2XQAA

Pentameric ligand gated ion channel glic in complex with tetrabutylantimony (tbsb)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 73
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xqaA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xqaA01
5HEJA 3U8JA 3UU4A 4HFCA 5AFLA 5HEUA 2ZJUA 3RI5A 5L4HA 3UUBA 1OEDC 2ZJVA 3RQWA 2BR7A 2BYNA 2X00D 1UW6A 5BP0A 2Y58A 3LSVA 2XQ3A 3ZKRA 4ZZCA 4XHEA 4X5TA 3UQ7A 2LKGA 3WIPA 1OEDA 3JADA 4ILBA 2W8FA 4LMLA 4HFDA 2BG9A 4AFHA 5HEGA 2VL0A 3RIFA 5HCMA 2WNCA 4ZR6A 3WTJA 5HCJA 4HFHA 5AFJA 2WNJA 4EZ1A 5J5FA 2BG9B 2XZ5A 4ZJSA 4NPPA 3SH1A 4HFEA 2YN6A 4HQPA 3U8KA 3WTMA 4UM3S 2UZ6A 4AFGA 4XK9A 3ZDGA 2MAWA 2W8GA 5J5IA 4Z91A 3TLWA 1I9BA 3GUAA 3EHZA 2XQ5A 2BR8A 3EI0A 4QH1A 4ZK4A 2YKSA 2BG9C 3U8LA 4DBMA 2WN9A 5BW2A 3PMZA 3RHWA 4AFTA 1UV6A 4IL4A 5CFBA 3RQUA 3WTKA 3WTNA 4A97A 4ZZBA 3EAMA 2YMDA 5HEHA 2LKHA 4WV9A 2PGZA 3SQ9A 2XQ6A 5KE4A 4LMJA 5HEOA 3WTLA 5LXBA 3WTHA 4TNVA 4ZJTA 2XQ4A 5FJVA 2BJ0A 5KZUA 2X00A 5AFMA 2Y54A 3WTOA 3UQ4A 2BYSA 4ALXA 2XQ7A 2XYSA 5AFMB 4QABA 4PIRA 2XNTA 3SQ6A 5L4EA 2WNLA 5J0ZA 2XNUA 3U8NA 2XQAA 3TLUA 4BFQA 2QC1B 1OEDE 4F8HA 3C84A 3WTIA 5AFNA 4IL9A 5AFHA 4LMKA 5JMEA 5J5GA 4UM3A 4B5DA 4ILCA 3P4WA 3UU5A 5IUXA 4QACA 3UU6A 3UU8A 2BYPA 2XQ8A 2Y57A 3C79A 4FRRA 4ZK1A 4ZRUA 5AFKA 2WZYA 4QH4A 4QH5A 3TLVA 5CO5A 5SYOA 3JAEA 4ILAA 5LG3A 4TWDA 4A98A 4COFA 2BYRA 3U8MA 2YOEA 3P50A 3ZDHA 3IGQA 4HFIA 4IREA 2XQ9A 2YMEA 2LM2A 4Z90A 4UM1A 2LLYA 2M6IA 5BRXA 5J5HA 4QAAA 3UU3A 4UM3P 2XNVA 3PEOA 4UXUA 5AINA 4NZBA 2Y7YA 3TLSA 2C9TA 2XZ6A 3SIOA 4TNWA 3RIAA 3TLTA 1OEDB 4TWHA 2BG9E 4HFBA 2XYTA 2M6BA 4TWFA 2PH9A 5TVCA 4D01A 3T4MA 1UX2A 2KSRA 3JAFA 4UY2A 4BQTA 5L47A 2BYQA 2Y56A
chains in the Genus database with same CATH superfamily
2LSGA 3PUVF 4OX9T 4YSXA 2K9AA 2VK9A 3CVRA 5AQNB 1XWMA 4IHJE 5AQSB 4TN7B 1D0YA 3C51A 3QUJA 1Y01A 4ZI2C 1HX1B 1MIWA 2YDQA 3N9MA 1W0AA 3PUAA 2A72A 3EUHA 4NPPA 3EVYA 2X9XA 5J5IA 3UFEA 5AQRB 3ZJ2A 2DWKA 1UURA 3BQKA 3ESLA 5IWAT 2ACXA 4UELA 4UVBB 1D1AA 2KMFA 2EHOB 1KNZA 1JNRA 2BZBA 3N9PA 5KZUA 2X00A 2K48A 3PUYF 4OFZA 4ALXA 4DV6T 2BVLA 3LK3B 1QSDA 4QXHB 3AE6A 3ZT6A 3J9X1 5J0ZA 4LF6T 2IIUA 3PU8A 5J5GA 3U3IA 2WDRA 3I9WA 1HX8A 3C4ZA 4JV5T 3SFDA 3OKQA 3K8PC 3TLVA 2CA5A 5LG3A 2YOEA 2NTYA 5JTGA 3TKLB 5HXHA 2XNVA 3PEOA 4EIWA 5JR9C 4YHHT 3MA9A 3SIOA 1IBKT 4TWHA 4HWDA 5JRCB 3FZHB 1ZV4X 5JR9A 5CA0E 2MTQA 4JLEA 1MMNA 1D0ZA 3ZCJA 4ZEYA 2XQ3A 2DLRA 1UK5A 4HWIB 4HFDA 2VL0A 4DV3T 2UUCT 5HCJA 4QXBB 3WAKA 2BS2A 2IW5B 2UUBT 2F4VT 3EI0A 5LHIB 1UV6A 4IL4A 3F57A 2QGSA 1ZOYA 2IC9A 3PURA 1OWAA 2UXNB 2WAUA 2Y48B 4HWCA 3KBTA 5FMNA 5EZYE 2JMKA 1H7CA 5JDHA 3RRWA 1MIYA 4DR3T 5AQMB 4HKAA 3PJAJ 2WWVA 4TUYE 5J2UE 4ZRUA 5AFKA 2BBHA 3I0QA 1HG5A 4DR1T 1KNPA 5FNVE 3ZDHA 1KFYA 3IGQA 4U74A 4BAYB 4I50E 4WBNE 4GIWA 5HWYA 2ZM2A 1HFAA 2XYTA 1S35A 2V26A 4UY2A 5L47A 2FUPA 2B1EA 1MMGA 5FY1A 2Y56A 4JBWF 4YY3T 3ONXA 4DBQA 3FZLB 5FL0A 1OEDC 2WY2A 3ZKRA 2YINA 4DV0T 1EZ3A 2LKGA 1OEDA 1IZNB 3UUXB 3WTMA 2MYSA 3ZDGA 1U5PA 2KLQA 4IT4A 3HI2A 3CX8B 2WSSV 3RQUA 3WTNA 3EAMA 3JCFA 2YMDA 2AXDS 2V7IA 5J1GA 4JI2T 2LRKA 3O1IA 4BJNA 5AFMA 4ZS3A 5ABEA 2DWGA 3ZYLA 1WRDA 2WP9A 5AFHA 3RYIE 4H9PC 1HF8A 4LMKA 5IHYA 3A7MA 4CQIA 2BS3A 3C79A 4FRRA 2DI4A 4H9SE 2E9XC 3P4QA 1VCTA 1BR4A 4B3MT 5J5HA 4QAAA 3UU3A 3ZC0A 4YT0A 4NZBA 3PJAA 2D0TA 3TLSA 2CEAA 3AEAA 4TWFA 3PUXF 4DV4T 4AI6A 3U8JA 5HWXA 1Z0PA 5FXZA 4MALA 4OYKA 2BR7A 4H9QC 2NP9A 3WIPA 5JDNA 3AEDA 2MOZA 3ANWB 2LOPA 5AFJA 3HR0A 5BR8T 5DJQC 3WI3A 4LF8T 1YXRA 3EHZA 2BR8A 4MLKA 2BG9C 3U8LA 2XAGB 4AFTA 3AAIA 3QOFA 4AXPA 3M3ZB 4CI2B 3MZKB 2WZHA 5AQQB 3AVSA 2IUBA 5CJ5A 3AAEB 2YK0A 3AA0B 4GK5E 2XNTA 2WNLA 4YFSA 4U31A 5AQHB 4PJNA 2JPFA 2QYWA 5AQTB 2A3DA 2X68A 5CA1E 1N32T 3IA3A 4DO0A 4AQFC 2W67A 3LG7A 2NR4A 2NOXA 3V5SA 2XAHB 2LLYA 3ZC1A 2XJ7A 2KXPB 4AQFA 4DV1T 3QC9A 4UVAB 4IE5A 1LRZA 3VRBA 3MJXA 5ABFA 2LSKA 2J4GA 3T4MA 4Q25A 3HKBE 2XAJB 3AB3B 3BK9A 5JVDE 2X0YA 3O4XE 4GKJT 2V5CA 5BP0A 4IDPA 4E7ZA 4JI6T 2XM2A 4IIJE 5F5WA 4JYAT 3B5MA 4AKLA 3C50A 1IBMT 3SH1A 3P4SA 5ADXL 3UT5E 1MMDA 2W66A 4LF4T 2MAWA 2HPJA 3NVOA 4AIUA 1G73A 3FZMB 1I9BA 3GUAA 2D0UA 2YDRA 2WS3A 5BMVE 2LOSA 3V5UA 4DVDA 2V6YB 2EHOA 4TX5A 4HN9A 3CQXC 3SQ9A 2XAFB 3WTLA 3WTHA 4TNVA 3P4RA 4U2YA 2WB5A 4HWHA 4EAHA 3OYZA 2X0LB 1J1JA 3HL6A 2JJ9A 5FXWA 3P4PA 2VURA 3CX6B 4QHOA 1FMWA 3ZPOA 2Q9QD 2Y57A 1BR2A 1BR1A 1NWMX 5LBQB 1I6ZA 5LHGB 4U72A 4ILUA 5FL1A 1L0VA 2KWHA 3OTOT 2AE9A 2JRKA 5JRCA 5KMGP 5HEJA 5AQOB 4ZXLA 2YU1A 2L8KA 2SPCA 1AJ3A 2VB6A 5M4YA 4X5TA 2W4XA 3JADA 2PFVA 4X65T 4YTPA 2ZM6T 2XASB 3ZMVB 4HQPA 2E5LT 3OJAA 1Z8UA 1SUMB 3RC8A 3GMIA 1SE7A 2LSJA 4JI1T 2HHHT 3PMZA 2GK9A 1ZKEA 4A5XA 1WFDA 4X66T 5HEHA 5HXCA 1HCIA 4UIGA 4DUZT 4DNDA 3VR9A 4WBOA 2KT9A 3RKOA 4DV2T 2NWBA 2MPKA 1T8BA 4F8HA 4EYYR 5JMEA 1XZYA 3ONLC 3UU8A 5FY0A 2VQET 3HKDE 5SYOA 3RGLA 5LB7B 2I0MA 1IJ5A 5L3CB 5H6RB 5L2LA 5LJMA 2WDVA 2CXLA 2XZ6A 1OXZA 2PH9A 5KXJA 5TVCA 3Q5WA 1J5WA 4I0UA 4IDQA 4X64T 2BKPA 4L9IA 1X9BA 4DR7T 5DABA 4OK0A 1UW6A 1UGOA 4B3ST 3T1HT 4DMVA 1FJGT 2NW8A 3M65A 2WBLA 2Z6EA 3ZSSA 3UQ7A 4X20E 4PJMA 4X1IE 5EK3A 2WNCA 4V1Av 2N9DA 3Q5XA 3WAJA 2XAQB 2ODVA 4PJJA 4EGWA 4PK6A 1MNDA 1CUNA 2BS4A 1LKXA 3P7IA 2KINB 2PJQA 4YLHA 4KX6A 4CZZB 4B3RT 4IGUA 3N2KE 2X66A 1JNZA 2XQ6A 5AQUB 5KE4A 4X1KE 1YQ4A 2WM9A 3FB2A 3SWHA 3UQ4A 5LXTE 4PIRA 3RF1A 3SRZA 3X1DA 3CKDA 3TLUA 2V7MA 4KUMB 2H7VC 2VVSA 4ZK1A 4GKKT 5JDGA 1B7TA 2BYRA 4TV9E 5JREA 4IREA 4UM1A 2CXFA 2CLYC 5AQKB 3PV0F 2LSYA 5DQVA 4NXNT 3T1YT 1Y64B 4TNWA 3Q2MA 3RIAA 2UXBT 2ZM0A 1D1CA 4DR2T 3I1AA 3PUWF 4D01A 1XMOT 2JMHA 4LFBT 2W0GA 2BYQA 4EZ1A 2W63A 4ZS2A 2CE7A 2ZJUA 3UUBA 2X9HA 3K1SA 3RIUA 4JI3T 2UXDT 2CWOA 3ANWA 4XHEA 1WLXA 2XZEA 3KVAA 4KMCA 1MMAA 3QB5K 3Q9DA 4XZCA 4UF0B 1N33T 2KNDA 3AE3A 4KHZF 3NRYA 4ASKA 3AECA 2YKSA 4G2AA 3KV4A 3CIRA 3MACA 4YXDA 4YTMA 3UUNA 2OLTA 2QRXA 1YW0A 2X51A 4NUUA 4YSYA 2PGZA 2DNXA 3KBUA 2CBJA 2WZIA 4K0KT 5FJVA 2VWAA 1I94T 5LYJE 2M67A 5L4EA 2CRBA 5AQGB 3C84A 3OVUA 5FXVA 3A8YC 4H63H 5JR9B 3VU7H 5CGMA 2FJBA 4QH5A 4YSZA 3ETUA 4HFIA 4HWFA 1XNQT 2ES0A 5AINA 2Y7YA 3ETVA 2IC6A 3TLTA 5JQGE 1HR0T 1YKHB 1LVKA 2BDEA 3VKHA 4YHJA 3LK42 3SS1A 4YTNA 2HPLA 4KBMB 2CCQA 4LFAT 3FHNA 3B57A 5J5FA 3WTJA 3AAAB 3AEEA 2V8SV 3DJBA 5EK2A 4HFEA 4UM3S 4UXNB 4AFGA 3FBLA 2JQ9A 1G8XA 3BQLA 2KWIB 4QH1A 3JC6D 3EDUA 3AA6B 3R6NA 2PTFA 2WQYA 4FJOA 1WR6A 1YKEB 4QKNA 3ZN0B 1QUUA 3ZMUB 4PK4A 1QLBA 1N34T 4ANJA 1HTJF 4ZJTA 3L09A 2XSAA 4QABA 2C5IT 3SQ6A 4ISSA 3U8NA 4BFQA 3ZMTB 1XMQT 4KI0F 2NTXA 4QACA 4O4IE 2LHRA 3Q5DA 2WZYA 3LBXB 3KINB 2PBIA 2XPKA 4P09A 1W0BA 1WYBA 4WW0A 1UX5A 5TAOA 4JEUB 4GOUA 4LF9T 3ZJ1A 1XDPA 2JQHA 4ZI3D 1OEDB 5LOVE 2V6XA 1M7KA 1J5ET 3RC3A 3UULA 3ZEFB 3L39A 2C5JA 4L0RA 3RI5A 1CHUA 2VKHA 3QB5A 3PTRB 4IE0A 3PUZF 3ZCIA 2Q9QC 4YJ3E 3KVBA 3AE8A 2E9XD 3FZFB 4PJLA 4OYJA 1US7B 2Q9QA 4UR9A 1FIOA 2YN6A 4F6RC 2G0UA 4ZHQE 2VVNA 2Y6XA 1N36T 5AQLB 2XQ5A 4ZK4A 1O3XA 2FBWA 2BKOA 4AQYT 4TZ4C 1GQEA 3IF8B 3ZLIA 2VKJA 2I6HA 2V7JA 4ZI7E 2XQ7A 3KV5A 3J7Yq 2EHOC 3GA8A 2KZ7B 1WYCA 1OEDE 2E9XB 5AFNA 1V9DA 1ZP0A 2YU2A 4BA9A 4PAGA 3PDYA 4EZ4A 4DUYT 3I9YA 2BBJA 3GWHA 2XM1A 4IE4A 4MHCA 2BKNA 4G63A 4EEDA 5LCYA 3CQCB 4XAXB 3A5XA 4ILAA 2CXDA 3QK6A 4IE6A 5H6QB 4EEBA 1HS7A 3K3QC 3ZN1B 3N2OA 4E7SA 2W61A 5A1LA 4QWNB 2UXXB 3UFGA 3CPZA 2V7LA 4MBQA 3ZYMA 3U78A 2DL1A 2WDQA 3H3MA 4P0BA 4EB6E 2QVAA 2XTLA 3RQWA 5FVLA 3OPCA 5HXEA 4MFRA 3LSVA 4U7IA 3PU3A 5F8PA 2LHNA 2WNJA 3PUSA 2BG9B 5LGNB 5DQWA 2A2FX 2K3WA 3IEEA 2LT3A 2WMNA 4C90A 4O2AE 4IDZA 4ZZBA 5EK4A 3CWZB 5HYAA 2N1GA 2E2AA 1VRBA 3G06A 3NZPA 4IDOA 1DU2A 4LFCT 2PG8A 2BYSA 1W09A 3AXJB 3PE0A 3Q5EA 4AKIA 2XNUA 3WTIA 2DHRA 2H89A 2ODUA 5CB4E 3LDQB 3UU6A 2XSBA 1HG2A 4U3CA 4QX8B 4QH4A 1BR0A 4H9RC 4K0UA 4Z90A 4ISTA 4U2ZA 4WZXA 2BG9E 4HFBA 4I55E 2E8IA 4QX7B 3JAFA 1MIVA 2V5DA 3ZMSB 4GYSA 1UUSA 3UU4A 3BQIA 5AFLA 4O4LE 5AQPB 1X79A 3CQGB 5J2TE 2Y58A 3LJCA 2RP4A 2RPAA 3FZKB 3C4WA 4ZZCA 3CK6A 2W8FA 5FXXA 4LMLA 3CMLA 4FI5A 3E0ZA 3GN5B 2XZ5A 1ZHCA 4UF0A 2UZ6A 2JQKA 4DMWA 2R6GF 3ZYKA 1ZEEA 4JI5T 1IBLT 1S94A 4WNKA 4DV5T 4PFPA 3VRAA 3RHWA 3MK7C 2W2UA 2ZMAA 5C3JA 5CFBA 3WTKA 3EDVA 4AKGA 2N2NA 2K24A 3KV9A 3QNUA 5ABGA 2WWUA 4UV9B 4WV9A 3NKZA 3AA1B 4LMJA 5HEOA 5LXBA 1NENA 1HNXT 2VL8A 4EYUA 4HTEA 2X9YA 2CMRA 2L9QA 4H9NC 5IYZE 4JUYA 1MNEA 4GK0E 5AQIB 3VHLA 5KX5E 4X1YE 4DBRA 5IUXA 2H88A 3UTKA 2ZM8A 4Z8XA 4ZI2D 2V7KA 3AEGA 3JAEA 5FVKA 4TWDA 3F2EA 2XQ9A 2CPTA 4EOZB 4UM3P 4UXUA 3PUQA 3C64A 1KNRA 3RX6A 3N9NA 3H3AA 3NWIA 5GONE 4WYVA 3SOLA 3NZQA 3C98B 1SHZC 2LE8A 2X00D 4GYRA 2OV9A 2XQYA 3N5LA 4ILBA 2CM0A 5LP6E 2A9UA 5KDMC 5FKYA 4U7YA 3OBVE 3RIUC 3RRCA 4XK9A 2X0HA 5LNKA 5BW2A 3ONJA 2UXCT 4P0AA 4A97A 4L5GA 2UUAT 5JDMA 2NW7A 2YEVC 5LMUT 2CWYA 2D2SA 3PUGA 5C2TA 2BJ0A 3AE9A 3K3NA 3KV6A 2C5KT 3P8CD 2W00A 4HFVA 4O8SA 1R8IA 1KK7A 4HEAA 4IL9A 4ADZA 4ILCA 4UEMA 4B3TT 3LBXA 3JC6C 1WCRA 1E2AA 3H37A 2X9WA 4LF7T 4A98A 3U8MA 2YMEA 2P9BA 4PNIA 3ZSTA 2JIWA 2WCAA 2IAKA 2M6BA 2KSRA 5AQFB 2VKOA 3E08A 3N9OA 3IBPA 3AEBA 2IMLA 2ZJVA 4PK5A 1NEKA 2YDSA 1W9RA 4HE8A 1UX4A 2HH7A 5HEGA 4O2BE 5HCMA 4EV6A 4ZR6A 4JI7T 4EZHA 4EXTA 2D5UA 3MXZA 2QA7A 3ZT5A 4AQGA 4DR5T 2IHR1 3AE4A 4N78D 3E22E 4Z91A 4ZI3C 3TLWA 1YQ3A 3ZMZB 2WN9A 4DR6T 2LKHA 3FXEB 4AISA 3HKEE 3RKGA 3O9XA 1KEYA 4CN6A 2Y54A 3WTOA 2UU9T 2J47A 4TV8E 1VOMA 2E9XA 2XQAA 4NXMT 2QC1B 5FY7A 3B13A 2V6YA 4J2CA 4PW8A 4UV8B 3CX7B 2D9DA 3UU5A 2CLYB 5JDFA 3ABVA 2BYPA 2XQ8A 5JDLA 2CHOA 3DP7A 4COFA 3RPUA 3S4UA 1E7PA 5LA6E 4QXCB 5JDQA 2LM9A 2W62A 3L3PA 3RYHE 4IE7A 2MBGA 2NW9A 1UX2A 1LVFA 4OHFA 1T72A 3L8RA 1YD8G 2ZLYA 4YJ2E 1U4QA 2WU2A 1FMVA 4I4TE 5FP3A 5L4HA 1HNZT 5FYMA 1T98A 3LFMA 3O1JA 2CHNA 2BG9A 4AFHA 5LGTB 3I0OA 4HFHA 3AE7A 4ZJSA 2E5VA 4CN1A 3AE2A 4ZOLE 4PFOA 2Y8DA 5L3GB 2W8GA 2V1DB 4KHPT 1M62A 5HAXA 5F3JA 2WU5A 2L3LA 1IJ6A 3EABA 4CXXA 2FJEA 3HA4A 3K3OA 5LJNA 4B6XA 2XQ4A 1SA0E 3AXJA 4CXWA 2XYSA 5AFMB 5L3EB 2LSIA 4U33A 3MKDA 4UM3A 2XHEB 4IDNA 5E0OA 4CI1B 2RA1A 4BJMA 4DIDB 4NIQA 3AA7B 3NBXX 4AKRB 5HXSA 4HGAA 3T8OA 2X67A 4ERRA 2C0SA 4CI3B 5LHHB 4JEHB 1IAPA 3RYCE 3AE1A 3ZT7A 2LJLA 3N2GE 3RH3A 4P1NA 5AQVB 4JI8T 2VKDA 4I43B 3FBZA 4O4JE 4BQTA 2K5BB 1KF6A 3VR8A 1WR0A 2H7OA 1E1HB 4HFCA 5HEUA 1NAFA 5L3BB 3N9QA 4A56A 2BYNA 2FJAA 3KFWX 2HN1A 3UUMA 2VASA 1XNRT 3DTOA 1HNWT 1UCUA 2I59A 3HKCE 3R84B 3VKGA 2XUEA 3NRXA 3AEFA 3GN5A 2WMOA 3AE5A 3RIFA 3IHRA 3FXDB 4CXYA 2HN2A 3N9LA 3U8KA 4O4HE 1FEWA 4H63V 5AQJB 5AFUL 5LG4A 3O1HA 4DBMA 3KDSE 2VQFT 5LGUB 5L3DB 2H3RA 3C4XA 1T7SA 2J1DG 4JI0T 3W15B 4JI4T 1D1BA 2B76A 2ACZA 3F31A 3D0TA 3AVRA 3OYXA 5ABHA 2OA5A 4H9OC 5LMNT 2BVMA 3SFEA 2XY8B 2CBIA 1D0XA 2DCFA 5L3FB 4NUVA 4B5DA 5JH7E 3P4WA 4AKHA 2FJDA 3LK2B 4X62T 4UVCB 4C91A 5CO5A 3RYFE 4DV7T 4CN4A 5ETWA 4XBFB 3P50A 4M1PA 4KP3C 1XDOA 2LM2A 5BRXA 2M6IA 2J62A 5C8YE 2C9TA 2JQQA 2LRLA 5HXRA 4DR4T 2IDOB 5LBMA 4LF5T 2LEHA 2EHOD 1VCSA 5ABFB 2Q9QB 3RLFF
chains in the Genus database with same CATH topology
5HEJA 3U8JA 3UU4A 4HFCA 5AFLA 5HEUA 2ZJUA 3RI5A 5L4HA 3UUBA 1OEDC 2ZJVA 3RQWA 2BR7A 2BYNA 2X00D 1UW6A 5BP0A 2Y58A 3LSVA 2XQ3A 3ZKRA 4ZZCA 4XHEA 4X5TA 3UQ7A 2LKGA 3WIPA 1OEDA 3JADA 4ILBA 2W8FA 4LMLA 4HFDA 2BG9A 4AFHA 5HEGA 2VL0A 3RIFA 5HCMA 2WNCA 4ZR6A 3WTJA 5HCJA 4HFHA 5AFJA 2WNJA 4EZ1A 5J5FA 2BG9B 2XZ5A 4ZJSA 4NPPA 3SH1A 4HFEA 2YN6A 4HQPA 3U8KA 3WTMA 4UM3S 2UZ6A 4AFGA 4XK9A 3ZDGA 2MAWA 2W8GA 5J5IA 4Z91A 3TLWA 1I9BA 3GUAA 3EHZA 2XQ5A 2BR8A 3EI0A 4QH1A 4ZK4A 2YKSA 2BG9C 3U8LA 4DBMA 2WN9A 5BW2A 3PMZA 3RHWA 4AFTA 1UV6A 4IL4A 5CFBA 3RQUA 3WTKA 3WTNA 4A97A 4ZZBA 3EAMA 2YMDA 5HEHA 2LKHA 4WV9A 2PGZA 3SQ9A 2XQ6A 5KE4A 4LMJA 5HEOA 3WTLA 5LXBA 3WTHA 4TNVA 4ZJTA 2XQ4A 5FJVA 2BJ0A 5KZUA 2X00A 5AFMA 2Y54A 3WTOA 3UQ4A 2BYSA 4ALXA 2XQ7A 2XYSA 5AFMB 4QABA 4PIRA 2XNTA 3SQ6A 5L4EA 2WNLA 5J0ZA 2XNUA 3U8NA 2XQAA 3TLUA 4BFQA 2QC1B 1OEDE 4F8HA 3C84A 3WTIA 5AFNA 4IL9A 5AFHA 4LMKA 5JMEA 5J5GA 4UM3A 4B5DA 4ILCA 3P4WA 3UU5A 5IUXA 4QACA 3UU6A 3UU8A 2BYPA 2XQ8A 2Y57A 3C79A 4FRRA 4ZK1A 4ZRUA 5AFKA 2WZYA 4QH4A 4QH5A 3TLVA 5CO5A 5SYOA 3JAEA 4ILAA 5LG3A 4TWDA 4A98A 4COFA 2BYRA 3U8MA 2YOEA 3P50A 3ZDHA 3IGQA 4HFIA 4IREA 2XQ9A 2YMEA 2LM2A 4Z90A 4UM1A 2LLYA 2M6IA 5BRXA 5J5HA 4QAAA 3UU3A 4UM3P 2XNVA 3PEOA 4UXUA 5AINA 4NZBA 2Y7YA 3TLSA 2C9TA 2XZ6A 3SIOA 4TNWA 3RIAA 3TLTA 1OEDB 4TWHA 2BG9E 4HFBA 2XYTA 2M6BA 4TWFA 2PH9A 5TVCA 4D01A 3T4MA 1UX2A 2KSRA 3JAFA 4UY2A 4BQTA 5L47A 2BYQA 2Y56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEJ A;  3U8J A;  3UU4 A;  4HFC A;  5AFL A;  5HEU A;  2ZJU A;  3RI5 A;  5L4H A;  3UUB A;  1OED C;  2ZJV A;  3RQW A;  2BR7 A;  2BYN A;  2X00 D;  1UW6 A;  5BP0 A;  2Y58 A;  3LSV A;  2XQ3 A;  3ZKR A;  4ZZC A;  4XHE A;  4X5T A;  3UQ7 A;  2LKG A;  3WIP A;  1OED A;  3JAD A;  4ILB A;  2W8F A;  4LML A;  4HFD A;  2BG9 A;  4AFH A;  5HEG A;  2VL0 A;  3RIF A;  5HCM A;  2WNC A;  4ZR6 A;  3WTJ A;  5HCJ A;  4HFH A;  5AFJ A;  2WNJ A;  4EZ1 A;  5J5F A;  2BG9 B;  2XZ5 A;  4ZJS A;  4NPP A;  3SH1 A;  4HFE A;  2YN6 A;  4HQP A;  3U8K A;  3WTM A;  4UM3 S;  2UZ6 A;  4AFG A;  4XK9 A;  3ZDG A;  2MAW A;  2W8G A;  5J5I A;  4Z91 A;  3TLW A;  1I9B A;  3GUA A;  3EHZ A;  2XQ5 A;  2BR8 A;  3EI0 A;  4QH1 A;  4ZK4 A;  2YKS A;  2BG9 C;  3U8L A;  4DBM A;  2WN9 A;  5BW2 A;  3PMZ A;  3RHW A;  4AFT A;  1UV6 A;  4IL4 A;  5CFB A;  3RQU A;  3WTK A;  3WTN A;  4A97 A;  4ZZB A;  3EAM A;  2YMD A;  5HEH A;  2LKH A;  4WV9 A;  2PGZ A;  3SQ9 A;  2XQ6 A;  5KE4 A;  4LMJ A;  5HEO A;  3WTL A;  5LXB A;  3WTH A;  4TNV A;  4ZJT A;  2XQ4 A;  5FJV A;  2BJ0 A;  5KZU A;  2X00 A;  5AFM A;  2Y54 A;  3WTO A;  3UQ4 A;  2BYS A;  4ALX A;  2XQ7 A;  2XYS A;  5AFM B;  4QAB A;  4PIR A;  2XNT A;  3SQ6 A;  5L4E A;  2WNL A;  5J0Z A;  2XNU A;  3U8N A;  2XQA A;  3TLU A;  4BFQ A;  2QC1 B;  1OED E;  4F8H A;  3C84 A;  3WTI A;  5AFN A;  4IL9 A;  5AFH A;  4LMK A;  5JME A;  5J5G A;  4UM3 A;  4B5D A;  4ILC A;  3P4W A;  3UU5 A;  5IUX A;  4QAC A;  3UU6 A;  3UU8 A;  2BYP A;  2XQ8 A;  2Y57 A;  3C79 A;  4FRR A;  4ZK1 A;  4ZRU A;  5AFK A;  2WZY A;  4QH4 A;  4QH5 A;  3TLV A;  5CO5 A;  5SYO A;  3JAE A;  4ILA A;  5LG3 A;  4TWD A;  4A98 A;  4COF A;  2BYR A;  3U8M A;  2YOE A;  3P50 A;  3ZDH A;  3IGQ A;  4HFI A;  4IRE A;  2XQ9 A;  2YME A;  2LM2 A;  4Z90 A;  4UM1 A;  2LLY A;  2M6I A;  5BRX A;  5J5H A;  4QAA A;  3UU3 A;  4UM3 P;  2XNV A;  3PEO A;  4UXU A;  5AIN A;  4NZB A;  2Y7Y A;  3TLS A;  2C9T A;  2XZ6 A;  3SIO A;  4TNW A;  3RIA A;  3TLT A;  1OED B;  4TWH A;  2BG9 E;  4HFB A;  2XYT A;  2M6B A;  4TWF A;  2PH9 A;  5TVC A;  4D01 A;  3T4M A;  1UX2 A;  2KSR A;  3JAF A;  4UY2 A;  4BQT A;  5L47 A;  2BYQ A;  2Y56 A; 
#chains in the Genus database with same CATH topology
 2LSG A;  3PUV F;  4OX9 T;  4YSX A;  2K9A A;  2VK9 A;  3CVR A;  5AQN B;  1XWM A;  4IHJ E;  5AQS B;  4TN7 B;  1D0Y A;  3C51 A;  3QUJ A;  1Y01 A;  4ZI2 C;  1HX1 B;  1MIW A;  2YDQ A;  3N9M A;  1W0A A;  3PUA A;  2A72 A;  3EUH A;  4NPP A;  3EVY A;  2X9X A;  5J5I A;  3UFE A;  5AQR B;  3ZJ2 A;  2DWK A;  1UUR A;  3BQK A;  3ESL A;  5IWA T;  2ACX A;  4UEL A;  4UVB B;  1D1A A;  2KMF A;  2EHO B;  1KNZ A;  1JNR A;  2BZB A;  3N9P A;  5KZU A;  2X00 A;  2K48 A;  3PUY F;  4OFZ A;  4ALX A;  4DV6 T;  2BVL A;  3LK3 B;  1QSD A;  4QXH B;  3AE6 A;  3ZT6 A;  3J9X 1;  5J0Z A;  4LF6 T;  2IIU A;  3PU8 A;  5J5G A;  3U3I A;  2WDR A;  3I9W A;  1HX8 A;  3C4Z A;  4JV5 T;  3SFD A;  3OKQ A;  3K8P C;  3TLV A;  2CA5 A;  5LG3 A;  2YOE A;  2NTY A;  5JTG A;  3TKL B;  5HXH A;  2XNV A;  3PEO A;  4EIW A;  5JR9 C;  4YHH T;  3MA9 A;  3SIO A;  1IBK T;  4TWH A;  4HWD A;  5JRC B;  3FZH B;  1ZV4 X;  5JR9 A;  5CA0 E;  2MTQ A;  4JLE A;  1MMN A;  1D0Z A;  3ZCJ A;  4ZEY A;  2XQ3 A;  2DLR A;  1UK5 A;  4HWI B;  4HFD A;  2VL0 A;  4DV3 T;  2UUC T;  5HCJ A;  4QXB B;  3WAK A;  2BS2 A;  2IW5 B;  2UUB T;  2F4V T;  3EI0 A;  5LHI B;  1UV6 A;  4IL4 A;  3F57 A;  2QGS A;  1ZOY A;  2IC9 A;  3PUR A;  1OWA A;  2UXN B;  2WAU A;  2Y48 B;  4HWC A;  3KBT A;  5FMN A;  5EZY E;  2JMK A;  1H7C A;  5JDH A;  3RRW A;  1MIY A;  4DR3 T;  5AQM B;  4HKA A;  3PJA J;  2WWV A;  4TUY E;  5J2U E;  4ZRU A;  5AFK A;  2BBH A;  3I0Q A;  1HG5 A;  4DR1 T;  1KNP A;  5FNV E;  3ZDH A;  1KFY A;  3IGQ A;  4U74 A;  4BAY B;  4I50 E;  4WBN E;  4GIW A;  5HWY A;  2ZM2 A;  1HFA A;  2XYT A;  1S35 A;  2V26 A;  4UY2 A;  5L47 A;  2FUP A;  2B1E A;  1MMG A;  5FY1 A;  2Y56 A;  4JBW F;  4YY3 T;  3ONX A;  4DBQ A;  3FZL B;  5FL0 A;  1OED C;  2WY2 A;  3ZKR A;  2YIN A;  4DV0 T;  1EZ3 A;  2LKG A;  1OED A;  1IZN B;  3UUX B;  3WTM A;  2MYS A;  3ZDG A;  1U5P A;  2KLQ A;  4IT4 A;  3HI2 A;  3CX8 B;  2WSS V;  3RQU A;  3WTN A;  3EAM A;  3JCF A;  2YMD A;  2AXD S;  2V7I A;  5J1G A;  4JI2 T;  2LRK A;  3O1I A;  4BJN A;  5AFM A;  4ZS3 A;  5ABE A;  2DWG A;  3ZYL A;  1WRD A;  2WP9 A;  5AFH A;  3RYI E;  4H9P C;  1HF8 A;  4LMK A;  5IHY A;  3A7M A;  4CQI A;  2BS3 A;  3C79 A;  4FRR A;  2DI4 A;  4H9S E;  2E9X C;  3P4Q A;  1VCT A;  1BR4 A;  4B3M T;  5J5H A;  4QAA A;  3UU3 A;  3ZC0 A;  4YT0 A;  4NZB A;  3PJA A;  2D0T A;  3TLS A;  2CEA A;  3AEA A;  4TWF A;  3PUX F;  4DV4 T;  4AI6 A;  3U8J A;  5HWX A;  1Z0P A;  5FXZ A;  4MAL A;  4OYK A;  2BR7 A;  4H9Q C;  2NP9 A;  3WIP A;  5JDN A;  3AED A;  2MOZ A;  3ANW B;  2LOP A;  5AFJ A;  3HR0 A;  5BR8 T;  5DJQ C;  3WI3 A;  4LF8 T;  1YXR A;  3EHZ A;  2BR8 A;  4MLK A;  2BG9 C;  3U8L A;  2XAG B;  4AFT A;  3AAI A;  3QOF A;  4AXP A;  3M3Z B;  4CI2 B;  3MZK B;  2WZH A;  5AQQ B;  3AVS A;  2IUB A;  5CJ5 A;  3AAE B;  2YK0 A;  3AA0 B;  4GK5 E;  2XNT A;  2WNL A;  4YFS A;  4U31 A;  5AQH B;  4PJN A;  2JPF A;  2QYW A;  5AQT B;  2A3D A;  2X68 A;  5CA1 E;  1N32 T;  3IA3 A;  4DO0 A;  4AQF C;  2W67 A;  3LG7 A;  2NR4 A;  2NOX A;  3V5S A;  2XAH B;  2LLY A;  3ZC1 A;  2XJ7 A;  2KXP B;  4AQF A;  4DV1 T;  3QC9 A;  4UVA B;  4IE5 A;  1LRZ A;  3VRB A;  3MJX A;  5ABF A;  2LSK A;  2J4G A;  3T4M A;  4Q25 A;  3HKB E;  2XAJ B;  3AB3 B;  3BK9 A;  5JVD E;  2X0Y A;  3O4X E;  4GKJ T;  2V5C A;  5BP0 A;  4IDP A;  4E7Z A;  4JI6 T;  2XM2 A;  4IIJ E;  5F5W A;  4JYA T;  3B5M A;  4AKL A;  3C50 A;  1IBM T;  3SH1 A;  3P4S A;  5ADX L;  3UT5 E;  1MMD A;  2W66 A;  4LF4 T;  2MAW A;  2HPJ A;  3NVO A;  4AIU A;  1G73 A;  3FZM B;  1I9B A;  3GUA A;  2D0U A;  2YDR A;  2WS3 A;  5BMV E;  2LOS A;  3V5U A;  4DVD A;  2V6Y B;  2EHO A;  4TX5 A;  4HN9 A;  3CQX C;  3SQ9 A;  2XAF B;  3WTL A;  3WTH A;  4TNV A;  3P4R A;  4U2Y A;  2WB5 A;  4HWH A;  4EAH A;  3OYZ A;  2X0L B;  1J1J A;  3HL6 A;  2JJ9 A;  5FXW A;  3P4P A;  2VUR A;  3CX6 B;  4QHO A;  1FMW A;  3ZPO A;  2Q9Q D;  2Y57 A;  1BR2 A;  1BR1 A;  1NWM X;  5LBQ B;  1I6Z A;  5LHG B;  4U72 A;  4ILU A;  5FL1 A;  1L0V A;  2KWH A;  3OTO T;  2AE9 A;  2JRK A;  5JRC A;  5KMG P;  5HEJ A;  5AQO B;  4ZXL A;  2YU1 A;  2L8K A;  2SPC A;  1AJ3 A;  2VB6 A;  5M4Y A;  4X5T A;  2W4X A;  3JAD A;  2PFV A;  4X65 T;  4YTP A;  2ZM6 T;  2XAS B;  3ZMV B;  4HQP A;  2E5L T;  3OJA A;  1Z8U A;  1SUM B;  3RC8 A;  3GMI A;  1SE7 A;  2LSJ A;  4JI1 T;  2HHH T;  3PMZ A;  2GK9 A;  1ZKE A;  4A5X A;  1WFD A;  4X66 T;  5HEH A;  5HXC A;  1HCI A;  4UIG A;  4DUZ T;  4DND A;  3VR9 A;  4WBO A;  2KT9 A;  3RKO A;  4DV2 T;  2NWB A;  2MPK A;  1T8B A;  4F8H A;  4EYY R;  5JME A;  1XZY A;  3ONL C;  3UU8 A;  5FY0 A;  2VQE T;  3HKD E;  5SYO A;  3RGL A;  5LB7 B;  2I0M A;  1IJ5 A;  5L3C B;  5H6R B;  5L2L A;  5LJM A;  2WDV A;  2CXL A;  2XZ6 A;  1OXZ A;  2PH9 A;  5KXJ A;  5TVC A;  3Q5W A;  1J5W A;  4I0U A;  4IDQ A;  4X64 T;  2BKP A;  4L9I A;  1X9B A;  4DR7 T;  5DAB A;  4OK0 A;  1UW6 A;  1UGO A;  4B3S T;  3T1H T;  4DMV A;  1FJG T;  2NW8 A;  3M65 A;  2WBL A;  2Z6E A;  3ZSS A;  3UQ7 A;  4X20 E;  4PJM A;  4X1I E;  5EK3 A;  2WNC A;  4V1A v;  2N9D A;  3Q5X A;  3WAJ A;  2XAQ B;  2ODV A;  4PJJ A;  4EGW A;  4PK6 A;  1MND A;  1CUN A;  2BS4 A;  1LKX A;  3P7I A;  2KIN B;  2PJQ A;  4YLH A;  4KX6 A;  4CZZ B;  4B3R T;  4IGU A;  3N2K E;  2X66 A;  1JNZ A;  2XQ6 A;  5AQU B;  5KE4 A;  4X1K E;  1YQ4 A;  2WM9 A;  3FB2 A;  3SWH A;  3UQ4 A;  5LXT E;  4PIR A;  3RF1 A;  3SRZ A;  3X1D A;  3CKD A;  3TLU A;  2V7M A;  4KUM B;  2H7V C;  2VVS A;  4ZK1 A;  4GKK T;  5JDG A;  1B7T A;  2BYR A;  4TV9 E;  5JRE A;  4IRE A;  4UM1 A;  2CXF A;  2CLY C;  5AQK B;  3PV0 F;  2LSY A;  5DQV A;  4NXN T;  3T1Y T;  1Y64 B;  4TNW A;  3Q2M A;  3RIA A;  2UXB T;  2ZM0 A;  1D1C A;  4DR2 T;  3I1A A;  3PUW F;  4D01 A;  1XMO T;  2JMH A;  4LFB T;  2W0G A;  2BYQ A;  4EZ1 A;  2W63 A;  4ZS2 A;  2CE7 A;  2ZJU A;  3UUB A;  2X9H A;  3K1S A;  3RIU A;  4JI3 T;  2UXD T;  2CWO A;  3ANW A;  4XHE A;  1WLX A;  2XZE A;  3KVA A;  4KMC A;  1MMA A;  3QB5 K;  3Q9D A;  4XZC A;  4UF0 B;  1N33 T;  2KND A;  3AE3 A;  4KHZ F;  3NRY A;  4ASK A;  3AEC A;  2YKS A;  4G2A A;  3KV4 A;  3CIR A;  3MAC A;  4YXD A;  4YTM A;  3UUN A;  2OLT A;  2QRX A;  1YW0 A;  2X51 A;  4NUU A;  4YSY A;  2PGZ A;  2DNX A;  3KBU A;  2CBJ A;  2WZI A;  4K0K T;  5FJV A;  2VWA A;  1I94 T;  5LYJ E;  2M67 A;  5L4E A;  2CRB A;  5AQG B;  3C84 A;  3OVU A;  5FXV A;  3A8Y C;  4H63 H;  5JR9 B;  3VU7 H;  5CGM A;  2FJB A;  4QH5 A;  4YSZ A;  3ETU A;  4HFI A;  4HWF A;  1XNQ T;  2ES0 A;  5AIN A;  2Y7Y A;  3ETV A;  2IC6 A;  3TLT A;  5JQG E;  1HR0 T;  1YKH B;  1LVK A;  2BDE A;  3VKH A;  4YHJ A;  3LK4 2;  3SS1 A;  4YTN A;  2HPL A;  4KBM B;  2CCQ A;  4LFA T;  3FHN A;  3B57 A;  5J5F A;  3WTJ A;  3AAA B;  3AEE A;  2V8S V;  3DJB A;  5EK2 A;  4HFE A;  4UM3 S;  4UXN B;  4AFG A;  3FBL A;  2JQ9 A;  1G8X A;  3BQL A;  2KWI B;  4QH1 A;  3JC6 D;  3EDU A;  3AA6 B;  3R6N A;  2PTF A;  2WQY A;  4FJO A;  1WR6 A;  1YKE B;  4QKN A;  3ZN0 B;  1QUU A;  3ZMU B;  4PK4 A;  1QLB A;  1N34 T;  4ANJ A;  1HTJ F;  4ZJT A;  3L09 A;  2XSA A;  4QAB A;  2C5I T;  3SQ6 A;  4ISS A;  3U8N A;  4BFQ A;  3ZMT B;  1XMQ T;  4KI0 F;  2NTX A;  4QAC A;  4O4I E;  2LHR A;  3Q5D A;  2WZY A;  3LBX B;  3KIN B;  2PBI A;  2XPK A;  4P09 A;  1W0B A;  1WYB A;  4WW0 A;  1UX5 A;  5TAO A;  4JEU B;  4GOU A;  4LF9 T;  3ZJ1 A;  1XDP A;  2JQH A;  4ZI3 D;  1OED B;  5LOV E;  2V6X A;  1M7K A;  1J5E T;  3RC3 A;  3UUL A;  3ZEF B;  3L39 A;  2C5J A;  4L0R A;  3RI5 A;  1CHU A;  2VKH A;  3QB5 A;  3PTR B;  4IE0 A;  3PUZ F;  3ZCI A;  2Q9Q C;  4YJ3 E;  3KVB A;  3AE8 A;  2E9X D;  3FZF B;  4PJL A;  4OYJ A;  1US7 B;  2Q9Q A;  4UR9 A;  1FIO A;  2YN6 A;  4F6R C;  2G0U A;  4ZHQ E;  2VVN A;  2Y6X A;  1N36 T;  5AQL B;  2XQ5 A;  4ZK4 A;  1O3X A;  2FBW A;  2BKO A;  4AQY T;  4TZ4 C;  1GQE A;  3IF8 B;  3ZLI A;  2VKJ A;  2I6H A;  2V7J A;  4ZI7 E;  2XQ7 A;  3KV5 A;  3J7Y q;  2EHO C;  3GA8 A;  2KZ7 B;  1WYC A;  1OED E;  2E9X B;  5AFN A;  1V9D A;  1ZP0 A;  2YU2 A;  4BA9 A;  4PAG A;  3PDY A;  4EZ4 A;  4DUY T;  3I9Y A;  2BBJ A;  3GWH A;  2XM1 A;  4IE4 A;  4MHC A;  2BKN A;  4G63 A;  4EED A;  5LCY A;  3CQC B;  4XAX B;  3A5X A;  4ILA A;  2CXD A;  3QK6 A;  4IE6 A;  5H6Q B;  4EEB A;  1HS7 A;  3K3Q C;  3ZN1 B;  3N2O A;  4E7S A;  2W61 A;  5A1L A;  4QWN B;  2UXX B;  3UFG A;  3CPZ A;  2V7L A;  4MBQ A;  3ZYM A;  3U78 A;  2DL1 A;  2WDQ A;  3H3M A;  4P0B A;  4EB6 E;  2QVA A;  2XTL A;  3RQW A;  5FVL A;  3OPC A;  5HXE A;  4MFR A;  3LSV A;  4U7I A;  3PU3 A;  5F8P A;  2LHN A;  2WNJ A;  3PUS A;  2BG9 B;  5LGN B;  5DQW A;  2A2F X;  2K3W A;  3IEE A;  2LT3 A;  2WMN A;  4C90 A;  4O2A E;  4IDZ A;  4ZZB A;  5EK4 A;  3CWZ B;  5HYA A;  2N1G A;  2E2A A;  1VRB A;  3G06 A;  3NZP A;  4IDO A;  1DU2 A;  4LFC T;  2PG8 A;  2BYS A;  1W09 A;  3AXJ B;  3PE0 A;  3Q5E A;  4AKI A;  2XNU A;  3WTI A;  2DHR A;  2H89 A;  2ODU A;  5CB4 E;  3LDQ B;  3UU6 A;  2XSB A;  1HG2 A;  4U3C A;  4QX8 B;  4QH4 A;  1BR0 A;  4H9R C;  4K0U A;  4Z90 A;  4IST A;  4U2Z A;  4WZX A;  2BG9 E;  4HFB A;  4I55 E;  2E8I A;  4QX7 B;  3JAF A;  1MIV A;  2V5D A;  3ZMS B;  4GYS A;  1UUS A;  3UU4 A;  3BQI A;  5AFL A;  4O4L E;  5AQP B;  1X79 A;  3CQG B;  5J2T E;  2Y58 A;  3LJC A;  2RP4 A;  2RPA A;  3FZK B;  3C4W A;  4ZZC A;  3CK6 A;  2W8F A;  5FXX A;  4LML A;  3CML A;  4FI5 A;  3E0Z A;  3GN5 B;  2XZ5 A;  1ZHC A;  4UF0 A;  2UZ6 A;  2JQK A;  4DMW A;  2R6G F;  3ZYK A;  1ZEE A;  4JI5 T;  1IBL T;  1S94 A;  4WNK A;  4DV5 T;  4PFP A;  3VRA A;  3RHW A;  3MK7 C;  2W2U A;  2ZMA A;  5C3J A;  5CFB A;  3WTK A;  3EDV A;  4AKG A;  2N2N A;  2K24 A;  3KV9 A;  3QNU A;  5ABG A;  2WWU A;  4UV9 B;  4WV9 A;  3NKZ A;  3AA1 B;  4LMJ A;  5HEO A;  5LXB A;  1NEN A;  1HNX T;  2VL8 A;  4EYU A;  4HTE A;  2X9Y A;  2CMR A;  2L9Q A;  4H9N C;  5IYZ E;  4JUY A;  1MNE A;  4GK0 E;  5AQI B;  3VHL A;  5KX5 E;  4X1Y E;  4DBR A;  5IUX A;  2H88 A;  3UTK A;  2ZM8 A;  4Z8X A;  4ZI2 D;  2V7K A;  3AEG A;  3JAE A;  5FVK A;  4TWD A;  3F2E A;  2XQ9 A;  2CPT A;  4EOZ B;  4UM3 P;  4UXU A;  3PUQ A;  3C64 A;  1KNR A;  3RX6 A;  3N9N A;  3H3A A;  3NWI A;  5GON E;  4WYV A;  3SOL A;  3NZQ A;  3C98 B;  1SHZ C;  2LE8 A;  2X00 D;  4GYR A;  2OV9 A;  2XQY A;  3N5L A;  4ILB A;  2CM0 A;  5LP6 E;  2A9U A;  5KDM C;  5FKY A;  4U7Y A;  3OBV E;  3RIU C;  3RRC A;  4XK9 A;  2X0H A;  5LNK A;  5BW2 A;  3ONJ A;  2UXC T;  4P0A A;  4A97 A;  4L5G A;  2UUA T;  5JDM A;  2NW7 A;  2YEV C;  5LMU T;  2CWY A;  2D2S A;  3PUG A;  5C2T A;  2BJ0 A;  3AE9 A;  3K3N A;  3KV6 A;  2C5K T;  3P8C D;  2W00 A;  4HFV A;  4O8S A;  1R8I A;  1KK7 A;  4HEA A;  4IL9 A;  4ADZ A;  4ILC A;  4UEM A;  4B3T T;  3LBX A;  3JC6 C;  1WCR A;  1E2A A;  3H37 A;  2X9W A;  4LF7 T;  4A98 A;  3U8M A;  2YME A;  2P9B A;  4PNI A;  3ZST A;  2JIW A;  2WCA A;  2IAK A;  2M6B A;  2KSR A;  5AQF B;  2VKO A;  3E08 A;  3N9O A;  3IBP A;  3AEB A;  2IML A;  2ZJV A;  4PK5 A;  1NEK A;  2YDS A;  1W9R A;  4HE8 A;  1UX4 A;  2HH7 A;  5HEG A;  4O2B E;  5HCM A;  4EV6 A;  4ZR6 A;  4JI7 T;  4EZH A;  4EXT A;  2D5U A;  3MXZ A;  2QA7 A;  3ZT5 A;  4AQG A;  4DR5 T;  2IHR 1;  3AE4 A;  4N78 D;  3E22 E;  4Z91 A;  4ZI3 C;  3TLW A;  1YQ3 A;  3ZMZ B;  2WN9 A;  4DR6 T;  2LKH A;  3FXE B;  4AIS A;  3HKE E;  3RKG A;  3O9X A;  1KEY A;  4CN6 A;  2Y54 A;  3WTO A;  2UU9 T;  2J47 A;  4TV8 E;  1VOM A;  2E9X A;  2XQA A;  4NXM T;  2QC1 B;  5FY7 A;  3B13 A;  2V6Y A;  4J2C A;  4PW8 A;  4UV8 B;  3CX7 B;  2D9D A;  3UU5 A;  2CLY B;  5JDF A;  3ABV A;  2BYP A;  2XQ8 A;  5JDL A;  2CHO A;  3DP7 A;  4COF A;  3RPU A;  3S4U A;  1E7P A;  5LA6 E;  4QXC B;  5JDQ A;  2LM9 A;  2W62 A;  3L3P A;  3RYH E;  4IE7 A;  2MBG A;  2NW9 A;  1UX2 A;  1LVF A;  4OHF A;  1T72 A;  3L8R A;  1YD8 G;  2ZLY A;  4YJ2 E;  1U4Q A;  2WU2 A;  1FMV A;  4I4T E;  5FP3 A;  5L4H A;  1HNZ T;  5FYM A;  1T98 A;  3LFM A;  3O1J A;  2CHN A;  2BG9 A;  4AFH A;  5LGT B;  3I0O A;  4HFH A;  3AE7 A;  4ZJS A;  2E5V A;  4CN1 A;  3AE2 A;  4ZOL E;  4PFO A;  2Y8D A;  5L3G B;  2W8G A;  2V1D B;  4KHP T;  1M62 A;  5HAX A;  5F3J A;  2WU5 A;  2L3L A;  1IJ6 A;  3EAB A;  4CXX A;  2FJE A;  3HA4 A;  3K3O A;  5LJN A;  4B6X A;  2XQ4 A;  1SA0 E;  3AXJ A;  4CXW A;  2XYS A;  5AFM B;  5L3E B;  2LSI A;  4U33 A;  3MKD A;  4UM3 A;  2XHE B;  4IDN A;  5E0O A;  4CI1 B;  2RA1 A;  4BJM A;  4DID B;  4NIQ A;  3AA7 B;  3NBX X;  4AKR B;  5HXS A;  4HGA A;  3T8O A;  2X67 A;  4ERR A;  2C0S A;  4CI3 B;  5LHH B;  4JEH B;  1IAP A;  3RYC E;  3AE1 A;  3ZT7 A;  2LJL A;  3N2G E;  3RH3 A;  4P1N A;  5AQV B;  4JI8 T;  2VKD A;  4I43 B;  3FBZ A;  4O4J E;  4BQT A;  2K5B B;  1KF6 A;  3VR8 A;  1WR0 A;  2H7O A;  1E1H B;  4HFC A;  5HEU A;  1NAF A;  5L3B B;  3N9Q A;  4A56 A;  2BYN A;  2FJA A;  3KFW X;  2HN1 A;  3UUM A;  2VAS A;  1XNR T;  3DTO A;  1HNW T;  1UCU A;  2I59 A;  3HKC E;  3R84 B;  3VKG A;  2XUE A;  3NRX A;  3AEF A;  3GN5 A;  2WMO A;  3AE5 A;  3RIF A;  3IHR A;  3FXD B;  4CXY A;  2HN2 A;  3N9L A;  3U8K A;  4O4H E;  1FEW A;  4H63 V;  5AQJ B;  5AFU L;  5LG4 A;  3O1H A;  4DBM A;  3KDS E;  2VQF T;  5LGU B;  5L3D B;  2H3R A;  3C4X A;  1T7S A;  2J1D G;  4JI0 T;  3W15 B;  4JI4 T;  1D1B A;  2B76 A;  2ACZ A;  3F31 A;  3D0T A;  3AVR A;  3OYX A;  5ABH A;  2OA5 A;  4H9O C;  5LMN T;  2BVM A;  3SFE A;  2XY8 B;  2CBI A;  1D0X A;  2DCF A;  5L3F B;  4NUV A;  4B5D A;  5JH7 E;  3P4W A;  4AKH A;  2FJD A;  3LK2 B;  4X62 T;  4UVC B;  4C91 A;  5CO5 A;  3RYF E;  4DV7 T;  4CN4 A;  5ETW A;  4XBF B;  3P50 A;  4M1P A;  4KP3 C;  1XDO A;  2LM2 A;  5BRX A;  2M6I A;  2J62 A;  5C8Y E;  2C9T A;  2JQQ A;  2LRL A;  5HXR A;  4DR4 T;  2IDO B;  5LBM A;  4LF5 T;  2LEH A;  2EHO D;  1VCS A;  5ABF B;  2Q9Q B;  3RLF F; 
#chains in the Genus database with same CATH homology
 5HEJ A;  3U8J A;  3UU4 A;  4HFC A;  5AFL A;  5HEU A;  2ZJU A;  3RI5 A;  5L4H A;  3UUB A;  1OED C;  2ZJV A;  3RQW A;  2BR7 A;  2BYN A;  2X00 D;  1UW6 A;  5BP0 A;  2Y58 A;  3LSV A;  2XQ3 A;  3ZKR A;  4ZZC A;  4XHE A;  4X5T A;  3UQ7 A;  2LKG A;  3WIP A;  1OED A;  3JAD A;  4ILB A;  2W8F A;  4LML A;  4HFD A;  2BG9 A;  4AFH A;  5HEG A;  2VL0 A;  3RIF A;  5HCM A;  2WNC A;  4ZR6 A;  3WTJ A;  5HCJ A;  4HFH A;  5AFJ A;  2WNJ A;  4EZ1 A;  5J5F A;  2BG9 B;  2XZ5 A;  4ZJS A;  4NPP A;  3SH1 A;  4HFE A;  2YN6 A;  4HQP A;  3U8K A;  3WTM A;  4UM3 S;  2UZ6 A;  4AFG A;  4XK9 A;  3ZDG A;  2MAW A;  2W8G A;  5J5I A;  4Z91 A;  3TLW A;  1I9B A;  3GUA A;  3EHZ A;  2XQ5 A;  2BR8 A;  3EI0 A;  4QH1 A;  4ZK4 A;  2YKS A;  2BG9 C;  3U8L A;  4DBM A;  2WN9 A;  5BW2 A;  3PMZ A;  3RHW A;  4AFT A;  1UV6 A;  4IL4 A;  5CFB A;  3RQU A;  3WTK A;  3WTN A;  4A97 A;  4ZZB A;  3EAM A;  2YMD A;  5HEH A;  2LKH A;  4WV9 A;  2PGZ A;  3SQ9 A;  2XQ6 A;  5KE4 A;  4LMJ A;  5HEO A;  3WTL A;  5LXB A;  3WTH A;  4TNV A;  4ZJT A;  2XQ4 A;  5FJV A;  2BJ0 A;  5KZU A;  2X00 A;  5AFM A;  2Y54 A;  3WTO A;  3UQ4 A;  2BYS A;  4ALX A;  2XQ7 A;  2XYS A;  5AFM B;  4QAB A;  4PIR A;  2XNT A;  3SQ6 A;  5L4E A;  2WNL A;  5J0Z A;  2XNU A;  3U8N A;  2XQA A;  3TLU A;  4BFQ A;  2QC1 B;  1OED E;  4F8H A;  3C84 A;  3WTI A;  5AFN A;  4IL9 A;  5AFH A;  4LMK A;  5JME A;  5J5G A;  4UM3 A;  4B5D A;  4ILC A;  3P4W A;  3UU5 A;  5IUX A;  4QAC A;  3UU6 A;  3UU8 A;  2BYP A;  2XQ8 A;  2Y57 A;  3C79 A;  4FRR A;  4ZK1 A;  4ZRU A;  5AFK A;  2WZY A;  4QH4 A;  4QH5 A;  3TLV A;  5CO5 A;  5SYO A;  3JAE A;  4ILA A;  5LG3 A;  4TWD A;  4A98 A;  4COF A;  2BYR A;  3U8M A;  2YOE A;  3P50 A;  3ZDH A;  3IGQ A;  4HFI A;  4IRE A;  2XQ9 A;  2YME A;  2LM2 A;  4Z90 A;  4UM1 A;  2LLY A;  2M6I A;  5BRX A;  5J5H A;  4QAA A;  3UU3 A;  4UM3 P;  2XNV A;  3PEO A;  4UXU A;  5AIN A;  4NZB A;  2Y7Y A;  3TLS A;  2C9T A;  2XZ6 A;  3SIO A;  4TNW A;  3RIA A;  3TLT A;  1OED B;  4TWH A;  2BG9 E;  4HFB A;  2XYT A;  2M6B A;  4TWF A;  2PH9 A;  5TVC A;  4D01 A;  3T4M A;  1UX2 A;  2KSR A;  3JAF A;  4UY2 A;  4BQT A;  5L47 A;  2BYQ A;  2Y56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...