M A;  4YLH A;  1W9R A;  4JV5 T;  5AQP B;  2Z6E A;  5JDF A;  5FVL A;  2W61 A;  3U3I A;  2WQY A;  5LG4 A;  1MMD A;  3DTO A;  4AI6 A;  5AFK A;  3O1J A;  5CA1 E;  4PFP A;  3CX6 B;  4ISS A;  2XQ4 A;  3TLW A;  4ZJT A;  3OYX A;  4QWN B;  4ZZB A;  3AB3 B;  3EDV A;  3UFG A;  4GK0 E;  3H3M A;  1BR2 A;  4B5D A;  3ZT7 A;  4X5T A;  2XQ9 A;  2LSJ A;  1WRD A;  3PJA A;  2E9X D;  5LYJ E;  2V7J A;  2YU1 A;  3IHR A;  2N1G A;  2X67 A;  1HF8 A;  1HG5 A;  3JAD A;  2IUB A;  2ACX A;  3WTJ A;  3SOL A;  3BK9 A;  3AAA B;  2CLY B;  2IHR 1;  2CA5 A;  2R6G F;  3QB5 A;  3KFW X;  4U33 A;  2BS3 A;  2UZ6 A;  1WYC A;  4COF A;  2WP9 A;  4HWF A;  2H3R A;  2NW7 A;  2LLY A;  2BZB A;  2XM1 A;  2QVA A;  3RIU C;  4AFH A;  5AFH A;  1YD8 G;  2W67 A;  5L47 A;  5J5I A;  1M62 A;  3FBZ A;  4BFQ A;  5J2T E;  4JI0 T;  1WCR A;  2CEA A;  4P09 A;  2CHN A;  1D1B A;  2RP4 A;  3U8J A;  3ZN0 B;  2X0Y A;  2XQY A;  2BG9 E;  5FY7 A;  4HQP A;  3VKG A;  1Z0P A;  2LHN A;  3PE0 A;  3LK4 2;  4Z8X A;  3UUL A;  4ANJ A;  2NWB A;  1LVK A;  2XY8 B;  5C2T A;  2BDE A;  5AQM B;  2D5U A;  3AVR A;  4CXW A;  2OA5 A;  5ABG A;  1H7C A;  4DV1 T;  3ZC1 A;  2QC1 B;  2V6X A;  3WTI A;  1D0X A;  2L3L A;  2PFV A;  3AVS A;  4TN7 B;  3E08 A;  3LSV A;  3RPU A;  2WS3 A;  2HH7 A;  4I0U A;  2RPA A;  5AQL B;  2X9Y A;  5LGU B;  3PUW F;  1UX4 A;  2IIU A;  5EK4 A;  1E7P A;  2JQK A;  2V6Y B;  5C8Y E;  3A5X A;  1IJ5 A;  5LJN A;  2BVM A;  2N2N A;  1HCI A;  2WNJ A;  1OED E;  5TAO A;  2PG8 A;  3TLU A;  5AFJ A;  2L8K A;  2J47 A;  3ZMZ B;  1VCS A;  4I50 E;  2VL8 A;  4K0U A;  3NZP A;  2PGZ A;  2I6H A;  4EZH A;  2QA7 A;  4DND A;  3N9Q A;  3GMI A;  3CK6 A;  3H37 A;  4PJL A;  1T7S A;  2UUC T;  4UM1 A;  3V5U A;  5AQT B;  2BKN A;  1FJG T;  2VQF T;  2Q9Q D;  4DR4 T;  3Q5D A;  4HFD A;  1D0Y A;  2V5D A;  2X00 D;  1E1H B;  3ETU A;  4ZXL A;  2XHE B;  3M3Z B;  2XAJ B;  2LSI A;  5FVK A;  4EYY R;  5JVD E;  3S4U A;  1W0A A;  1W09 A;  3ZC0 A;  4QAB A;  2OLT A;  5H6R B;  2NTY A;  5L4H A;  3RYC E;  3T1H T;  2Y6X A;  4NUV A;  2XQA A;  2WY2 A;  4UR9 A;  4DV0 T;  2A72 A;  3N2K E;  3K3O A;  4FRR A;  2PTF A;  4PNI A;  3JAE A;  4U74 A;  5AQF B;  5AFM B;  2CCQ A;  3WTL A;  4PW8 A;  4TX5 A;  1NEN A;  2HHH T;  1MNE A;  4HE8 A;  4IDN A;  4QH4 A;  2WB5 A;  4M1P A;  4HWH A;  2E9X C;  2IC9 A;  1N32 T;  5KZU A;  3CML A;  3M65 A;  4JI7 T;  4YJ2 E;  4CQI A;  2XUE A;  4CZZ B;  3AAI A;  2WCA A;  4X1Y E;  4EB6 E;  5IWA T;  3ONL C;  4AIS A;  3U8L A;  1QLB A;  4AXP A;  3ZPO A;  3WIP A;  2CXL A;  1U5P A;  5KXJ A;  4LFB T;  3QB5 K;  4NXN T;  2H7O A;  1WLX A;  5LHI B;  4DVD A;  4X66 T;  2LSG A;  2E9X B;  1CHU A;  5ABH A;  5L3D B;  3RYF E;  4BJN A;  3PUX F;  3AE8 A;  4EED A;  1FEW A;  2NP9 A;  1BR0 A;  1M7K A;  4IL4 A;  2X68 A;  1XNQ T;  3ANW B;  4DUY T;  3AEB A;  4UXN B;  4X62 T;  2E5V A;  4ILA A;  5ABE A;  2KND A;  3SQ6 A;  3FXE B;  2W0G A;  1UX5 A;  2CBJ A;  4A97 A;  2YEV C;  2ODU A;  4NUU A;  1QUU A;  2JIW A;  1OWA A;  2NTX A;  3EDU A;  3QNU A;  2VK9 A;  2MYS A;  3P4P A;  2WM9 A;  2AE9 A;  4HFI A;  4LF4 T;  4ZI3 D;  1KNP A;  5FXZ A;  2VKO A;  4XHE A;  5HWX A;  4LFA T;  3RIU A;  5LOV E;  3U78 A;  2VKD A;  3UUB A;  2XQ6 A;  1HNX T;  2IML A;  3I0Q A;  5ADX L;  5DQW A;  1MND A;  3GN5 B;  3KV6 A;  2XNU A;  4TWF A;  2YK0 A;  4GYR A;  2W62 A;  2XZ5 A;  4NZB A;  3JC6 C;  3DP7 A;  3F2E A;  3RX6 A;  2JRK A;  3U8K A;  4JI4 T;  3AE4 A;  3TLT A;  3OYZ A;  3RIA A;  4H9S E;  3CX8 B;  2YIN A;  4AKH A;  3AE6 A;  4OYK A;  3N2G E;  4X1I E;  3AE3 A;  2C5J A;  4U72 A;  4MFR A;  3P7I A;  2V6Y A;  2WWU A;  4CN1 A;  4HWD A;  5LCY A;  4TNW A;  4IDZ A;  1T8B A;  4IIJ E;  2YDR A;  4TZ4 C;  5FXV A;  4BQT A;  3DJB A;  3GUA A;  3ZJ1 A;  1IAP A;  3B57 A;  5H6Q B;  3KIN B;  3K1S A;  5AIN A;  2ZMA A;  2ZM0 A;  4A98 A;  3CX7 B;  3LK2 B;  1VRB A;  2BS4 A;  2Q9Q C;  3X1D A;  3ZLI A;  3PU3 A;  4UF0 B;  2YN6 A;  3EUH A;  3AEG A;  2ACZ A;  2WZY A;  3KBT A;  3FZK B;  1HNZ T;  1ZEE A;  4DUZ T;  2KT9 A;  1HR0 T;  3FBL A;  3U8M A;  5A1L A;  1ZV4 X;  4ZK4 A;  4DBR A;  3WAJ A;  4PK5 A;  2X0L B;  1SE7 A;  4X64 T;  2QRX A;  4HWC A;  1XMO T;  5AQV B;  5AQS B;  1XNR T;  2Q9Q B;  3BQK A;  2RA1 A;  4DR1 T;  2J1D G;  5HXE A;  3PUZ F;  3UTK A;  5AQG B;  3I1A A;  4QAA A;  3RH3 A;  2JPF A;  1SA0 E;  2E8I A;  2WDQ A;  1XMQ T;  2W8F A;  4BAY B;  4IDO A;  1XZY A;  2WBL A;  5JR9 C;  3VRB A;  2YU2 A;  2XJ7 A;  4QXB B;  2VKJ A;  1CUN A;  5HEJ A;  3A7M A;  4WBO A;  2LT3 A;  2LOS A;  5HEH A;  2XNT A;  1D0Z A;  1WYB A;  4E7S A;  2JJ9 A;  2W4X A;  2XTL A;  4YTM A;  3AXJ B;  1WFD A;  5FKY A;  3O9X A;  3VKH A;  4HEA A;  3RRC A;  5JR9 B;  4AKI A;  2WZH A;  4YT0 A;  2A3D A;  5AFM A;  3OBV E;  3RF1 A;  4WNK A;  3J9X 1;  2C0S A;  2MAW A;  2IW5 B;  1XDO A;  3SRZ A;  2Y7Y A;  4O4J E;  2CLY C;  5C3J A;  5HYA A;  3LG7 A;  4N78 D;  3C4W A;  1LKX A;  3ZYL A;  4EGW A;  4MLK A;  3AE7 A;  5IHY A;  5FP3 A;  4TV8 E;  2UXB T;  2LM2 A;  5BP0 A;  4O4I E;  5KDM C;  3UUX B;  4QXC B;  3ZT6 A;  3AEF A;  5AQH B;  4DR5 T;  2BYS A;  1MIY A;  4JBW F;  1HX1 B;  2E9X A;  3H3A A;  2BBH A;  3J7Y q;  1FIO A;  2K3W A;  4I55 E;  2VL0 A;  2ES0 A;  4LML A;  1MIW A;  4UVC B;  2M67 A;  3ZJ2 A;  5LXB A;  3AE1 A;  2M6I A;  1Y64 B;  3TKL B;  4DR2 T;  2EHO D;  2HN2 A;  4C91 A;  3RC3 A;  4ILB A;  4YSX A;  2XM2 A;  3EVY A;  2PH9 A;  1UUS A;  2YME A;  4ZI3 C;  2CPT A;  2DL1 A;  1YQ4 A;  5TVC A;  4U2Z A;  1JNR A;  1ZP0 A;  1US7 B;  4KBM B;  3I9Y A;  5LG3 A;  4O8S A;  1N34 T;  5L3B B;  3OKQ A;  2XQ8 A;  3AE5 A;  5L3C B;  2CWY A;  3WTK A;  1KK7 A;  3P4R A;  3ZMT B;  4LMK A;  3HKC E;  2X9W A;  2JMK A;  3QK6 A;  1YQ3 A;  2CHO A;  3UU6 A;  3C79 A;  5CA0 E;  4F8H A;  4YFS A;  3F57 A;  2UU9 T;  3ZDH A;  2CXD A;  2LKG A;  3B5M A;  4JEU B;  2UXC T;  5FJV A;  3GN5 A;  2J62 A;  4I43 B;  5LBQ B;  2HPJ A;  4UM3 A;  2WU5 A;  3HR0 A;  4KUM B;  5AQU B;  2E5L T;  3PUR A;  3LJC A;  4ZR6 A;  2ZJV A;  3IEE A;  3CQC B;  1YXR A;  3PUY F;  3ESL A;  2LE8 A;  3F31 A;  2BR7 A;  2UXN B;  5KE4 A;  2BKO A;  4QX8 B;  2LRL A;  4JI3 T;  2WNC A;  5L3E B;  4P0A A;  2PBI A;  2IAK A;  3ZDG A;  5CO5 A;  2MBG A;  5JDM A;  1MMA A;  1V9D A;  4UXU A;  4G2A A;  4ZI2 D;  4ZHQ E;  3Q9D A;  5J2U E;  1Y01 A;  4GK5 E;  4TV9 E;  4P1N A;  4UF0 A;  4O4L E;  3KV9 A;  2DHR A;  4UM3 S;  3VRA A;  3UU3 A;  1KNR A;  4Z91 A;  3L3P A;  2JQH A;  4LF6 T;  1SHZ C;  1FMW A;  2WU2 A;  3N5L A;  4XAX B;  4B6X A;  3P4Q A;  3UFE A;  2Q9Q A;  4TWD A;  4ZI7 E;  4BJM A;  1BR1 A;  1MMG A;  4GOU A;  2WDV A;  3UQ7 A;  2K24 A;  2X00 A;  4IST A;  3PU8 A;  2BJ0 A;  5LXT E;  2Y54 A;  5HCM A;  3MK7 C;  2DNX A;  2V7K A;  4G63 A;  1ZKE A;  3SFE A;  2X9H A;  2XAG B;  3KV4 A;  3EAM A;  3HKE E;  3AAE B;  3A8Y C;  2X9X A;  3OVU A;  3ZN1 B;  2C5I T;  5JTG A;  4MBQ A;  3VU7 H;  1KFY A;  1I6Z A;  4IE4 A;  3AXJ A;  4QHO A;  5JR9 A;  2XAS B;  3VR9 A;  3CVR A;  3ONX A;  5KX5 E;  4EZ4 A;  5LGT B;  3C50 A;  4V1A v;  2JMH A;  2BG9 B;  4PK4 A;  2KWH A;  4H63 H;  3UU8 A;  2V7I A;  5FL0 A;  3K8P C;  2XYS A;  2BKP A;  4O2A E;  3UQ4 A;  4CN6 A;  4IDP A;  2DLR A;  2W2U A;  5FNV E;  3JAF A;  4NIQ A;  3P4W A;  5JDQ A;  5F3J A;  1OED C;  4PJJ A;  2DI4 A;  2CBI A;  2JQQ A;  3N9M A;  3FZH B;  4AQY T;  1L0V A;  2EHO C;  3ABV A;  3GWH A;  3NVO A;  4IE6 A;  4UV9 B;  3SIO A;  3NBX X;  4WW0 A;  1BR4 A;  4DO0 A;  1LRZ A;  2V26 A;  2LM9 A;  3ZEF B;  3PUG A;  4IE0 A;  4GYS A;  1UCU A;  5FMN A;  4KHP T;  3QC9 A;  5LA6 E;  1OED B;  4PIR A;  5CGM A;  4QAC A;  3ZYK A;  2Y56 A;  2EHO B;  2NR4 A;  3WTN A;  1EZ3 A;  4EYU A;  3MZK B;  4B3T T;  3BQL A;  3GA8 A;  2K5B B;  2H88 A;  2A9U A;  5J0Z A;  4IGU A;  4A56 A;  3R84 B;  5LJM A;  3FZM B;  5F8P A;  3CIR A;  5CJ5 A;  2N9D A;  4U7Y A;  3RC8 A;  5HXH A;  5AFU L;  3ZMU B;  4LMJ A;  3LBX B;  2XZE A;  4AQF C;  5JME A;  3Q5X A;  4LF9 T;  1N33 T;  3N9O A;  4LF8 T;  3W15 B;  4OFZ A;  5HXC A;  4NPP A;  2BS2 A;  2UUA T;  2VQE T;  4X1K E;  1WR6 A;  5L2L A;  3LFM A;  5LGN B;  5JRE A;  2OV9 A;  2FJD A;  5FXX A;  4HKA A;  1S94 A;  4YHH T;  4CI3 B;  2LSY A;  2WMN A;  3ZCJ A;  2BYN A;  4H63 V;  3C64 A;  3UT5 E;  4XBF B;  5GON E;  1HNW T;  4O2B E;  2Y48 B;  3RQW A;  2ODV A;  5E0O A;  2VKH A;  4ZI2 C;  2YDQ A;  2P9B A;  4JI8 T;  3RKG A;  5HXR A;  2LOP A;  3IA3 A;  4EEB A;  1YW0 A;  5CFB A;  1HG2 A;  3AA6 B;  2CXF A;  2J4G A;  2QYW A;  3WTO A;  2X51 A;  3KBU A;  4WBN E;  3ZT5 A;  4ERR A;  4L9I A;  5IUX A;  3VR8 A;  2LJL A;  3RLF F;  5ETW A;  3RHW A;  2SPC A;  3ZMS B;  4CXY A;  2XAQ B;  2KSR A;  1MIV A;  2D9D A;  3NRX A;  3RYH E;  4DV4 T;  4KX6 A;  2KXP B;  1O3X A;  3MA9 A;  3AA0 B;  1J5E T;  2BBJ A;  3CKD A;  3L09 A;  4OX9 T;  2WN9 A;  2GK9 A;  4TUY E;  4CN4 A;  3HI2 A;  2BYP A;  3EHZ A;  3PDY A;  2K9A A;  4MHC A;  4CI2 B;  4JUY A;  5JDN A;  3PUS A;  2Y8D A;  2VVS A;  4IL9 A;  2LSK A;  5M4Y A;  4YSY A;  4U31 A;  2FUP A;  1UW6 A;  2MPK A;  4EZ1 A;  5AFL A;  2W00 A;  4O4H E;  4OHF A;  2UXX B;  4Z90 A;  3NRY A;  4AIU A;  1VCT A;  3SQ9 A;  2XPK A;  2W63 A;  5HEO A;  2BVL A;  4KHZ F;  4ZEY A;  4J2C A;  3O1H A;  3OJA A;  4ILU A;  4AQG A;  4EV6 A;  4ALX A;  3NZQ A;  2M6B A;  3FZF B;  4OK0 A;  2VAS A;  3AED A;  5AQR B;  2D2S A;  3KVB A;  1LVF A;  4AFT A;  5BMV E;  4IT4 A;  2BG9 A;  4B3R T;  4IRE A;  5EK3 A;  5FL1 A;  2I59 A;  3JCF A;  4GKJ T;  1UV6 A;  4DR3 T;  4HWI B;  1NWM X;  5AQK B;  4HFH A;  1NEK A;  2XSB A;  2ZJU A;  2FBW A;  5LP6 E;  4QXH B;  4JEH B;  2LKH A;  4DV2 T;  4JLE A;  2Y57 A;  3BQI A;  1UGO A;  4DMV A;  3P4S A;  4DBM A;  4UY2 A;  3Q5E A;  2XQ5 A;  2WNL A;  3ANW A;  2D0U A;  1Z8U A;  4ZK1 A;  2ZM2 A;  4DR6 T;  2KLQ A;  2KWI B;  4HGA A;  1IJ6 A;  4UVB B;  4CI1 B;  4YTP A;  2K48 A;  4ILC A;  2CM0 A;  3TLV A;  3Q2M A;  2WWV A;  1OED A;  4CXX A;  4EOZ B;  4ZRU A;  5J5F A;  5LMU T;  2EHO A;  4DV5 T;  3C4X A;  3T1Y T;  3EI0 A;  3ZCI A;  5LHG B;  3KV5 A;  4JI2 T;  4EXT A;  4K0K T;  2V5C A;  4L0R A;  3N9N A;  2L9Q A;  1N36 T;  5LMN T;  2HPL A;  4JI5 T;  4HFB A;  4JI1 T;  2B76 A;  2IC6 A;  2XQ7 A;  3FHN A;  4H9N C;  1GQE A;  5BW2 A;  3I0O A;  4H9Q C;  4KMC A;  3T4M A;  3LBX A;  1IBM T;  5FXW A;  3WTM A;  2XNV A;  2V7L A;  4HN9 A;  2W66 A;  4PFO A;  4AKR B;  5AQJ B;  2FJE A;  5HCJ A;  4WYV A;  3E0Z A;  2CWO A;  4ZZC A;  4H9P C;  5AQI B;  1X9B A;  4ASK A;  4ZJS A;  4OYJ A;  3WI3 A;  2V1D B;  3PTR B;  3P50 A;  5LHH B;  2G0U A;  2XAF B;  4QH1 A;  5EZY E;  4AQF A;  4DID B;  2MOZ A;  3JC6 D;  2YKS A;  5ABF B;  2UUB T;  5LBM A;  2KIN B;  3I9W A;  3RIF A;  2VB6 A;  3MJX A;  4H9O C;  5JDG A;  2WSS V;  1IBK T;  3AEA A;  4GKK T;  1I94 T;  1QSD A;  1T72 A;  4JYA T;  1I9B A;  4ZOL E;  4HFC A;  2X0H A;  1UK5 A;  1XWM A;  2LRK A;  5JRC B;  3U8N A;  2ZM8 A;  1ZHC A;  5BRX A;  5EK2 A;  4DBQ A;  3AA7 B;  1B7T A;  1W0B A;  1VOM A;  1HX8 A;  2CE7 A;  1AJ3 A;  4AFG A;  3OPC A;  2VVN A;  3EAB A;  4FJO A;  4UEL A;  3FXD B;  3ZMV B;  3E22 E;  3RYI E;  4X20 E;  3UUN A;  3SWH A;  2JQ9 A;  3R6N A;  2KMF A;  4BA9 A;  5J5G A;  5SYO A;  2B1E A;  2CMR A;  1U4Q A;  1XDP A;  2DWK A;  2MTQ A;  4DV7 T;  3CPZ A;  3RGL A;  4HTE A;  4H9R C;  3C84 A;  2ZM6 T;  2VUR A;  2KZ7 B;  3MAC A;  3QUJ A;  3HKB E;  1G8X A;  3D0T A;  4AKL A;  3IBP A;  3UU5 A;  4WZX A;  2DWG A;  1G73 A;  4XZC A;  4QX7 B;  3N9P A;  3O4X E;  1YKH B;  4WV9 A;  2BG9 C;  3K3Q C;  2VWA A;  3IGQ A;  2FJA A;  2IDO B;  2ZLY A;  3N2O A;  3SH1 A;  4DR7 T;  5KMG P;  5LB7 B;  4C90 A;  3NWI A;  4ADZ A;  3HKD E;  1KEY A;  2W8G A;  4JI6 T;  2DCF A;  2QGS A;  3CWZ B;  3LDQ B;  4D01 A;  3K3N A;  4UIG A;  1HFA A;  2C5K T;  4NXM T;  3IF8 B;  4L5G A;  2XAH B;  2XYT A;  5AQN B;  3C98 B;  2C9T A;  2A2F X;  2WZI A;  4P0B A;  2H7V C;  2NW8 A;  3L8R A;  4E7Z A;  4KI0 F;  1ZOY A;  4IE7 A;  3TLS A;  4A5X A;  5HXS A;  3FB2 A;  2AXD S;  1T98 A;  2BYQ A;  4IHJ E;  2Y58 A;  5HAX A;  3AE2 A;  5HWY A;  3G06 A;  1KNZ A;  5HEG A;  2YDS A;  3OTO T;  5FY0 A;  3ZSS A;  5L3G B;  2FJB A;  3B13 A;  3RKO A;  1UUR A;  2V7M A;  3ZST A;  2XSA A;  1IZN B;  4LF7 T;  1YKE B;  4PJM A;  4B3S T;  3PEO A;  3AE9 A;  4LF5 T;  3ETV A;  3MXZ A;  5J5H A;  3SFD A;  1HTJ F;  1KF6 A;  5J1G A;  3Q5W A;  1J1J A;  3V5S A;  4U7I A;  4F6R C;  3AEE A;  3VHL A;  4YSZ A;  3SS1 A;  4QH5 A;  2NOX A;  2H89 A;  4ZS3 A;  5F5W A;  1E2A A;  3C51 A;  1UX2 A;  3RQU A;  5JDH A;  5DQV A;  3CQG B;  3PV0 F;  5AFN A;  3FZL B;  4UVA B;  2BR8 A;  3QOF A;  5DAB A;  5JQG E;  3T8O A;  2XQ3 A;  2UXD T;  3C4Z A;  2YOE A;  2LHR A;  1DU2 A;  4U2Y A;  4KP3 C;  4QKN A;  1S35 A;  2D0T A;  3ZYM A;  4AKG A;  3UUM A;  4IE5 A;  5DJQ C;  5L3F B;  4YTN A;  2E2A A;  4UV8 B;  4YY3 T;  3HL6 A;  1D1A A;  4XK9 A;  3LK3 B;  4PJN A;  1WR0 A;  2HN1 A;  4PAG A;  1NAF A;  4DMW A;  2LEH A;  1OXZ A;  5JH7 E;  3CQX C;  2BYR A;  5ABF A;  3WAK A;  1JNZ A;  3PUA A;  5AQO B;  4EIW A;  1FMV A;  1R8I A;  5IYZ E;  2CRB A;  2F4V T;  4MAL A;  4U3C A;  3HA4 A;  4TWH A;  1X79 A;  5FY1 A;  4LFC T;  1J5W A;  1HS7 A;  3ZKR A;  2V8S V;  3L39 A;  4EAH A;  4DV3 T;  5JRC A;  3P8C D;  2PJQ A;  5HEU A;  4I4T E;  4HFE A;  4IDQ A;  2WMO A;  3RI5 A;  4UEM A;  4DV6 T; 
#chains in the Genus database with same CATH homology
 2BYP A;  3EHZ A;  4UM3 S;  3WTI A;  4ILA A;  4QAB A;  5AFM A;  4BQT A;  2XQ8 A;  5AFN A;  3JAF A;  3UU3 A;  4Z91 A;  3UU4 A;  3SQ6 A;  2W8G A;  4IL9 A;  3GUA A;  4ILC A;  3P4W A;  3WTK A;  3LSV A;  4LMK A;  1I9B A;  2MAW A;  3TLV A;  3JAD A;  2BR8 A;  4HFC A;  1UW6 A;  5LG3 A;  2Y7Y A;  3WTJ A;  5L4H A;  4EZ1 A;  5AFL A;  4D01 A;  4A97 A;  1OED A;  2XQA A;  1OED C;  4Z90 A;  3UU6 A;  3C79 A;  4ZRU A;  3U8N A;  5AIN A;  4F8H A;  2XQ3 A;  3ZDH A;  2XZ6 A;  5J5F A;  2BYN A;  3SQ9 A;  2LKG A;  2XYT A;  4A98 A;  4NPP A;  5FJV A;  5BRX A;  4TWD A;  2YOE A;  5L4E A;  4TNV A;  2UZ6 A;  2C9T A;  3EI0 A;  5HEO A;  4FRR A;  2YN6 A;  4UM3 A;  2YMD A;  2LM2 A;  4COF A;  3SIO A;  3JAE A;  3UQ7 A;  5BP0 A;  4AFG A;  2WZY A;  2WNJ A;  1OED E;  2X00 A;  5AFM B;  2LLY A;  2BJ0 A;  3TLU A;  4HFI A;  5AFJ A;  3RQW A;  4UM3 P;  3TLS A;  3WTL A;  4ALX A;  2M6B A;  4HFB A;  3U8M A;  2BYS A;  2Y54 A;  4XK9 A;  4ZK4 A;  4XHE A;  5HCM A;  2BYQ A;  4AFH A;  5AFH A;  2PGZ A;  2Y58 A;  5L47 A;  3UUB A;  4QH4 A;  5J5I A;  5CFB A;  1OED B;  2ZJV A;  4PIR A;  4ZR6 A;  5J5G A;  5SYO A;  2XQ6 A;  4QAC A;  2XQ7 A;  3WTH A;  5BW2 A;  4BFQ A;  2Y56 A;  5HEG A;  3WTO A;  3PMZ A;  4AFT A;  2VL0 A;  2XNU A;  3EAM A;  4TWF A;  3T4M A;  5KZU A;  2BG9 A;  3WTN A;  2BR7 A;  4LML A;  2BYR A;  3WTM A;  4IRE A;  2XNV A;  5KE4 A;  5IUX A;  3C84 A;  5LXB A;  1UV6 A;  2XZ5 A;  4NZB A;  4QAA A;  3U8J A;  3U8L A;  4UM1 A;  2M6I A;  2WNC A;  2W8F A;  3PEO A;  5HCJ A;  3RHW A;  3U8K A;  3WIP A;  5J0Z A;  2BG9 E;  4TWH A;  3TLT A;  2KSR A;  3UU5 A;  3RIA A;  3ZDG A;  5AFK A;  4HQP A;  5J5H A;  4HFH A;  4ZZC A;  4ILB A;  3ZKR A;  2ZJU A;  4HFD A;  5CO5 A;  4ZJS A;  5HEJ A;  2X00 D;  4UXU A;  3P50 A;  2XQ4 A;  2PH9 A;  4WV9 A;  3TLW A;  2BG9 C;  2LKH A;  4ZJT A;  4LMJ A;  5HEH A;  4QH1 A;  2BG9 B;  2YME A;  4ZZB A;  2Y57 A;  5JME A;  2XNT A;  2YKS A;  3IGQ A;  4DBM A;  3UU8 A;  4UY2 A;  4QH5 A;  5TVC A;  4B5D A;  2XQ5 A;  5HEU A;  3RIF A;  4HFE A;  4IL4 A;  2XYS A;  4X5T A;  2XQ9 A;  2WNL A;  2WN9 A;  3RI5 A;  3UQ4 A;  1UX2 A;  3SH1 A;  4TNW A;  4ZK1 A;  3RQU A;  2QC1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...