5L47A

X-ray structure of the 2-22' locally-closed mutant of glic in complex with cyanoselenobarbital (seleniated barbiturate)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
source organism Gloeobacter
molecule tags Membrane protein, transport protein
total genus 88
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l47A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l47A01
3TLTA 3P4WA 5AFLA 5KZUA 4ALXA 2YMDA 5HEJA 3WTJA 2BYSA 2WZYA 5JMEA 4X5TA 3IGQA 4ZRUA 2XQ3A 4UXUA 5J5FA 2LKGA 5HCJA 5HEGA 2XQ7A 5HEOA 1OEDA 2BG9C 2XQ5A 4AFHA 2LLYA 3RIAA 3UQ7A 4DBMA 4HFIA 2BG9E 5CFBA 3UQ4A 1UV6A 5IUXA 2BR7A 2W8FA 2ZJUA 2BYNA 3WTLA 3WIPA 4EZ1A 4ILCA 5L4EA 4A98A 4HFDA 3RIFA 4A97A 4WV9A 3PMZA 2XZ5A 4ZJTA 2YMEA 5HEHA 5AFKA 4AFGA 2Y7YA 2W8GA 5J5GA 5TVCA 3UU3A 3ZKRA 4B5DA 4UM3S 3RI5A 2Y54A 2Y56A 4UM3A 2XQ8A 5BRXA 4HFHA 2BG9A 5CO5A 5L4HA 4QH4A 2XQ6A 1UX2A 3RQWA 3LSVA 2M6IA 3SQ6A 2Y58A 4BQTA 4COFA 2XQ9A 2BR8A 3TLVA 3SIOA 4TWDA 3JADA 4QH5A 5HEUA 4LMJA 2BYRA 4UM3P 3TLUA 3WTIA 2BG9B 3JAEA 3WTNA 2BYPA 5L47A 3P50A 5AFMB 2XQ4A 4XHEA 2M6BA 2XNUA 2YOEA 3SQ9A 3U8MA 3JAFA 1OEDE 2BJ0A 3UU8A 4TWHA 3WTMA 4QABA 2XNTA 5AINA 2Y57A 2WNJA 4Z91A 5BP0A 4ZZCA 4ZJSA 2XYSA 2XZ6A 2X00A 4D01A 2YKSA 4ZZBA 5J5HA 2VL0A 5AFMA 4QH1A 3UUBA 2PH9A 5J5IA 3RHWA 3U8LA 2LM2A 4NPPA 3WTOA 3GUAA 5AFNA 4HFEA 4ILBA 4BFQA 4IL4A 2LKHA 4Z90A 2WNLA 4FRRA 4UM1A 5HCMA 3UU5A 5AFJA 4LMKA 4NZBA 4PIRA 2UZ6A 2WN9A 2WNCA 4ZK1A 5J0ZA 5BW2A 4ILAA 5SYOA 4IL9A 3TLWA 4ZK4A 4TNVA 3WTKA 3RQUA 5LG3A 4XK9A 3ZDGA 4HFCA 4QAAA 5AFHA 1UW6A 2C9TA 3EAMA 3ZDHA 4F8HA 2QC1B 4QACA 3U8JA 4IREA 4HQPA 4TWFA 2PGZA 2XQAA 2ZJVA 4UY2A 2X00D 2XYTA 3TLSA 3EI0A 3WTHA 5LXBA 3C79A 3T4MA 3EHZA 3PEOA 2KSRA 4ZR6A 3U8KA 4TNWA 1I9BA 3UU4A 3C84A 4HFBA 3SH1A 5KE4A 1OEDC 4LMLA 3UU6A 5FJVA 3U8NA 4AFTA 2BYQA 2MAWA 2YN6A 2XNVA 1OEDB
chains in the Genus database with same CATH superfamily
5DQVA 5KZUA 5C2TA 3ZT5A 1OXZA 4TV9E 4P1NA 1T72A 1UX5A 2G0UA 1W09A 3O1HA 1WLXA 3MXZA 2K3WA 4HFIA 2ODUA 3N2GE 2J1DG 1S94A 3AE1A 3RLFF 2PBIA 1LVFA 5IWAT 2V1DB 2FJEA 1HNZT 1SE7A 2XQ8A 4NUUA 4YTPA 4MLKA 3CWZB 5HXRA 3V5UA 2LHRA 2UXBT 3MKDA 5ABGA 3V5SA 3SIOA 4OYJA 3RPUA 2X68A 2K24A 3CX6B 1W0AA 4PW8A 2QVAA 4NIQA 2M6BA 2CBIA 2E9XA 2XAGB 3RF1A 2WP9A 4U31A 2YKSA 3FHNA 5AQSB 1R8IA 4QH1A 4ZI2D 4HFEA 2VQET 3OVUA 4GK5E 4UM1A 3C4XA 3EABA 1SA0E 4DV5T 4EV6A 4AI6A 3L09A 3BQLA 3ZT6A 5HWYA 3KDSE 4ZI7E 5EK3A 2D9DA 1W0BA 3P4SA 3VKHA 2CEAA 1KEYA 1D0YA 3LK2B 4AFTA 2OV9A 1LRZA 3KVBA 1W9RA 1JNZA 2Z6EA 3CPZA 2CE7A 3P7IA 5JDQA 4X5TA 3O4XE 2KNDA 4AFHA 2YDRA 4HWIB 1I6ZA 2BYNA 5FMNA 4QXHB 3PMZA 2NP9A 5HEHA 4DR3T 3AE6A 1HFAA 3ANWB 3HA4A 3AEGA 4UM3A 5AQTB 4UR9A 3HKCE 4LF9T 4EZHA 3ONXA 4JI1T 3LSVA 2JJ9A 3Q5WA 4BQTA 3ONJA 3RRWA 2WZHA 2XAHB 3NWIA 2FBWA 3JAEA 4HEAA 2UXXB 4JI5T 2IHR1 2DL1A 2YEVC 1DU2A 1YW0A 2QYWA 2W00A 2LT3A 5AQLB 3MZKB 3L3PA 4UVCB 4AIUA 3GUAA 2WS3A 4Z8XA 4CI1B 3HR0A 4U74A 4JI3T 4DV1T 4ERRA 4PIRA 1D1AA 2V8SV 4ZXLA 3EAMA 3RH3A 3AECA 3NVOA 2XYTA 5C8YE 5FXVA 2HHHT 4NUVA 4TN7B 2Y6XA 3ZN1B 3C4WA 4UVBB 4CI2B 2WMNA 3PUXF 5LHHB 1J5WA 1Z8UA 2GK9A 1EZ3A 4LF6T 3ZMTB 2HN1A 4HFVA 4U7YA 4EIWA 4DV7T 2B76A 4PK5A 2CA5A 3ZPOA 2KMFA 3ZEFB 1UGOA 3QNUA 4FI5A 4JEHB 4KHPT 3MA9A 4IDQA 2LEHA 3KV6A 4UM3P 2VKHA 4C91A 1D0ZA 2VB6A 2OA5A 3B13A 5LYJE 3N9PA 3UUXB 1ZP0A 1D0XA 1QSDA 4X66T 1BR4A 2WNJA 2JPFA 5LGNB 2JQ9A 2DCFA 3TKLB 4DV6T 2A72A 4ZZBA 3NRYA 4JI7T 3U8LA 2WDVA 2WNLA 3RRCA 2HH7A 4IE5A 4UIGA 3TLWA 2C5JA 2CWYA 2HPLA 2CPTA 4IE0A 5LMNT 2YK0A 4F8HA 3S4UA 3UT5E 2WM9A 4UF0A 2XM2A 4ZR6A 3ETVA 3U8NA 2VKDA 2MAWA 2YMDA 2XNVA 3RGLA 3KV4A 5C3JA 4N78D 4B3MT 3CKDA 1QUUA 1HX8A 4UXUA 5AFUL 3ZYMA 4WZXA 4KX6A 1HR0T 3F2EA 3R6NA 4L0RA 3UQ4A 3AEDA 4P0BA 2LSKA 5LA6E 2XZ5A 2JMKA 1IBLT 1J1JA 1KNPA 2Y56A 1E7PA 5BRXA 2CHOA 3CQXC 5L4HA 2MOZA 2VURA 3ONLC 2CBJA 3C51A 5AQMB 1WYCA 4YJ2E 2WU5A 3AAEB 2E8IA 2B1EA 4YSYA 3HI2A 3Q5XA 2YOEA 2WU2A 4DBQA 5AINA 1YXRA 4ISTA 4ZZCA 5LJNA 4JI4T 1X9BA 2XAFB 3VU7H 3PUVF 4JV5T 4DNDA 4ILUA 3N9OA 2BBHA 3ZC1A 3HKDE 2XAQB 3EUHA 2BKPA 3UU5A 4LMKA 4YXDA 2K5BB 2PJQA 3K1SA 4ASKA 4TX5A 4IGUA 3BQKA 5F5WA 4TUYE 3PEOA 5LHIB 5AQRB 3UU4A 4HFBA 2I59A 5AFLA 2V7MA 4ALXA 3G06A 2LOPA 2N9DA 1O3XA 4DMVA 4CN6A 1IBMT 4O4IE 5HCJA 5HEGA 5F3JA 2BG9C 4DR7T 2ZM0A 5IUXA 5J1GA 3WTLA 2K48A 4O2BE 3MJXA 4DV2T 3OYXA 5FY7A 3F57A 4CN1A 3I9WA 2H89A 3UU3A 3RC3A 5GONE 1Y01A 5CO5A 3VKGA 5FXXA 2YU2A 2QRXA 2BR8A 3TLVA 4IE6A 3JADA 4HWFA 3DP7A 2XZEA 4CN4A 3P50A 3SQ9A 4ZOLE 5DABA 3HL6A 2WSSV 3VHLA 3UU8A 4IDZA 2LSGA 2W67A 2WMOA 3ZMSB 2FUPA 3ZSSA 2X00A 3PJAJ 3RHWA 3WTOA 1FEWA 1IBKT 2DWGA 2LKHA 1YQ4A 2KXPB 5AQOB 3CX7B 4UVAB 3NRXA 3IF8B 1V9DA 2OLTA 4QACA 4PJJA 3PV0F 5JDGA 5F8PA 3FZFB 1HX1B 3VRBA 3L39A 3SH1A 3AE4A 4HGAA 2XQ3A 1HNXT 1T98A 4GKJT 2MPKA 5AQQB 3E08A 2LOSA 2WZYA 5JMEA 4PFPA 2V6YB 1N34T 5L3BB 4ZI3D 2V7IA 4IDPA 4IT4A 2V5CA 4X1KE 3JC6C 3CQCB 3JCFA 1SHZC 4B3TT 1D1CA 1S35A 2CCQA 2VL8A 4KHZF 5LXTE 4PNIA 2BDEA 4QX8B 1KF6A 5AQNB 4EXTA 4QXBB 4DO0A 3NZQA 3X1DA 3EVYA 3LFMA 3KV5A 3JAFA 2CHNA 4TWHA 1D1BA 2IMLA 4ZEYA 4DIDB 3SOLA 2X67A 5J5IA 3OYZA 4ISSA 4ILBA 4YFSA 4BJMA 5L3DB 2BZBA 3O9XA 2ODVA 3LK42 5BW2A 5HXCA 4WBNE 3WTKA 3ZC0A 1BR2A 3PTRB 2XQYA 4K0UA 4JI2T 5AQJB 2LM9A 4TV8E 4CQIA 5KE4A 5AQIB 4XAXB 4NXMT 3N5LA 4B6XA 3PUQA 2EHOC 3N2KE 3PJAA 3K3NA 3I9YA 4AQFC 2KWHA 3ZT7A 3AE5A 2Q9QC 4HE8A 5FKYA 2J4GA 1BR0A 3RIAA 2CM0A 3UQ7A 2PTFA 2H7VC 2V6YA 2X9HA 3AEBA 2UUBT 1HCIA 4HWHA 3RKOA 3T1YT 5LNKA 4QX7B 2W4XA 2BG9A 1HG2A 2XY8B 2J62A 3ABVA 3KV9A 1VCSA 3GMIA 1MMAA 5H6RB 5LG4A 1IJ6A 4UV9B 5JDLA 3PUGA 2LM2A 4I4TE 4JLEA 4X65T 2LSIA 5KX5E 4YY3T 5LP6E 2A3DA 3E22E 5FYMA 1XDPA 2ZM6T 4O4LE 3QB5A 4AQGA 2WNCA 4ILAA 4YT0A 4U72A 3Q5DA 2LHNA 4HFCA 1U5PA 3CIRA 4U7IA 1UCUA 4IREA 4TWFA 4X62T 5LXBA 4UELA 4U33A 3LBXA 3F31A 5LGUB 5AQUB 4H9PC 3UFEA 2V7JA 1J5ET 2BG9E 4JUYA 3P4WA 4UF0B 2X9WA 2EHOB 4QKNA 4E7SA 5HXEA 3OJAA 4KP3C 2WCAA 2QA7A 3CVRA 3Q5EA 2Q9QB 1IJ5A 3IHRA 3FZLB 5KDMC 1QLBA 5CFBA 1UV6A 2NOXA 4ZI2C 5ABEA 2L9QA 4ILCA 3R84B 2NTYA 2XUEA 5TVCA 3J7Yq 4EOZB 1UUSA 3RI5A 4DR4T 2JQQA 2VASA 2XQ6A 1UX2A 1XNQT 2M6IA 3KFWX 5HXHA 2VWAA 4EEDA 3A7MA 4DUYT 2WB5A 5FVKA 2FJBA 2XNUA 5L3CB 4X1IE 3FBZA 5J5HA 4NPPA 4Q25A 3FB2A 2V5DA 4JI8T 4NZBA 5ABFB 2X0LB 4PAGA 4UXNB 2WQYA 3RQUA 4XK9A 3K8PC 2E9XD 2BS4A 2QC1B 2WWVA 3LK3B 4CXWA 2D5UA 2MBGA 2JQKA 4EYYR 3ZMVB 3FXDB 4LF5T 2V7KA 4CXYA 1WCRA 4YTMA 3PUSA 5J5FA 3DJBA 5HEOA 1WFDA 5KXJA 2ZM8A 3VR9A 4WNKA 4WBOA 5AQFB 5JQGE 2W8FA 5FXWA 2EHOA 3DTOA 3ZSTA 5LCYA 4AQFA 4GKKT 4ZJTA 3AE3A 3PUWF 5AFKA 3NKZA 3W15B 2Q9QA 3PE0A 1UK5A 4AKGA 2BS3A 5ADXL 1IAPA 1M7KA 4U2ZA 2CLYC 3ZMUB 2LSYA 3SQ6A 4A5XA 4OFZA 5LGTB 4PK6A 3UULA 2FJDA 5LHGB 3N9LA 2YINA 2BJ0A 2AE9A 4DR2T 1LVKA 2Y57A 2W0GA 3K3QC 5KMGP 3ZCIA 5AFNA 4L9IA 4MFRA 5AFJA 4ZK1A 4J2CA 2CMRA 3I1AA 4KMCA 3U8JA 1IZNB 2ZJVA 3WI3A 3WTHA 3B5MA 5A1LA 2DNXA 3BQIA 5ABFA 2E5LT 1MMGA 4PJNA 3U8KA 3RYHE 4DV3T 4L5GA 2YN6A 1WR6A 3TLTA 4NXNT 1FMVA 3P4RA 3AAIA 2V6XA 3FBLA 1XDOA 1VRBA 3LJCA 4I0UA 5LBQB 4CXXA 2JIWA 4JEUB 5HYAA 1VOMA 2AXDS 2XQ7A 4EGWA 4HKAA 4AKRB 3AE2A 1ZV4X 3H37A 3T1HT 3RIFA 4IIJE 1B7TA 4ZS3A 3RYFE 4OX9T 4KBMB 4B5DA 2XASB 3AA6B 2BVLA 4O8SA 2LJLA 1I94T 3AE7A 5AQGB 4IDNA 2XQ9A 5J2UE 3SFEA 3AA7B 4TWDA 4LMJA 3L8RA 1YKHB 4YHJA 4XHEA 1ZOYA 4EAHA 3MK7C 4IDOA 2XSAA 3GN5B 1G8XA 4HTEA 4ZJSA 3P4QA 2M67A 1FIOA 4UV8B 4PFOA 3C98B 2XM1A 4I55E 4MALA 2UUAT 2VVNA 2WN9A 2NWBA 1MMNA 5JDMA 4EB6E 5ABHA 5LG3A 3ZDHA 2C9TA 3O1IA 1H7CA 2X66A 4P0AA 5HXSA 3T4MA 2JRKA 5FP3A 5JDHA 2KLQA 1WYBA 4XBFB 4IE4A 4DBRA 4DUZT 2H7OA 2VKOA 4HFDA 3RKGA 2YU1A 4GOUA 4AFGA 3FZMB 5JREA 1N33T 4EEBA 1XMOT 2J47A 4UM3S 3PUAA 1KFYA 2WY2A 4P09A 4BJNA 5CA0E 4GYRA 1M62A 2KZ7B 3NZPA 4H63H 4AQYT 5HEUA 4YSZA 3WTIA 2BG9B 2X0YA 4KUMB 4YTNA 2BYPA 1U4QA 2I0MA 1HTJF 5AFMB 2MYSA 2PG8A 2BS2A 3AEAA 1OEDE 4U2YA 4JI6T 5BR8T 5FXZA 4Z91A 3ZYKA 3M3ZB 4WW0A 4YLHA 1N36T 2X9XA 2JMHA 1MMDA 2R6GF 2X9YA 2PH9A 4BAYB 2UU9T 2IC9A 4B3RT 4LFBT 1NENA 1NAFA 3GN5A 2CXDA 1E1HB 1JNRA 3AVSA 2DI4A 1XNRT 4O4HE 5SYOA 4IL9A 4OHFA 4HWDA 4DR5T 1MIWA 5AFHA 2IC6A 3EDVA 4H63V 4ZHQE 3TLSA 4GYSA 5E0OA 2IAKA 2NW8A 2BBJA 1NEKA 2BYQA 1Y64B 4IE7A 3Q9DA 4K0KT 2H88A 3LBXB 2BYSA 5JVDE 5JH7E 5J2TE 3PURA 2LKGA 3AA1B 1CHUA 4A56A 4DR6T 2W62A 4EZ1A 2ACXA 4XZCA 2D2SA 2N1GA 2LSJA 1HNWT 4CZZB 3VRAA 3J9X1 2YDQA 4QH4A 4DR1T 4YHHT 2I6HA 2SPCA 3IBPA 5JR9C 4GK0E 2N2NA 2Y48B 1L0VA 5M4YA 3BK9A 5FY0A 3U3IA 4B3ST 4H9OC 2CXFA 3AE8A 5JRCB 3C64A 5IHYA 5BP0A 2C0SA 5AFMA 4CI3B 4ZI3C 1G73A 5AQHB 2NR4A 2L3LA 2CXLA 2RA1A 4HWCA 4X1YE 2KT9A 2HN2A 2A2FX 1YD8G 2ZLYA 3T8OA 3RYCE 4I43B 3K3OA 2E5VA 3U78A 3GA8A 2X00D 2K9AA 5L3FB 2QGSA 4DV4T 4LMLA 3AA0B 2UXDT 2XSBA 3M65A 1LKXA 1UX4A 2ACZA 4LF4T 3ZCJA 2XTLA 4JBWF 5HEJA 3AXJB 3OBVE 2LRKA 4HN9A 2BR7A 3CK6A 2D0TA 4A97A 2JQHA 1WR0A 2ES0A 3ETUA 4DMWA 5HWXA 3RQWA 4H9QC 3PUZF 4G63A 3PUYF 2Y58A 2X0HA 4QH5A 5JR9B 3CX8B 4G2AA 5HAXA 3O1JA 2ZMAA 4ANJA 1US7B 1HS7A 3U8MA 5L3EB 3N2OA 3WTMA 4QABA 1XWMA 1N32T 1KK7A 5CB4E 4D01A 2WDQA 2VL0A 3NBXX 3UUBA 2ZM2A 3E0ZA 3I0OA 2E2AA 4FRRA 4PK4A 4F6RC 5JRCA 2BKOA 5HCMA 5JTGA 3UUNA 4MBQA 2F4VT 2UZ6A 3C50A 3CMLA 4ZK4A 3ZYLA 2WBLA 3LG7A 4ZS2A 3ZDGA 2CWOA 4V1Av 4WYVA 2IIUA 2W2UA 3PU8A 2W66A 3AEFA 4BA9A 4LFAT 3C4ZA 3P4PA 4I50E 3EHZA 3C79A 4C90A 5LMUT 3FXEB 4U3CA 3C84A 1OEDC 2H3RA 2VVSA 5FJVA 5DJQC 3A5XA 4COFA 5EK4A 1OWAA 4X20E 5TAOA 3IA3A 2A9UA 3QOFA 3H3MA 4AKIA 5LOVE 3ANWA 3N9MA 2ZJUA 3AXJA 4A98A 4WV9A 3CQGB 2YMEA 3HKBE 3UTKA 2Y7YA 3RIUC 5AQKB 3ZKRA 1GQEA 3N9NA 5FNVE 5FY1A 1KNRA 2MTQA 4EZ4A 3SFDA 3WTNA 5FVLA 3H3AA 2LE8A 2P9BA 1YQ3A 2IUBA 2VKJA 4QHOA 2XNTA 3A8YC 1KNZA 5JR9A 4GIWA 3OKQA 2W63A 1FJGT 1ZEEA 4E7ZA 4X64T 5AQVB 1T8BA 1AJ3A 1CUNA 3RYIE 3I0QA 3QUJA 5DQWA 4PJLA 2CRBA 3ZJ1A 4UEMA 3KBTA 1MNDA 4IL4A 4Z90A 1YKEB 1E2AA 2NTXA 5L2LA 5L3GB 3LDQB 4TNVA 4YJ3E 1WRDA 5LB7B 2XPKA 4UY2A 2D0UA 2KSRA 2FJAA 2WWUA 5FL1A 3UU6A 5FL0A 4DV0T 2HPJA 1OEDB 2DLRA 2NW9A 5JDNA 4QXCB 3ZN0B 3WTJA 2BVMA 2UUCT 1UURA 2WAUA 3IGQA 3AEEA 4H9RC 4O2AE 3AAAB 4ADZA 3SRZA 2DWKA 4DBMA 4LFCT 3SWHA 4TZ4C 1X79A 2V26A 3AE9A 5J5GA 2Y54A 2E9XC 2KINB 3FZHB 1MNEA 2XAJB 3VR8A 2RPAA 3QB5K 3TLUA 3KBUA 4JI0T 4YSXA 4AKHA 1XMQT 2XHEB 3ZLIA 4H9SE 5CJ5A 2XQ4A 2W61A 5IYZE 4LF8T 2C5IT 2XYSA 2XZ6A 3B57A 3RX6A 2DHRA 2RP4A 3QK6A 5EK2A 2VK9A 3JC6D 4BFQA 2CLYB 4O4JE 3Q2MA 2L8KA 5J0ZA 3RC8A 2C5KT 3PU3A 3ZMZB 1UW6A 5EZYE 4AXPA 2UXCT 3KVAA 3QC9A 1NWMX 4HQPA 2LRLA 1Z0PA 2PGZA 2XQAA 4M1PA 2PFVA 3EI0A 1BR1A 4TNWA 1I9BA 2VQFT 1XZYA 3HKEE 5LJMA 4PJMA 5JDFA 1MIYA 3AB3B 2IW5B 3AVRA 2KWIB 4ZRUA 3ZJ2A 4AISA 1MIVA 1FMWA 5H6QB 1OEDA 2XQ5A 4MHCA 2UXNB 5AQPB 4EYUA 2LLYA 4H9NC 3UFGA 3WIPA 4QWNB 5L4EA 3EDUA 3GWHA 3D0TA 2W8GA 3ESLA 2V7LA 5ETWA 3WAKA 4LF7T 4HFHA 3OTOT 2WZIA 5CA1E 3IEEA 3WAJA 2NW7A 5CGMA 2E9XB 3N9QA 2IDOB 2YDSA 2BYRA 1ZKEA 2EHOD 1ZHCA 5L47A 3RIUA 2WDRA 2X51A 3MACA 4OK0A 5BMVE 2Q9QD 1SUMB 4KI0F 3UUMA 4OYKA 4DVDA 4AKLA 3OPCA 2BKNA 2XJ7A 2Y8DA 4QAAA 4JYAT 5LBMA 3SS1A 4FJOA 3FZKB 4IHJE 1VCTA 1HG5A 1T7SA 3P8CD 1HF8A 3KINB 3PDYA
chains in the Genus database with same CATH topology
3TLTA 3P4WA 5AFLA 5KZUA 4ALXA 2YMDA 5HEJA 3WTJA 2BYSA 2WZYA 5JMEA 4X5TA 3IGQA 4ZRUA 2XQ3A 4UXUA 5J5FA 2LKGA 5HCJA 5HEGA 2XQ7A 5HEOA 1OEDA 2BG9C 2XQ5A 4AFHA 2LLYA 3RIAA 3UQ7A 4DBMA 4HFIA 2BG9E 5CFBA 3UQ4A 1UV6A 5IUXA 2BR7A 2W8FA 2ZJUA 2BYNA 3WTLA 3WIPA 4EZ1A 4ILCA 5L4EA 4A98A 4HFDA 3RIFA 4A97A 4WV9A 3PMZA 2XZ5A 4ZJTA 2YMEA 5HEHA 5AFKA 4AFGA 2Y7YA 2W8GA 5J5GA 5TVCA 3UU3A 3ZKRA 4B5DA 4UM3S 3RI5A 2Y54A 2Y56A 4UM3A 2XQ8A 5BRXA 4HFHA 2BG9A 5CO5A 5L4HA 4QH4A 2XQ6A 1UX2A 3RQWA 3LSVA 2M6IA 3SQ6A 2Y58A 4BQTA 4COFA 2XQ9A 2BR8A 3TLVA 3SIOA 4TWDA 3JADA 4QH5A 5HEUA 4LMJA 2BYRA 4UM3P 3TLUA 3WTIA 2BG9B 3JAEA 3WTNA 2BYPA 5L47A 3P50A 5AFMB 2XQ4A 4XHEA 2M6BA 2XNUA 2YOEA 3SQ9A 3U8MA 3JAFA 1OEDE 2BJ0A 3UU8A 4TWHA 3WTMA 4QABA 2XNTA 5AINA 2Y57A 2WNJA 4Z91A 5BP0A 4ZZCA 4ZJSA 2XYSA 2XZ6A 2X00A 4D01A 2YKSA 4ZZBA 5J5HA 2VL0A 5AFMA 4QH1A 3UUBA 2PH9A 5J5IA 3RHWA 3U8LA 2LM2A 4NPPA 3WTOA 3GUAA 5AFNA 4HFEA 4ILBA 4BFQA 4IL4A 2LKHA 4Z90A 2WNLA 4FRRA 4UM1A 5HCMA 3UU5A 5AFJA 4LMKA 4NZBA 4PIRA 2UZ6A 2WN9A 2WNCA 4ZK1A 5J0ZA 5BW2A 4ILAA 5SYOA 4IL9A 3TLWA 4ZK4A 4TNVA 3WTKA 3RQUA 5LG3A 4XK9A 3ZDGA 4HFCA 4QAAA 5AFHA 1UW6A 2C9TA 3EAMA 3ZDHA 4F8HA 2QC1B 4QACA 3U8JA 4IREA 4HQPA 4TWFA 2PGZA 2XQAA 2ZJVA 4UY2A 2X00D 2XYTA 3TLSA 3EI0A 3WTHA 5LXBA 3C79A 3T4MA 3EHZA 3PEOA 2KSRA 4ZR6A 3U8KA 4TNWA 1I9BA 3UU4A 3C84A 4HFBA 3SH1A 5KE4A 1OEDC 4LMLA 3UU6A 5FJVA 3U8NA 4AFTA 2BYQA 2MAWA 2YN6A 2XNVA 1OEDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLT A;  3P4W A;  5AFL A;  5KZU A;  4ALX A;  2YMD A;  5HEJ A;  3WTJ A;  2BYS A;  2WZY A;  5JME A;  4X5T A;  3IGQ A;  4ZRU A;  2XQ3 A;  4UXU A;  5J5F A;  2LKG A;  5HCJ A;  5HEG A;  2XQ7 A;  5HEO A;  1OED A;  2BG9 C;  2XQ5 A;  4AFH A;  2LLY A;  3RIA A;  3UQ7 A;  4DBM A;  4HFI A;  2BG9 E;  5CFB A;  3UQ4 A;  1UV6 A;  5IUX A;  2BR7 A;  2W8F A;  2ZJU A;  2BYN A;  3WTL A;  3WIP A;  4EZ1 A;  4ILC A;  5L4E A;  4A98 A;  4HFD A;  3RIF A;  4A97 A;  4WV9 A;  3PMZ A;  2XZ5 A;  4ZJT A;  2YME A;  5HEH A;  5AFK A;  4AFG A;  2Y7Y A;  2W8G A;  5J5G A;  5TVC A;  3UU3 A;  3ZKR A;  4B5D A;  4UM3 S;  3RI5 A;  2Y54 A;  2Y56 A;  4UM3 A;  2XQ8 A;  5BRX A;  4HFH A;  2BG9 A;  5CO5 A;  5L4H A;  4QH4 A;  2XQ6 A;  1UX2 A;  3RQW A;  3LSV A;  2M6I A;  3SQ6 A;  2Y58 A;  4BQT A;  4COF A;  2XQ9 A;  2BR8 A;  3TLV A;  3SIO A;  4TWD A;  3JAD A;  4QH5 A;  5HEU A;  4LMJ A;  2BYR A;  4UM3 P;  3TLU A;  3WTI A;  2BG9 B;  3JAE A;  3WTN A;  2BYP A;  5L47 A;  3P50 A;  5AFM B;  2XQ4 A;  4XHE A;  2M6B A;  2XNU A;  2YOE A;  3SQ9 A;  3U8M A;  3JAF A;  1OED E;  2BJ0 A;  3UU8 A;  4TWH A;  3WTM A;  4QAB A;  2XNT A;  5AIN A;  2Y57 A;  2WNJ A;  4Z91 A;  5BP0 A;  4ZZC A;  4ZJS A;  2XYS A;  2XZ6 A;  2X00 A;  4D01 A;  2YKS A;  4ZZB A;  5J5H A;  2VL0 A;  5AFM A;  4QH1 A;  3UUB A;  2PH9 A;  5J5I A;  3RHW A;  3U8L A;  2LM2 A;  4NPP A;  3WTO A;  3GUA A;  5AFN A;  4HFE A;  4ILB A;  4BFQ A;  4IL4 A;  2LKH A;  4Z90 A;  2WNL A;  4FRR A;  4UM1 A;  5HCM A;  3UU5 A;  5AFJ A;  4LMK A;  4NZB A;  4PIR A;  2UZ6 A;  2WN9 A;  2WNC A;  4ZK1 A;  5J0Z A;  5BW2 A;  4ILA A;  5SYO A;  4IL9 A;  3TLW A;  4ZK4 A;  4TNV A;  3WTK A;  3RQU A;  5LG3 A;  4XK9 A;  3ZDG A;  4HFC A;  4QAA A;  5AFH A;  1UW6 A;  2C9T A;  3EAM A;  3ZDH A;  4F8H A;  2QC1 B;  4QAC A;  3U8J A;  4IRE A;  4HQP A;  4TWF A;  2PGZ A;  2XQA A;  2ZJV A;  4UY2 A;  2X00 D;  2XYT A;  3TLS A;  3EI0 A;  3WTH A;  5LXB A;  3C79 A;  3T4M A;  3EHZ A;  3PEO A;  2KSR A;  4ZR6 A;  3U8K A;  4TNW A;  1I9B A;  3UU4 A;  3C84 A;  4HFB A;  3SH1 A;  5KE4 A;  1OED C;  4LML A;  3UU6 A;  5FJV A;  3U8N A;  4AFT A;  2BYQ A;  2MAW A;  2YN6 A;  2XNV A;  1OED B; 
#chains in the Genus database with same CATH topology
 5DQV A;  5KZU A;  5C2T A;  3ZT5 A;  1OXZ A;  4TV9 E;  4P1N A;  1T72 A;  1UX5 A;  2G0U A;  1W09 A;  3O1H A;  1WLX A;  3MXZ A;  2K3W A;  4HFI A;  2ODU A;  3N2G E;  2J1D G;  1S94 A;  3AE1 A;  3RLF F;  2PBI A;  1LVF A;  5IWA T;  2V1D B;  2FJE A;  1HNZ T;  1SE7 A;  2XQ8 A;  4NUU A;  4YTP A;  4MLK A;  3CWZ B;  5HXR A;  3V5U A;  2LHR A;  2UXB T;  3MKD A;  5ABG A;  3V5S A;  3SIO A;  4OYJ A;  3RPU A;  2X68 A;  2K24 A;  3CX6 B;  1W0A A;  4PW8 A;  2QVA A;  4NIQ A;  2M6B A;  2CBI A;  2E9X A;  2XAG B;  3RF1 A;  2WP9 A;  4U31 A;  2YKS A;  3FHN A;  5AQS B;  1R8I A;  4QH1 A;  4ZI2 D;  4HFE A;  2VQE T;  3OVU A;  4GK5 E;  4UM1 A;  3C4X A;  3EAB A;  1SA0 E;  4DV5 T;  4EV6 A;  4AI6 A;  3L09 A;  3BQL A;  3ZT6 A;  5HWY A;  3KDS E;  4ZI7 E;  5EK3 A;  2D9D A;  1W0B A;  3P4S A;  3VKH A;  2CEA A;  1KEY A;  1D0Y A;  3LK2 B;  4AFT A;  2OV9 A;  1LRZ A;  3KVB A;  1W9R A;  1JNZ A;  2Z6E A;  3CPZ A;  2CE7 A;  3P7I A;  5JDQ A;  4X5T A;  3O4X E;  2KND A;  4AFH A;  2YDR A;  4HWI B;  1I6Z A;  2BYN A;  5FMN A;  4QXH B;  3PMZ A;  2NP9 A;  5HEH A;  4DR3 T;  3AE6 A;  1HFA A;  3ANW B;  3HA4 A;  3AEG A;  4UM3 A;  5AQT B;  4UR9 A;  3HKC E;  4LF9 T;  4EZH A;  3ONX A;  4JI1 T;  3LSV A;  2JJ9 A;  3Q5W A;  4BQT A;  3ONJ A;  3RRW A;  2WZH A;  2XAH B;  3NWI A;  2FBW A;  3JAE A;  4HEA A;  2UXX B;  4JI5 T;  2IHR 1;  2DL1 A;  2YEV C;  1DU2 A;  1YW0 A;  2QYW A;  2W00 A;  2LT3 A;  5AQL B;  3MZK B;  3L3P A;  4UVC B;  4AIU A;  3GUA A;  2WS3 A;  4Z8X A;  4CI1 B;  3HR0 A;  4U74 A;  4JI3 T;  4DV1 T;  4ERR A;  4PIR A;  1D1A A;  2V8S V;  4ZXL A;  3EAM A;  3RH3 A;  3AEC A;  3NVO A;  2XYT A;  5C8Y E;  5FXV A;  2HHH T;  4NUV A;  4TN7 B;  2Y6X A;  3ZN1 B;  3C4W A;  4UVB B;  4CI2 B;  2WMN A;  3PUX F;  5LHH B;  1J5W A;  1Z8U A;  2GK9 A;  1EZ3 A;  4LF6 T;  3ZMT B;  2HN1 A;  4HFV A;  4U7Y A;  4EIW A;  4DV7 T;  2B76 A;  4PK5 A;  2CA5 A;  3ZPO A;  2KMF A;  3ZEF B;  1UGO A;  3QNU A;  4FI5 A;  4JEH B;  4KHP T;  3MA9 A;  4IDQ A;  2LEH A;  3KV6 A;  4UM3 P;  2VKH A;  4C91 A;  1D0Z A;  2VB6 A;  2OA5 A;  3B13 A;  5LYJ E;  3N9P A;  3UUX B;  1ZP0 A;  1D0X A;  1QSD A;  4X66 T;  1BR4 A;  2WNJ A;  2JPF A;  5LGN B;  2JQ9 A;  2DCF A;  3TKL B;  4DV6 T;  2A72 A;  4ZZB A;  3NRY A;  4JI7 T;  3U8L A;  2WDV A;  2WNL A;  3RRC A;  2HH7 A;  4IE5 A;  4UIG A;  3TLW A;  2C5J A;  2CWY A;  2HPL A;  2CPT A;  4IE0 A;  5LMN T;  2YK0 A;  4F8H A;  3S4U A;  3UT5 E;  2WM9 A;  4UF0 A;  2XM2 A;  4ZR6 A;  3ETV A;  3U8N A;  2VKD A;  2MAW A;  2YMD A;  2XNV A;  3RGL A;  3KV4 A;  5C3J A;  4N78 D;  4B3M T;  3CKD A;  1QUU A;  1HX8 A;  4UXU A;  5AFU L;  3ZYM A;  4WZX A;  4KX6 A;  1HR0 T;  3F2E A;  3R6N A;  4L0R A;  3UQ4 A;  3AED A;  4P0B A;  2LSK A;  5LA6 E;  2XZ5 A;  2JMK A;  1IBL T;  1J1J A;  1KNP A;  2Y56 A;  1E7P A;  5BRX A;  2CHO A;  3CQX C;  5L4H A;  2MOZ A;  2VUR A;  3ONL C;  2CBJ A;  3C51 A;  5AQM B;  1WYC A;  4YJ2 E;  2WU5 A;  3AAE B;  2E8I A;  2B1E A;  4YSY A;  3HI2 A;  3Q5X A;  2YOE A;  2WU2 A;  4DBQ A;  5AIN A;  1YXR A;  4IST A;  4ZZC A;  5LJN A;  4JI4 T;  1X9B A;  2XAF B;  3VU7 H;  3PUV F;  4JV5 T;  4DND A;  4ILU A;  3N9O A;  2BBH A;  3ZC1 A;  3HKD E;  2XAQ B;  3EUH A;  2BKP A;  3UU5 A;  4LMK A;  4YXD A;  2K5B B;  2PJQ A;  3K1S A;  4ASK A;  4TX5 A;  4IGU A;  3BQK A;  5F5W A;  4TUY E;  3PEO A;  5LHI B;  5AQR B;  3UU4 A;  4HFB A;  2I59 A;  5AFL A;  2V7M A;  4ALX A;  3G06 A;  2LOP A;  2N9D A;  1O3X A;  4DMV A;  4CN6 A;  1IBM T;  4O4I E;  5HCJ A;  5HEG A;  5F3J A;  2BG9 C;  4DR7 T;  2ZM0 A;  5IUX A;  5J1G A;  3WTL A;  2K48 A;  4O2B E;  3MJX A;  4DV2 T;  3OYX A;  5FY7 A;  3F57 A;  4CN1 A;  3I9W A;  2H89 A;  3UU3 A;  3RC3 A;  5GON E;  1Y01 A;  5CO5 A;  3VKG A;  5FXX A;  2YU2 A;  2QRX A;  2BR8 A;  3TLV A;  4IE6 A;  3JAD A;  4HWF A;  3DP7 A;  2XZE A;  4CN4 A;  3P50 A;  3SQ9 A;  4ZOL E;  5DAB A;  3HL6 A;  2WSS V;  3VHL A;  3UU8 A;  4IDZ A;  2LSG A;  2W67 A;  2WMO A;  3ZMS B;  2FUP A;  3ZSS A;  2X00 A;  3PJA J;  3RHW A;  3WTO A;  1FEW A;  1IBK T;  2DWG A;  2LKH A;  1YQ4 A;  2KXP B;  5AQO B;  3CX7 B;  4UVA B;  3NRX A;  3IF8 B;  1V9D A;  2OLT A;  4QAC A;  4PJJ A;  3PV0 F;  5JDG A;  5F8P A;  3FZF B;  1HX1 B;  3VRB A;  3L39 A;  3SH1 A;  3AE4 A;  4HGA A;  2XQ3 A;  1HNX T;  1T98 A;  4GKJ T;  2MPK A;  5AQQ B;  3E08 A;  2LOS A;  2WZY A;  5JME A;  4PFP A;  2V6Y B;  1N34 T;  5L3B B;  4ZI3 D;  2V7I A;  4IDP A;  4IT4 A;  2V5C A;  4X1K E;  3JC6 C;  3CQC B;  3JCF A;  1SHZ C;  4B3T T;  1D1C A;  1S35 A;  2CCQ A;  2VL8 A;  4KHZ F;  5LXT E;  4PNI A;  2BDE A;  4QX8 B;  1KF6 A;  5AQN B;  4EXT A;  4QXB B;  4DO0 A;  3NZQ A;  3X1D A;  3EVY A;  3LFM A;  3KV5 A;  3JAF A;  2CHN A;  4TWH A;  1D1B A;  2IML A;  4ZEY A;  4DID B;  3SOL A;  2X67 A;  5J5I A;  3OYZ A;  4ISS A;  4ILB A;  4YFS A;  4BJM A;  5L3D B;  2BZB A;  3O9X A;  2ODV A;  3LK4 2;  5BW2 A;  5HXC A;  4WBN E;  3WTK A;  3ZC0 A;  1BR2 A;  3PTR B;  2XQY A;  4K0U A;  4JI2 T;  5AQJ B;  2LM9 A;  4TV8 E;  4CQI A;  5KE4 A;  5AQI B;  4XAX B;  4NXM T;  3N5L A;  4B6X A;  3PUQ A;  2EHO C;  3N2K E;  3PJA A;  3K3N A;  3I9Y A;  4AQF C;  2KWH A;  3ZT7 A;  3AE5 A;  2Q9Q C;  4HE8 A;  5FKY A;  2J4G A;  1BR0 A;  3RIA A;  2CM0 A;  3UQ7 A;  2PTF A;  2H7V C;  2V6Y A;  2X9H A;  3AEB A;  2UUB T;  1HCI A;  4HWH A;  3RKO A;  3T1Y T;  5LNK A;  4QX7 B;  2W4X A;  2BG9 A;  1HG2 A;  2XY8 B;  2J62 A;  3ABV A;  3KV9 A;  1VCS A;  3GMI A;  1MMA A;  5H6R B;  5LG4 A;  1IJ6 A;  4UV9 B;  5JDL A;  3PUG A;  2LM2 A;  4I4T E;  4JLE A;  4X65 T;  2LSI A;  5KX5 E;  4YY3 T;  5LP6 E;  2A3D A;  3E22 E;  5FYM A;  1XDP A;  2ZM6 T;  4O4L E;  3QB5 A;  4AQG A;  2WNC A;  4ILA A;  4YT0 A;  4U72 A;  3Q5D A;  2LHN A;  4HFC A;  1U5P A;  3CIR A;  4U7I A;  1UCU A;  4IRE A;  4TWF A;  4X62 T;  5LXB A;  4UEL A;  4U33 A;  3LBX A;  3F31 A;  5LGU B;  5AQU B;  4H9P C;  3UFE A;  2V7J A;  1J5E T;  2BG9 E;  4JUY A;  3P4W A;  4UF0 B;  2X9W A;  2EHO B;  4QKN A;  4E7S A;  5HXE A;  3OJA A;  4KP3 C;  2WCA A;  2QA7 A;  3CVR A;  3Q5E A;  2Q9Q B;  1IJ5 A;  3IHR A;  3FZL B;  5KDM C;  1QLB A;  5CFB A;  1UV6 A;  2NOX A;  4ZI2 C;  5ABE A;  2L9Q A;  4ILC A;  3R84 B;  2NTY A;  2XUE A;  5TVC A;  3J7Y q;  4EOZ B;  1UUS A;  3RI5 A;  4DR4 T;  2JQQ A;  2VAS A;  2XQ6 A;  1UX2 A;  1XNQ T;  2M6I A;  3KFW X;  5HXH A;  2VWA A;  4EED A;  3A7M A;  4DUY T;  2WB5 A;  5FVK A;  2FJB A;  2XNU A;  5L3C B;  4X1I E;  3FBZ A;  5J5H A;  4NPP A;  4Q25 A;  3FB2 A;  2V5D A;  4JI8 T;  4NZB A;  5ABF B;  2X0L B;  4PAG A;  4UXN B;  2WQY A;  3RQU A;  4XK9 A;  3K8P C;  2E9X D;  2BS4 A;  2QC1 B;  2WWV A;  3LK3 B;  4CXW A;  2D5U A;  2MBG A;  2JQK A;  4EYY R;  3ZMV B;  3FXD B;  4LF5 T;  2V7K A;  4CXY A;  1WCR A;  4YTM A;  3PUS A;  5J5F A;  3DJB A;  5HEO A;  1WFD A;  5KXJ A;  2ZM8 A;  3VR9 A;  4WNK A;  4WBO A;  5AQF B;  5JQG E;  2W8F A;  5FXW A;  2EHO A;  3DTO A;  3ZST A;  5LCY A;  4AQF A;  4GKK T;  4ZJT A;  3AE3 A;  3PUW F;  5AFK A;  3NKZ A;  3W15 B;  2Q9Q A;  3PE0 A;  1UK5 A;  4AKG A;  2BS3 A;  5ADX L;  1IAP A;  1M7K A;  4U2Z A;  2CLY C;  3ZMU B;  2LSY A;  3SQ6 A;  4A5X A;  4OFZ A;  5LGT B;  4PK6 A;  3UUL A;  2FJD A;  5LHG B;  3N9L A;  2YIN A;  2BJ0 A;  2AE9 A;  4DR2 T;  1LVK A;  2Y57 A;  2W0G A;  3K3Q C;  5KMG P;  3ZCI A;  5AFN A;  4L9I A;  4MFR A;  5AFJ A;  4ZK1 A;  4J2C A;  2CMR A;  3I1A A;  4KMC A;  3U8J A;  1IZN B;  2ZJV A;  3WI3 A;  3WTH A;  3B5M A;  5A1L A;  2DNX A;  3BQI A;  5ABF A;  2E5L T;  1MMG A;  4PJN A;  3U8K A;  3RYH E;  4DV3 T;  4L5G A;  2YN6 A;  1WR6 A;  3TLT A;  4NXN T;  1FMV A;  3P4R A;  3AAI A;  2V6X A;  3FBL A;  1XDO A;  1VRB A;  3LJC A;  4I0U A;  5LBQ B;  4CXX A;  2JIW A;  4JEU B;  5HYA A;  1VOM A;  2AXD S;  2XQ7 A;  4EGW A;  4HKA A;  4AKR B;  3AE2 A;  1ZV4 X;  3H37 A;  3T1H T;  3RIF A;  4IIJ E;  1B7T A;  4ZS3 A;  3RYF E;  4OX9 T;  4KBM B;  4B5D A;  2XAS B;  3AA6 B;  2BVL A;  4O8S A;  2LJL A;  1I94 T;  3AE7 A;  5AQG B;  4IDN A;  2XQ9 A;  5J2U E;  3SFE A;  3AA7 B;  4TWD A;  4LMJ A;  3L8R A;  1YKH B;  4YHJ A;  4XHE A;  1ZOY A;  4EAH A;  3MK7 C;  4IDO A;  2XSA A;  3GN5 B;  1G8X A;  4HTE A;  4ZJS A;  3P4Q A;  2M67 A;  1FIO A;  4UV8 B;  4PFO A;  3C98 B;  2XM1 A;  4I55 E;  4MAL A;  2UUA T;  2VVN A;  2WN9 A;  2NWB A;  1MMN A;  5JDM A;  4EB6 E;  5ABH A;  5LG3 A;  3ZDH A;  2C9T A;  3O1I A;  1H7C A;  2X66 A;  4P0A A;  5HXS A;  3T4M A;  2JRK A;  5FP3 A;  5JDH A;  2KLQ A;  1WYB A;  4XBF B;  4IE4 A;  4DBR A;  4DUZ T;  2H7O A;  2VKO A;  4HFD A;  3RKG A;  2YU1 A;  4GOU A;  4AFG A;  3FZM B;  5JRE A;  1N33 T;  4EEB A;  1XMO T;  2J47 A;  4UM3 S;  3PUA A;  1KFY A;  2WY2 A;  4P09 A;  4BJN A;  5CA0 E;  4GYR A;  1M62 A;  2KZ7 B;  3NZP A;  4H63 H;  4AQY T;  5HEU A;  4YSZ A;  3WTI A;  2BG9 B;  2X0Y A;  4KUM B;  4YTN A;  2BYP A;  1U4Q A;  2I0M A;  1HTJ F;  5AFM B;  2MYS A;  2PG8 A;  2BS2 A;  3AEA A;  1OED E;  4U2Y A;  4JI6 T;  5BR8 T;  5FXZ A;  4Z91 A;  3ZYK A;  3M3Z B;  4WW0 A;  4YLH A;  1N36 T;  2X9X A;  2JMH A;  1MMD A;  2R6G F;  2X9Y A;  2PH9 A;  4BAY B;  2UU9 T;  2IC9 A;  4B3R T;  4LFB T;  1NEN A;  1NAF A;  3GN5 A;  2CXD A;  1E1H B;  1JNR A;  3AVS A;  2DI4 A;  1XNR T;  4O4H E;  5SYO A;  4IL9 A;  4OHF A;  4HWD A;  4DR5 T;  1MIW A;  5AFH A;  2IC6 A;  3EDV A;  4H63 V;  4ZHQ E;  3TLS A;  4GYS A;  5E0O A;  2IAK A;  2NW8 A;  2BBJ A;  1NEK A;  2BYQ A;  1Y64 B;  4IE7 A;  3Q9D A;  4K0K T;  2H88 A;  3LBX B;  2BYS A;  5JVD E;  5JH7 E;  5J2T E;  3PUR A;  2LKG A;  3AA1 B;  1CHU A;  4A56 A;  4DR6 T;  2W62 A;  4EZ1 A;  2ACX A;  4XZC A;  2D2S A;  2N1G A;  2LSJ A;  1HNW T;  4CZZ B;  3VRA A;  3J9X 1;  2YDQ A;  4QH4 A;  4DR1 T;  4YHH T;  2I6H A;  2SPC A;  3IBP A;  5JR9 C;  4GK0 E;  2N2N A;  2Y48 B;  1L0V A;  5M4Y A;  3BK9 A;  5FY0 A;  3U3I A;  4B3S T;  4H9O C;  2CXF A;  3AE8 A;  5JRC B;  3C64 A;  5IHY A;  5BP0 A;  2C0S A;  5AFM A;  4CI3 B;  4ZI3 C;  1G73 A;  5AQH B;  2NR4 A;  2L3L A;  2CXL A;  2RA1 A;  4HWC A;  4X1Y E;  2KT9 A;  2HN2 A;  2A2F X;  1YD8 G;  2ZLY A;  3T8O A;  3RYC E;  4I43 B;  3K3O A;  2E5V A;  3U78 A;  3GA8 A;  2X00 D;  2K9A A;  5L3F B;  2QGS A;  4DV4 T;  4LML A;  3AA0 B;  2UXD T;  2XSB A;  3M65 A;  1LKX A;  1UX4 A;  2ACZ A;  4LF4 T;  3ZCJ A;  2XTL A;  4JBW F;  5HEJ A;  3AXJ B;  3OBV E;  2LRK A;  4HN9 A;  2BR7 A;  3CK6 A;  2D0T A;  4A97 A;  2JQH A;  1WR0 A;  2ES0 A;  3ETU A;  4DMW A;  5HWX A;  3RQW A;  4H9Q C;  3PUZ F;  4G63 A;  3PUY F;  2Y58 A;  2X0H A;  4QH5 A;  5JR9 B;  3CX8 B;  4G2A A;  5HAX A;  3O1J A;  2ZMA A;  4ANJ A;  1US7 B;  1HS7 A;  3U8M A;  5L3E B;  3N2O A;  3WTM A;  4QAB A;  1XWM A;  1N32 T;  1KK7 A;  5CB4 E;  4D01 A;  2WDQ A;  2VL0 A;  3NBX X;  3UUB A;  2ZM2 A;  3E0Z A;  3I0O A;  2E2A A;  4FRR A;  4PK4 A;  4F6R C;  5JRC A;  2BKO A;  5HCM A;  5JTG A;  3UUN A;  4MBQ A;  2F4V T;  2UZ6 A;  3C50 A;  3CML A;  4ZK4 A;  3ZYL A;  2WBL A;  3LG7 A;  4ZS2 A;  3ZDG A;  2CWO A;  4V1A v;  4WYV A;  2IIU A;  2W2U A;  3PU8 A;  2W66 A;  3AEF A;  4BA9 A;  4LFA T;  3C4Z A;  3P4P A;  4I50 E;  3EHZ A;  3C79 A;  4C90 A;  5LMU T;  3FXE B;  4U3C A;  3C84 A;  1OED C;  2H3R A;  2VVS A;  5FJV A;  5DJQ C;  3A5X A;  4COF A;  5EK4 A;  1OWA A;  4X20 E;  5TAO A;  3IA3 A;  2A9U A;  3QOF A;  3H3M A;  4AKI A;  5LOV E;  3ANW A;  3N9M A;  2ZJU A;  3AXJ A;  4A98 A;  4WV9 A;  3CQG B;  2YME A;  3HKB E;  3UTK A;  2Y7Y A;  3RIU C;  5AQK B;  3ZKR A;  1GQE A;  3N9N A;  5FNV E;  5FY1 A;  1KNR A;  2MTQ A;  4EZ4 A;  3SFD A;  3WTN A;  5FVL A;  3H3A A;  2LE8 A;  2P9B A;  1YQ3 A;  2IUB A;  2VKJ A;  4QHO A;  2XNT A;  3A8Y C;  1KNZ A;  5JR9 A;  4GIW A;  3OKQ A;  2W63 A;  1FJG T;  1ZEE A;  4E7Z A;  4X64 T;  5AQV B;  1T8B A;  1AJ3 A;  1CUN A;  3RYI E;  3I0Q A;  3QUJ A;  5DQW A;  4PJL A;  2CRB A;  3ZJ1 A;  4UEM A;  3KBT A;  1MND A;  4IL4 A;  4Z90 A;  1YKE B;  1E2A A;  2NTX A;  5L2L A;  5L3G B;  3LDQ B;  4TNV A;  4YJ3 E;  1WRD A;  5LB7 B;  2XPK A;  4UY2 A;  2D0U A;  2KSR A;  2FJA A;  2WWU A;  5FL1 A;  3UU6 A;  5FL0 A;  4DV0 T;  2HPJ A;  1OED B;  2DLR A;  2NW9 A;  5JDN A;  4QXC B;  3ZN0 B;  3WTJ A;  2BVM A;  2UUC T;  1UUR A;  2WAU A;  3IGQ A;  3AEE A;  4H9R C;  4O2A E;  3AAA B;  4ADZ A;  3SRZ A;  2DWK A;  4DBM A;  4LFC T;  3SWH A;  4TZ4 C;  1X79 A;  2V26 A;  3AE9 A;  5J5G A;  2Y54 A;  2E9X C;  2KIN B;  3FZH B;  1MNE A;  2XAJ B;  3VR8 A;  2RPA A;  3QB5 K;  3TLU A;  3KBU A;  4JI0 T;  4YSX A;  4AKH A;  1XMQ T;  2XHE B;  3ZLI A;  4H9S E;  5CJ5 A;  2XQ4 A;  2W61 A;  5IYZ E;  4LF8 T;  2C5I T;  2XYS A;  2XZ6 A;  3B57 A;  3RX6 A;  2DHR A;  2RP4 A;  3QK6 A;  5EK2 A;  2VK9 A;  3JC6 D;  4BFQ A;  2CLY B;  4O4J E;  3Q2M A;  2L8K A;  5J0Z A;  3RC8 A;  2C5K T;  3PU3 A;  3ZMZ B;  1UW6 A;  5EZY E;  4AXP A;  2UXC T;  3KVA A;  3QC9 A;  1NWM X;  4HQP A;  2LRL A;  1Z0P A;  2PGZ A;  2XQA A;  4M1P A;  2PFV A;  3EI0 A;  1BR1 A;  4TNW A;  1I9B A;  2VQF T;  1XZY A;  3HKE E;  5LJM A;  4PJM A;  5JDF A;  1MIY A;  3AB3 B;  2IW5 B;  3AVR A;  2KWI B;  4ZRU A;  3ZJ2 A;  4AIS A;  1MIV A;  1FMW A;  5H6Q B;  1OED A;  2XQ5 A;  4MHC A;  2UXN B;  5AQP B;  4EYU A;  2LLY A;  4H9N C;  3UFG A;  3WIP A;  4QWN B;  5L4E A;  3EDU A;  3GWH A;  3D0T A;  2W8G A;  3ESL A;  2V7L A;  5ETW A;  3WAK A;  4LF7 T;  4HFH A;  3OTO T;  2WZI A;  5CA1 E;  3IEE A;  3WAJ A;  2NW7 A;  5CGM A;  2E9X B;  3N9Q A;  2IDO B;  2YDS A;  2BYR A;  1ZKE A;  2EHO D;  1ZHC A;  5L47 A;  3RIU A;  2WDR A;  2X51 A;  3MAC A;  4OK0 A;  5BMV E;  2Q9Q D;  1SUM B;  4KI0 F;  3UUM A;  4OYK A;  4DVD A;  4AKL A;  3OPC A;  2BKN A;  2XJ7 A;  2Y8D A;  4QAA A;  4JYA T;  5LBM A;  3SS1 A;  4FJO A;  3FZK B;  4IHJ E;  1VCT A;  1HG5 A;  1T7S A;  3P8C D;  1HF8 A;  3KIN B;  3PDY A; 
#chains in the Genus database with same CATH homology
 3TLT A;  3P4W A;  5AFL A;  5KZU A;  4ALX A;  2YMD A;  5HEJ A;  3WTJ A;  2BYS A;  2WZY A;  5JME A;  4X5T A;  3IGQ A;  4ZRU A;  2XQ3 A;  4UXU A;  5J5F A;  2LKG A;  5HCJ A;  5HEG A;  2XQ7 A;  5HEO A;  1OED A;  2BG9 C;  2XQ5 A;  4AFH A;  2LLY A;  3RIA A;  3UQ7 A;  4DBM A;  4HFI A;  2BG9 E;  5CFB A;  3UQ4 A;  1UV6 A;  5IUX A;  2BR7 A;  2W8F A;  2ZJU A;  2BYN A;  3WTL A;  3WIP A;  4EZ1 A;  4ILC A;  5L4E A;  4A98 A;  4HFD A;  3RIF A;  4A97 A;  4WV9 A;  3PMZ A;  2XZ5 A;  4ZJT A;  2YME A;  5HEH A;  5AFK A;  4AFG A;  2Y7Y A;  2W8G A;  5J5G A;  5TVC A;  3UU3 A;  3ZKR A;  4B5D A;  4UM3 S;  3RI5 A;  2Y54 A;  2Y56 A;  4UM3 A;  2XQ8 A;  5BRX A;  4HFH A;  2BG9 A;  5CO5 A;  5L4H A;  4QH4 A;  2XQ6 A;  1UX2 A;  3RQW A;  3LSV A;  2M6I A;  3SQ6 A;  2Y58 A;  4BQT A;  4COF A;  2XQ9 A;  2BR8 A;  3TLV A;  3SIO A;  4TWD A;  3JAD A;  4QH5 A;  5HEU A;  4LMJ A;  2BYR A;  4UM3 P;  3TLU A;  3WTI A;  2BG9 B;  3JAE A;  3WTN A;  2BYP A;  5L47 A;  3P50 A;  5AFM B;  2XQ4 A;  4XHE A;  2M6B A;  2XNU A;  2YOE A;  3SQ9 A;  3U8M A;  3JAF A;  1OED E;  2BJ0 A;  3UU8 A;  4TWH A;  3WTM A;  4QAB A;  2XNT A;  5AIN A;  2Y57 A;  2WNJ A;  4Z91 A;  5BP0 A;  4ZZC A;  4ZJS A;  2XYS A;  2XZ6 A;  2X00 A;  4D01 A;  2YKS A;  4ZZB A;  5J5H A;  2VL0 A;  5AFM A;  4QH1 A;  3UUB A;  2PH9 A;  5J5I A;  3RHW A;  3U8L A;  2LM2 A;  4NPP A;  3WTO A;  3GUA A;  5AFN A;  4HFE A;  4ILB A;  4BFQ A;  4IL4 A;  2LKH A;  4Z90 A;  2WNL A;  4FRR A;  4UM1 A;  5HCM A;  3UU5 A;  5AFJ A;  4LMK A;  4NZB A;  4PIR A;  2UZ6 A;  2WN9 A;  2WNC A;  4ZK1 A;  5J0Z A;  5BW2 A;  4ILA A;  5SYO A;  4IL9 A;  3TLW A;  4ZK4 A;  4TNV A;  3WTK A;  3RQU A;  5LG3 A;  4XK9 A;  3ZDG A;  4HFC A;  4QAA A;  5AFH A;  1UW6 A;  2C9T A;  3EAM A;  3ZDH A;  4F8H A;  2QC1 B;  4QAC A;  3U8J A;  4IRE A;  4HQP A;  4TWF A;  2PGZ A;  2XQA A;  2ZJV A;  4UY2 A;  2X00 D;  2XYT A;  3TLS A;  3EI0 A;  3WTH A;  5LXB A;  3C79 A;  3T4M A;  3EHZ A;  3PEO A;  2KSR A;  4ZR6 A;  3U8K A;  4TNW A;  1I9B A;  3UU4 A;  3C84 A;  4HFB A;  3SH1 A;  5KE4 A;  1OED C;  4LML A;  3UU6 A;  5FJV A;  3U8N A;  4AFT A;  2BYQ A;  2MAW A;  2YN6 A;  2XNV A;  1OED B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...