5L47A

X-ray structure of the 2-22' locally-closed mutant of glic in complex with cyanoselenobarbital (seleniated barbiturate)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
source organism Gloeobacter
total genus 88
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l47A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l47A01
4NZBA 4DBMA 3TLTA 3UQ4A 3GUAA 3SQ9A 4AFHA 2WZYA 4WV9A 2XQ9A 5L4HA 5L4EA 5HCJA 4ZR6A 2M6IA 2Y56A 4HFEA 1OEDE 5AFNA 5AFMA 4TWHA 3TLWA 4XHEA 2ZJUA 5LG3A 2BR7A 3PMZA 3RHWA 3U8MA 4ALXA 3IGQA 3P50A 5KZUA 2WNCA 1UV6A 3UU6A 2BG9B 5J0ZA 3P4WA 4BQTA 3WTNA 4QAAA 3ZDGA 4Z90A 2XNUA 3WTIA 4HFDA 4UM3A 4UM1A 4TNVA 4ZRUA 2PH9A 3U8LA 5IUXA 4IL9A 4NPPA 2WNLA 3C79A 3TLUA 3UUBA 2BYNA 2YMEA 4ZK4A 3JAEA 4BFQA 2LLYA 3RQUA 3SIOA 3WTKA 3WIPA 2Y7YA 2WNJA 2YOEA 2YMDA 4AFTA 2C9TA 3WTJA 4X5TA 2YKSA 4HFBA 1OEDC 5HEOA 3UU3A 4COFA 5AFJA 5AFKA 2QC1B 2Y58A 2ZJVA 4Z91A 5BW2A 4UXUA 4QABA 3JAFA 2LKHA 2XQ8A 4QH1A 3RIFA 4LMJA 2BG9A 3PEOA 3ZDHA 3RIAA 4IL4A 3RI5A 2BR8A 5J5IA 2XQ4A 4PIRA 2BYQA 2XZ6A 4D01A 3T4MA 4ZK1A 4HQPA 4TNWA 4HFIA 5FJVA 4TWFA 4LMKA 2X00D 4AFGA 2XNTA 2Y57A 4B5DA 3SQ6A 5BP0A 5BRXA 5J5FA 2LM2A 4QH5A 5JMEA 3JADA 2BG9E 4HFHA 2UZ6A 4XK9A 4ZJSA 3LSVA 4IREA 3WTOA 2W8GA 5HEJA 3UU4A 2BYRA 2PGZA 5HCMA 2XQAA 2MAWA 5J5HA 3UQ7A 3UU5A 2XQ7A 4UM3P 3WTHA 5HEGA 5LXBA 3C84A 5AFHA 4ILAA 2VL0A 5HEHA 5CO5A 3U8NA 4QH4A 5HEUA 3TLSA 3ZKRA 3EI0A 2WN9A 2BYSA 2XQ5A 3RQWA 2XYTA 2XYSA 2XZ5A 3WTMA 2Y54A 2W8FA 4FRRA 3EAMA 4ZZBA 1I9BA 4LMLA 4EZ1A 4ZZCA 4ILBA 5AINA 2XQ6A 5AFMB 3TLVA 4UY2A 3WTLA 3U8KA 4F8HA 3SH1A 1OEDB 1OEDA 2LKGA 3U8JA 2BYPA 5KE4A 4ZJTA 2BJ0A 4ILCA 4A97A 5TVCA 2KSRA 5CFBA 1UX2A 2XQ3A 5L47A 5J5GA 5AFLA 2X00A 2XNVA 2BG9C 3EHZA 2M6BA 1UW6A 3UU8A 4QACA 5SYOA 4HFCA 4UM3S 4A98A 4TWDA 2YN6A
chains in the Genus database with same CATH superfamily
1I94T 5CB4E 4U33A 4B3ST 2BS3A 2WB5A 3KFWX 2BR7A 2Z6EA 5J1GA 5AQGB 3FXEB 4GYSA 2V8SV 3J9X1 2BZBA 1V9DA 3KINB 1J5WA 4ZK4A 4XBFB 2V7LA 2D9DA 1HX1B 1MIWA 5ABFB 2LJLA 3H3MA 3OKQA 2YOEA 1T8BA 2WDRA 4HFBA 2JQHA 2BKOA 1XDPA 3E08A 4UF0A 3TKLB 5ABEA 2D0TA 4O4LE 5LG4A 4O2BE 5LMUT 5J5IA 2WMNA 3VR9A 2YDQA 4ANJA 3UUXB 2E5VA 2FJDA 5FJVA 1WRDA 4HFVA 5JMEA 5JDQA 3OJAA 1IAPA 2JPFA 4ZS2A 1UURA 1HF8A 2J1DG 5LXBA 2XM2A 4MFRA 4PNIA 2DCFA 4X64T 2DLRA 1UCUA 1M7KA 3ZN1B 2CXFA 4YTPA 1OEDA 2KSRA 1YKHB 4IDNA 5J5GA 5JQGE 3HA4A 4JI2T 3RKOA 4UR9A 2FJEA 3FZLB 2XQ9A 4HWHA 2LSKA 2VKOA 1D1BA 5AQTB 5F5WA 4DR2T 2I6HA 1UGOA 1SHZC 3LK42 3N9NA 3Q5EA 3ZMVB 3H3AA 2KMFA 3OPCA 2VQET 3K1SA 5KMGP 5KXJA 3WTJA 4PFPA 1SE7A 4MALA 5HEOA 3UU3A 4ADZA 3C98B 5LGTB 3P4QA 5LMNT 3N2OA 2E5LT 3AVSA 2CA5A 3U3IA 5HXEA 2BR8A 2XQ4A 2HPJA 2W66A 4JBWF 5ETWA 5EK3A 5BRXA 3RYIE 3QK6A 3ZC1A 3T1YT 2J47A 4K0KT 4U7IA 5FYMA 2LSGA 5LOVE 4ZHQE 5LBQB 4O4IE 1FMVA 3PUAA 5HEUA 1ZP0A 3EI0A 2WN9A 4IE7A 4EEBA 4AKIA 4CQIA 2KNDA 3ZYKA 3V5SA 2CE7A 3WAKA 3Q5WA 3Q5DA 5LHIB 4TUYE 3P4PA 2OLTA 1EZ3A 4UV8B 4WV9A 1ZKEA 4IIJE 3PMZA 1MIVA 2QYWA 3AE5A 4IT4A 1Y01A 1BR0A 5J0ZA 1WFDA 2X0LB 1XNQT 2MYSA 4H9PC 4UM1A 2A2FX 2H7OA 4JYAT 3PUVF 4PK4A 3IHRA 4ISTA 4N78D 2C9TA 3Q2MA 3RYFE 3C4WA 1VOMA 4CI2B 1E7PA 1HX8A 3MJXA 2QGSA 3ZDHA 3O1HA 1CUNA 2IMLA 2K9AA 2BS2A 4LF7T 4HTEA 4X65T 2IC6A 1BR2A 4P0BA 4CI3B 1ZHCA 4OYJA 3I9WA 3JADA 3L09A 2XAQB 4X62T 1KEYA 1W09A 1IJ6A 2B76A 3AE1A 5FVLA 4ILAA 2H3RA 3OBVE 4AQYT 4H9OC 1NWMX 3T8OA 2V7KA 3NVOA 4B3RT 2WMOA 2HN2A 1UK5A 4B3MT 4UY2A 1VRBA 4FI5A 4YHHT 1XDOA 5JR9A 3R84B 3SRZA 4TWDA 4NZBA 3MACA 4AFHA 3CK6A 3ANWA 5L4HA 4UXNB 5HCJA 3K3OA 4YT0A 2CLYB 3TLWA 4QXBB 1T98A 2WNCA 3MKDA 5LHGB 2BDEA 1KFYA 5AQHB 1N34T 2ODVA 3E0ZA 4WBNE 2BBHA 4NPPA 3CX8B 4BFQA 4I55E 3SIOA 3WIPA 4DR1T 2CXDA 2YKSA 1LRZA 3LDQB 5LGUB 5AFKA 5JH7E 2ZJVA 4UXUA 4KHZF 1WLXA 2LKHA 1LVKA 3K8PC 4DV3T 5AQVB 3ZT5A 1H7CA 4WW0A 5AFUL 1E1HB 5FY0A 3O4XE 5LNKA 3ZT7A 3ZMZB 3SQ6A 2J4GA 2CPTA 4G63A 2WBLA 3AEBA 4LF4T 5EK2A 3ZYMA 2XQ7A 5HAXA 5FMNA 2W67A 4UEMA 3O1IA 5CO5A 4PAGA 5E0OA 3BQLA 1Z8UA 4I43B 3AE8A 2EHOD 5IHYA 4LMLA 4ILBA 3WTLA 2CMRA 3SH1A 3WAJA 3UUNA 2XPKA 2XQ3A 5AFLA 4WBOA 2MTQA 2NWBA 4EB6E 4AKRB 1HG5A 5LB7B 5SYOA 1OEDE 2BKNA 3HKBE 3TLTA 2CHOA 2V1DB 3ZC0A 4ZR6A 1KNPA 5IYZE 1J5ET 2G0UA 5AQQB 4BAYB 2LOSA 1XMQT 3AE4A 3AB3B 2ZJUA 1G8XA 3RHWA 3FZMB 3WTNA 3PDYA 2PTFA 3CIRA 4TNVA 1QLBA 3SS1A 4TN7B 3B57A 2CBIA 1ZV4X 1LVFA 4OYKA 4A56A 4OFZA 5FL0A 2XAHB 3RYHE 4JLEA 3AA7B 2H89A 3PEOA 4CXXA 1MIYA 3T4MA 3CPZA 4GIWA 3ONLC 4HQPA 4L9IA 4DUYT 3AVRA 3A5XA 4AFGA 4QXHB 2VL8A 2LOPA 2Y57A 4PFOA 4QH5A 4PJMA 1WYBA 4IREA 3ZEFB 3FBLA 1BR4A 1LKXA 5JR9B 3K3QC 1WR0A 4IE6A 4X20E 1HNXT 2E9XD 3LBXA 3ANWB 2CRBA 2X9WA 3CWZB 2XSBA 3P8CD 3HKCE 4J2CA 3U78A 4EEDA 1AJ3A 2NTYA 1MNDA 4IDZA 5LCYA 2DWKA 2BG9C 1IZNB 1KNRA 3Q5XA 2M6BA 5JDHA 3RH3A 4G2AA 5J2UE 4UM3S 4BJMA 3SQ9A 2WZYA 1US7B 4I50E 3BK9A 3JC6D 3N9QA 4XAXB 1HS7A 2F4VT 3N2KE 4PK5A 4ALXA 3ONXA 4NIQA 4GKJT 4AI6A 3RRWA 1YKEB 2JMKA 3ZJ2A 1D1CA 1MNEA 1Y64B 1HCIA 4ZRUA 2PH9A 3PURA 3U8LA 2VQFT 4AKGA 4M1PA 2BYNA 4AIUA 2VURA 3D0TA 2LHNA 3PUQA 4X5TA 5LYJE 5L3GB 4CXWA 4JI5T 4Z91A 4DR4T 4LFBT 1U4QA 5IWAT 3MK7C 3KVAA 3RI5A 4YJ3E 4UVAB 5JRCA 4UV9B 4UIGA 2P9BA 3NZQA 4B5DA 2XASB 2Q9QD 3B5MA 5FL1A 4ISSA 2YU1A 5FXWA 5M4YA 4DV5T 2ZMAA 4EOZB 2XZ5A 1UX4A 1I9BA 4YTNA 5BMVE 5KDMC 4GKKT 3TLVA 5JREA 1KK7A 5FXXA 2ODUA 4A97A 2E2AA 1XMOT 3RIUC 2ACXA 4HFCA 2V6YA 3PTRB 3CQCB 2ZM6T 5L4EA 2X0HA 2OV9A 2E9XB 4ASKA 3AAEB 3NZPA 4IDOA 3DP7A 2YDRA 4QAAA 2CXLA 4DV4T 3PUXF 4UM3A 2UXBT 4UELA 3IEEA 5IUXA 3TLUA 1J1JA 3FHNA 3ZJ1A 4O8SA 3PUWF 4PJNA 4ZI3D 3KV9A 4L0RA 4LF9T 2Y58A 2FJBA 2V6XA 2LM9A 1D0ZA 4AXPA 4ZK1A 3LBXB 2I0MA 4DBRA 3AA6B 4TV8E 2DI4A 5C8YE 2CLYC 5TAOA 4ZI2D 5HCMA 2MAWA 1B7TA 2AXDS 3WTHA 2QA7A 2KINB 4JI6T 3DTOA 3N9OA 4HN9A 3BQKA 2AE9A 3KV4A 2L3LA 3EAMA 3EDVA 3VRAA 1MMGA 2XQ6A 5F3JA 2CCQA 3PUZF 2YU2A 2FJAA 5GONE 3VKHA 1UX2A 2W00A 3AAIA 5DQWA 4HE8A 4HEAA 1KF6A 2Q9QB 2YN6A 3ZPOA 4CN6A 4BA9A 3AXJA 5H6QB 3ZSTA 1YW0A 3I1AA 4AISA 5A1LA 2UUCT 3P50A 3DJBA 3W15B 1NEKA 4BQTA 3PE0A 3ZDGA 2XNUA 5LJNA 3WTIA 5JRCB 4NXMT 2K48A 1FEWA 2L8KA 2YMEA 4CZZB 4LF8T 2K24A 4UF0B 1W9RA 2QC1B 2BVMA 3CKDA 3RIFA 4LMJA 4IDPA 2V5CA 2WWUA 1QUUA 4DV1T 2CWOA 4D01A 3HKDE 2X9XA 3Q9DA 5JDMA 3N9PA 4X1KE 1HTJF 2A3DA 5EK4A 5J5FA 4HFHA 4ZJSA 3LSVA 4TV9E 1JNZA 4X66T 5AQUB 2W61A 4P09A 2V5DA 4U74A 1S35A 2UU9T 1HNZT 2KWHA 1IJ5A 1YXRA 3C50A 2V6YB 4CN1A 2I59A 4U7YA 4O4JE 5J2TE 3AE6A 3OVUA 1OEDB 1D0XA 2LKGA 2WS3A 3RF1A 4DV2T 5TVCA 4ZOLE 2B1EA 3NWIA 5BR8T 2XZEA 3GUAA 4YSXA 2D0UA 5AFMA 4ILUA 3RC8A 3NRYA 3IGQA 1FIOA 2WZIA 3NKZA 4YXDA 2GK9A 2H7VC 4QWNB 1JNRA 3CX7B 3PJAJ 3LK3B 1WYCA 3P4RA 3VU7H 2WDQA 2LLYA 3OYXA 4KUMB 2LSYA 4AFTA 4B6XA 4H9RC 3QB5K 2K3WA 5AQIB 5LHHB 4TX5A 2ZM8A 4QABA 4QH1A 2BBJA 4PIRA 3X1DA 2XZ6A 5L3DB 5JTGA 2OA5A 2JIWA 2BS4A 3SFDA 3C4XA 3N9LA 3WTOA 3ZSSA 4C91A 3AEAA 2HPLA 4EV6A 4YTMA 3EVYA 2J62A 2EHOC 3TLSA 4O2AE 3K3NA 3AXJB 2XHEB 3ZMTB 4ZZCA 3QNUA 2K5BB 4F8HA 3U8JA 3V5UA 2BYPA 3P7IA 5AQNB 5AQJB 3RYCE 5HYAA 2X00A 2N2NA 4C90A 3UTKA 3ZLIA 1SUMB 3GN5A 5JDNA 5AQSB 2WCAA 2BVLA 1OXZA 2M6IA 5AFNA 3S4UA 3RX6A 3EDUA 4KX6A 5KZUA 2KWIB 4UVCB 2C5IT 3FBZA 2WU5A 3ESLA 2XJ7A 4B3TT 3VR8A 3UUBA 2D5UA 1XWMA 5ABFA 1HNWT 3SWHA 3LFMA 2WDVA 4YHJA 4IHJE 4EGWA 2XSAA 3IA3A 1M62A 1T7SA 3ZN0B 5HXSA 3QB5A 3MXZA 4JI3T 3ZYLA 2W2UA 4LMKA 5FP3A 2X68A 3RLFF 2W8GA 5LA6E 4EYUA 2E9XC 2PGZA 2WP9A 1VCSA 3C84A 2UXDT 3ZKRA 2LRLA 3ZT6A 4GK0E 2JJ9A 2C0SA 3AE7A 1L0VA 2L9QA 3C64A 3HI2A 5AFMB 3J7Yq 4BJNA 2WWVA 4H9QC 4GOUA 4AKLA 3VRBA 4ILCA 2JQKA 1N32T 2ZM2A 3VHLA 1UUSA 3ETUA 1QSDA 4CI1B 4GK5E 2XUEA 3UT5E 4HWCA 2LSJA 3I0OA 5ADXL 3C51A 4HFEA 4CN4A 4DMVA 5LG3A 2QRXA 3U8MA 4WYVA 4DR5T 4EXTA 2BKPA 4QX7B 5FKYA 2WM9A 3RGLA 1D1AA 4HFDA 3N2GE 2UXXB 2UUBT 3AEDA 3O9XA 2SPCA 3JAEA 4OHFA 4I0UA 2JQQA 3T1HT 4DV0T 4JI8T 1YQ4A 4HWIB 4XZCA 3JAFA 2WSSV 2XQ8A 4EZHA 4K0UA 2BG9A 3E22E 1UX5A 1DU2A 4ERRA 4TNWA 2Q9QC 1MMAA 5C2TA 4EYYR 4MHCA 3HL6A 3B13A 3UU4A 2BYRA 2XQAA 5LGNB 4JV5T 1E2AA 2VL0A 3UFGA 3GWHA 4CXYA 3RQWA 4DR6T 1HR0T 1W0BA 4YSYA 4EZ4A 4ZS3A 5ABGA 3A7MA 5H6RB 4OX9T 2IW5B 3KBUA 3LG7A 3MA9A 5CJ5A 4JUYA 2XNVA 3L8RA 2W0GA 4MLKA 4KBMB 1FMWA 2IHR1 3UQ4A 1D0YA 3FZKB 3ETVA 1OWAA 4XHEA 4JEHB 5AQOB 5ABHA 2LEHA 3HR0A 5AQKB 3AA0B 2CEAA 3MZKB 3OTOT 2CWYA 3SOLA 2CBJA 3KDSE 4ZI3C 3BQIA 5DABA 2WNLA 1N33T 4DIDB 2XAFB 3AE2A 3WTKA 3AA1B 2WNJA 4IE0A 3HKEE 4MBQA 1NENA 4P0AA 1OEDC 2YEVC 5CGMA 3GMIA 4DMWA 4QXCB 3RIUA 4H63V 4PJJA 3AEGA 2XAJB 3F31A 4E7SA 4HFIA 4ZI2C 1IBMT 4JI1T 5BP0A 2X51A 2WZHA 2XM1A 2UZ6A 5JDGA 4DUZT 2LHRA 2FBWA 1ZEEA 2V7JA 3OYZA 2XAGB 5DJQC 5HEHA 3U8NA 2XQ5A 2DL1A 3KBTA 2V7MA 3QOFA 3RPUA 2Y54A 4FRRA 4PW8A 4TZ4C 3L3PA 5HXRA 3M65A 4ZI7E 4F6RC 3FXDB 5CA1E 5KE4A 4DV7T 3IBPA 3FZHB 2VKHA 2MBGA 2MOZA 4QACA 4H9NC 4DBMA 4I4TE 2PFVA 3A8YC 5HXCA 2ES0A 4U72A 2VKJA 2Y56A 2IUBA 2Y6XA 3LJCA 3N9MA 1KNZA 2CHNA 5DQVA 1UV6A 3UU6A 1O3XA 2BG9B 4KI0F 1BR1A 3L39A 2UXCT 2A72A 1YD8G 1S94A 2JRKA 3PJAA 4IE5A 3RQUA 4YLHA 1FJGT 2YK0A 2YMDA 4WNKA 1XZYA 3KV6A 4COFA 2VK9A 3CQXC 2NTXA 2JQ9A 2UXNB 4NUVA 2PG8A 2ZLYA 4DVDA 2E8IA 2N9DA 2NOXA 5AQPB 1I6ZA 3ABVA 3UQ7A 3PV0F 3UU5A 4KMCA 5AFHA 5LP6E 5L3EB 2Y8DA 2BYSA 5HWYA 2VVSA 2XYSA 3RKGA 1SA0E 2CM0A 2W8FA 5L2LA 3U8KA 4JEUB 3H37A 2W63A 3CVRA 4NUUA 5C3JA 5L47A 4QKNA 5F8PA 2IDOB 4KHPT 1XNRT 1UW6A 4A98A 1MMNA 4H9SE 2V7IA 5FNVE 5FXVA 5HWXA 4H63H 4HWFA 1HFAA 1T72A 4Q25A 2FUPA 1X79A 3M3ZB 5AQRB 2X67A 2LRKA 5AFJA 2D2SA 2RPAA 5BW2A 1HG2A 2VVNA 4LFCT 5JR9C 3QC9A 4O4HE 3PU3A 3RIAA 4IL4A 2JMHA 4LF5T 2BYQA 5FXZA 4LF6T 3AEFA 3KV5A 2BG9E 2MPKA 2VKDA 5AQMB 5J5HA 4FJOA 3CX6B 5HEGA 3UFEA 2W62A 3GA8A 1ZOYA 3NRXA 3WTMA 4IGUA 4P1NA 2WY2A 3PUGA 4YSZA 5CA0E 4DR7T 2VB6A 2BJ0A 3R6NA 2H88A 5L3FB 2DHRA 4DV6T 3EABA 3UU8A 4GYRA 3LK2B 2RA1A 1R8IA 4V1Av 3G06A 2X9YA 4UVBB 4DBQA 2VWAA 3O1JA 4DO0A 1N36T 3F57A 5FY7A 1WR6A 2WQYA 2ACZA 2EHOA 3P4WA 1CHUA 1X9BA 3AAAB 4Z90A 4ZXLA 2NW9A 2W4XA 5JDLA 5FVKA 3QUJA 2Y48B 3AEEA 2Y7YA 3EUHA 2PBIA 5EZYE 2WAUA 4WZXA 4IE4A 1YQ3A 4LFAT 3WI3A 2HH7A 4JI4T 4JI0T 2R6GF 2M67A 2A9UA 2XTLA 1MMDA 2NW8A 5LXTE 2X00D 4Z8XA 2DWGA 2LM2A 4U2ZA 2XY8B 3CQGB 3I0QA 4QHOA 1IBLT 4ZEYA 3C4ZA 4IDQA 3P4SA 5LBMA 4YY3T 2LSIA 3N5LA 2XYTA 5AQFB 4ZZBA 2XQYA 2WU2A 4QX8B 3JCFA 4U2YA 1Z0PA 1VCTA 4AQFC 5CFBA 5L3CB 3SFEA 3CMLA 1IBKT 5AQLB 2X66A 1U5PA 3EHZA 4EIWA 2IC9A 1WCRA 3IF8B 2VASA 2NW7A 5LJMA 3I9YA 2N1GA 2HN1A 2C5JA 2NP9A 4X1IE 4HGAA 4U31A 2RP4A 4PJLA 4TWHA 3AE9A 4AQFA 2E9XA 1NAFA 4OK0A 3FZFB 2KT9A 3JC6C 2C5KT 4IL9A 3ZMSB 2UUAT 5JDFA 5L3BB 3C79A 4HWDA 2NR4A 3AE3A 4X1YE 2KZ7B 2V26A 4AQGA 1G73A 2ZM0A 4DNDA 4YJ2E 2IIUA 2PJQA 2IAKA 3ONJA 4YFSA 3ZMUB 3UUMA 3FB2A 5KX5E 3PU8A 5HXHA 2X0YA 4TWFA 5JVDE 2HHHT 3VKGA 2XNTA 4XK9A 5HEJA 2DNXA 1W0AA 3ZCJA 4UM3P 2YINA 1GQEA 5FY1A 3AECA 3PUYF 3RC3A 2LE8A 4QH4A 2LT3A 4E7ZA 3RRCA 2QVAA 3F2EA 3KVBA 2KLQA 4U3CA 4EZ1A 5AINA 3UULA 4L5GA 2YDSA 4HKAA 2KXPB 4AKHA 4EAHA 4A5XA 4PK6A 4ZJTA 4NXNT 3NBXX 2EHOB 2X9HA 3ZCIA 4JI7T 3PUSA 4KP3C 3GN5B 2Q9QA 4DR3T
chains in the Genus database with same CATH topology
4NZBA 4DBMA 3TLTA 3UQ4A 3GUAA 3SQ9A 4AFHA 2WZYA 4WV9A 2XQ9A 5L4HA 5L4EA 5HCJA 4ZR6A 2M6IA 2Y56A 4HFEA 1OEDE 5AFNA 5AFMA 4TWHA 3TLWA 4XHEA 2ZJUA 5LG3A 2BR7A 3PMZA 3RHWA 3U8MA 4ALXA 3IGQA 3P50A 5KZUA 2WNCA 1UV6A 3UU6A 2BG9B 5J0ZA 3P4WA 4BQTA 3WTNA 4QAAA 3ZDGA 4Z90A 2XNUA 3WTIA 4HFDA 4UM3A 4UM1A 4TNVA 4ZRUA 2PH9A 3U8LA 5IUXA 4IL9A 4NPPA 2WNLA 3C79A 3TLUA 3UUBA 2BYNA 2YMEA 4ZK4A 3JAEA 4BFQA 2LLYA 3RQUA 3SIOA 3WTKA 3WIPA 2Y7YA 2WNJA 2YOEA 2YMDA 4AFTA 2C9TA 3WTJA 4X5TA 2YKSA 4HFBA 1OEDC 5HEOA 3UU3A 4COFA 5AFJA 5AFKA 2QC1B 2Y58A 2ZJVA 4Z91A 5BW2A 4UXUA 4QABA 3JAFA 2LKHA 2XQ8A 4QH1A 3RIFA 4LMJA 2BG9A 3PEOA 3ZDHA 3RIAA 4IL4A 3RI5A 2BR8A 5J5IA 2XQ4A 4PIRA 2BYQA 2XZ6A 4D01A 3T4MA 4ZK1A 4HQPA 4TNWA 4HFIA 5FJVA 4TWFA 4LMKA 2X00D 4AFGA 2XNTA 2Y57A 4B5DA 3SQ6A 5BP0A 5BRXA 5J5FA 2LM2A 4QH5A 5JMEA 3JADA 2BG9E 4HFHA 2UZ6A 4XK9A 4ZJSA 3LSVA 4IREA 3WTOA 2W8GA 5HEJA 3UU4A 2BYRA 2PGZA 5HCMA 2XQAA 2MAWA 5J5HA 3UQ7A 3UU5A 2XQ7A 4UM3P 3WTHA 5HEGA 5LXBA 3C84A 5AFHA 4ILAA 2VL0A 5HEHA 5CO5A 3U8NA 4QH4A 5HEUA 3TLSA 3ZKRA 3EI0A 2WN9A 2BYSA 2XQ5A 3RQWA 2XYTA 2XYSA 2XZ5A 3WTMA 2Y54A 2W8FA 4FRRA 3EAMA 4ZZBA 1I9BA 4LMLA 4EZ1A 4ZZCA 4ILBA 5AINA 2XQ6A 5AFMB 3TLVA 4UY2A 3WTLA 3U8KA 4F8HA 3SH1A 1OEDB 1OEDA 2LKGA 3U8JA 2BYPA 5KE4A 4ZJTA 2BJ0A 4ILCA 4A97A 5TVCA 2KSRA 5CFBA 1UX2A 2XQ3A 5L47A 5J5GA 5AFLA 2X00A 2XNVA 2BG9C 3EHZA 2M6BA 1UW6A 3UU8A 4QACA 5SYOA 4HFCA 4UM3S 4A98A 4TWDA 2YN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NZB A;  4DBM A;  3TLT A;  3UQ4 A;  3GUA A;  3SQ9 A;  4AFH A;  2WZY A;  4WV9 A;  2XQ9 A;  5L4H A;  5L4E A;  5HCJ A;  4ZR6 A;  2M6I A;  2Y56 A;  4HFE A;  1OED E;  5AFN A;  5AFM A;  4TWH A;  3TLW A;  4XHE A;  2ZJU A;  5LG3 A;  2BR7 A;  3PMZ A;  3RHW A;  3U8M A;  4ALX A;  3IGQ A;  3P50 A;  5KZU A;  2WNC A;  1UV6 A;  3UU6 A;  2BG9 B;  5J0Z A;  3P4W A;  4BQT A;  3WTN A;  4QAA A;  3ZDG A;  4Z90 A;  2XNU A;  3WTI A;  4HFD A;  4UM3 A;  4UM1 A;  4TNV A;  4ZRU A;  2PH9 A;  3U8L A;  5IUX A;  4IL9 A;  4NPP A;  2WNL A;  3C79 A;  3TLU A;  3UUB A;  2BYN A;  2YME A;  4ZK4 A;  3JAE A;  4BFQ A;  2LLY A;  3RQU A;  3SIO A;  3WTK A;  3WIP A;  2Y7Y A;  2WNJ A;  2YOE A;  2YMD A;  4AFT A;  2C9T A;  3WTJ A;  4X5T A;  2YKS A;  4HFB A;  1OED C;  5HEO A;  3UU3 A;  4COF A;  5AFJ A;  5AFK A;  2QC1 B;  2Y58 A;  2ZJV A;  4Z91 A;  5BW2 A;  4UXU A;  4QAB A;  3JAF A;  2LKH A;  2XQ8 A;  4QH1 A;  3RIF A;  4LMJ A;  2BG9 A;  3PEO A;  3ZDH A;  3RIA A;  4IL4 A;  3RI5 A;  2BR8 A;  5J5I A;  2XQ4 A;  4PIR A;  2BYQ A;  2XZ6 A;  4D01 A;  3T4M A;  4ZK1 A;  4HQP A;  4TNW A;  4HFI A;  5FJV A;  4TWF A;  4LMK A;  2X00 D;  4AFG A;  2XNT A;  2Y57 A;  4B5D A;  3SQ6 A;  5BP0 A;  5BRX A;  5J5F A;  2LM2 A;  4QH5 A;  5JME A;  3JAD A;  2BG9 E;  4HFH A;  2UZ6 A;  4XK9 A;  4ZJS A;  3LSV A;  4IRE A;  3WTO A;  2W8G A;  5HEJ A;  3UU4 A;  2BYR A;  2PGZ A;  5HCM A;  2XQA A;  2MAW A;  5J5H A;  3UQ7 A;  3UU5 A;  2XQ7 A;  4UM3 P;  3WTH A;  5HEG A;  5LXB A;  3C84 A;  5AFH A;  4ILA A;  2VL0 A;  5HEH A;  5CO5 A;  3U8N A;  4QH4 A;  5HEU A;  3TLS A;  3ZKR A;  3EI0 A;  2WN9 A;  2BYS A;  2XQ5 A;  3RQW A;  2XYT A;  2XYS A;  2XZ5 A;  3WTM A;  2Y54 A;  2W8F A;  4FRR A;  3EAM A;  4ZZB A;  1I9B A;  4LML A;  4EZ1 A;  4ZZC A;  4ILB A;  5AIN A;  2XQ6 A;  5AFM B;  3TLV A;  4UY2 A;  3WTL A;  3U8K A;  4F8H A;  3SH1 A;  1OED B;  1OED A;  2LKG A;  3U8J A;  2BYP A;  5KE4 A;  4ZJT A;  2BJ0 A;  4ILC A;  4A97 A;  5TVC A;  2KSR A;  5CFB A;  1UX2 A;  2XQ3 A;  5L47 A;  5J5G A;  5AFL A;  2X00 A;  2XNV A;  2BG9 C;  3EHZ A;  2M6B A;  1UW6 A;  3UU8 A;  4QAC A;  5SYO A;  4HFC A;  4UM3 S;  4A98 A;  4TWD A;  2YN6 A; 
#chains in the Genus database with same CATH topology
 1I94 T;  5CB4 E;  4U33 A;  4B3S T;  2BS3 A;  2WB5 A;  3KFW X;  2BR7 A;  2Z6E A;  5J1G A;  5AQG B;  3FXE B;  4GYS A;  2V8S V;  3J9X 1;  2BZB A;  1V9D A;  3KIN B;  1J5W A;  4ZK4 A;  4XBF B;  2V7L A;  2D9D A;  1HX1 B;  1MIW A;  5ABF B;  2LJL A;  3H3M A;  3OKQ A;  2YOE A;  1T8B A;  2WDR A;  4HFB A;  2JQH A;  2BKO A;  1XDP A;  3E08 A;  4UF0 A;  3TKL B;  5ABE A;  2D0T A;  4O4L E;  5LG4 A;  4O2B E;  5LMU T;  5J5I A;  2WMN A;  3VR9 A;  2YDQ A;  4ANJ A;  3UUX B;  2E5V A;  2FJD A;  5FJV A;  1WRD A;  4HFV A;  5JME A;  5JDQ A;  3OJA A;  1IAP A;  2JPF A;  4ZS2 A;  1UUR A;  1HF8 A;  2J1D G;  5LXB A;  2XM2 A;  4MFR A;  4PNI A;  2DCF A;  4X64 T;  2DLR A;  1UCU A;  1M7K A;  3ZN1 B;  2CXF A;  4YTP A;  1OED A;  2KSR A;  1YKH B;  4IDN A;  5J5G A;  5JQG E;  3HA4 A;  4JI2 T;  3RKO A;  4UR9 A;  2FJE A;  3FZL B;  2XQ9 A;  4HWH A;  2LSK A;  2VKO A;  1D1B A;  5AQT B;  5F5W A;  4DR2 T;  2I6H A;  1UGO A;  1SHZ C;  3LK4 2;  3N9N A;  3Q5E A;  3ZMV B;  3H3A A;  2KMF A;  3OPC A;  2VQE T;  3K1S A;  5KMG P;  5KXJ A;  3WTJ A;  4PFP A;  1SE7 A;  4MAL A;  5HEO A;  3UU3 A;  4ADZ A;  3C98 B;  5LGT B;  3P4Q A;  5LMN T;  3N2O A;  2E5L T;  3AVS A;  2CA5 A;  3U3I A;  5HXE A;  2BR8 A;  2XQ4 A;  2HPJ A;  2W66 A;  4JBW F;  5ETW A;  5EK3 A;  5BRX A;  3RYI E;  3QK6 A;  3ZC1 A;  3T1Y T;  2J47 A;  4K0K T;  4U7I A;  5FYM A;  2LSG A;  5LOV E;  4ZHQ E;  5LBQ B;  4O4I E;  1FMV A;  3PUA A;  5HEU A;  1ZP0 A;  3EI0 A;  2WN9 A;  4IE7 A;  4EEB A;  4AKI A;  4CQI A;  2KND A;  3ZYK A;  3V5S A;  2CE7 A;  3WAK A;  3Q5W A;  3Q5D A;  5LHI B;  4TUY E;  3P4P A;  2OLT A;  1EZ3 A;  4UV8 B;  4WV9 A;  1ZKE A;  4IIJ E;  3PMZ A;  1MIV A;  2QYW A;  3AE5 A;  4IT4 A;  1Y01 A;  1BR0 A;  5J0Z A;  1WFD A;  2X0L B;  1XNQ T;  2MYS A;  4H9P C;  4UM1 A;  2A2F X;  2H7O A;  4JYA T;  3PUV F;  4PK4 A;  3IHR A;  4IST A;  4N78 D;  2C9T A;  3Q2M A;  3RYF E;  3C4W A;  1VOM A;  4CI2 B;  1E7P A;  1HX8 A;  3MJX A;  2QGS A;  3ZDH A;  3O1H A;  1CUN A;  2IML A;  2K9A A;  2BS2 A;  4LF7 T;  4HTE A;  4X65 T;  2IC6 A;  1BR2 A;  4P0B A;  4CI3 B;  1ZHC A;  4OYJ A;  3I9W A;  3JAD A;  3L09 A;  2XAQ B;  4X62 T;  1KEY A;  1W09 A;  1IJ6 A;  2B76 A;  3AE1 A;  5FVL A;  4ILA A;  2H3R A;  3OBV E;  4AQY T;  4H9O C;  1NWM X;  3T8O A;  2V7K A;  3NVO A;  4B3R T;  2WMO A;  2HN2 A;  1UK5 A;  4B3M T;  4UY2 A;  1VRB A;  4FI5 A;  4YHH T;  1XDO A;  5JR9 A;  3R84 B;  3SRZ A;  4TWD A;  4NZB A;  3MAC A;  4AFH A;  3CK6 A;  3ANW A;  5L4H A;  4UXN B;  5HCJ A;  3K3O A;  4YT0 A;  2CLY B;  3TLW A;  4QXB B;  1T98 A;  2WNC A;  3MKD A;  5LHG B;  2BDE A;  1KFY A;  5AQH B;  1N34 T;  2ODV A;  3E0Z A;  4WBN E;  2BBH A;  4NPP A;  3CX8 B;  4BFQ A;  4I55 E;  3SIO A;  3WIP A;  4DR1 T;  2CXD A;  2YKS A;  1LRZ A;  3LDQ B;  5LGU B;  5AFK A;  5JH7 E;  2ZJV A;  4UXU A;  4KHZ F;  1WLX A;  2LKH A;  1LVK A;  3K8P C;  4DV3 T;  5AQV B;  3ZT5 A;  1H7C A;  4WW0 A;  5AFU L;  1E1H B;  5FY0 A;  3O4X E;  5LNK A;  3ZT7 A;  3ZMZ B;  3SQ6 A;  2J4G A;  2CPT A;  4G63 A;  2WBL A;  3AEB A;  4LF4 T;  5EK2 A;  3ZYM A;  2XQ7 A;  5HAX A;  5FMN A;  2W67 A;  4UEM A;  3O1I A;  5CO5 A;  4PAG A;  5E0O A;  3BQL A;  1Z8U A;  4I43 B;  3AE8 A;  2EHO D;  5IHY A;  4LML A;  4ILB A;  3WTL A;  2CMR A;  3SH1 A;  3WAJ A;  3UUN A;  2XPK A;  2XQ3 A;  5AFL A;  4WBO A;  2MTQ A;  2NWB A;  4EB6 E;  4AKR B;  1HG5 A;  5LB7 B;  5SYO A;  1OED E;  2BKN A;  3HKB E;  3TLT A;  2CHO A;  2V1D B;  3ZC0 A;  4ZR6 A;  1KNP A;  5IYZ E;  1J5E T;  2G0U A;  5AQQ B;  4BAY B;  2LOS A;  1XMQ T;  3AE4 A;  3AB3 B;  2ZJU A;  1G8X A;  3RHW A;  3FZM B;  3WTN A;  3PDY A;  2PTF A;  3CIR A;  4TNV A;  1QLB A;  3SS1 A;  4TN7 B;  3B57 A;  2CBI A;  1ZV4 X;  1LVF A;  4OYK A;  4A56 A;  4OFZ A;  5FL0 A;  2XAH B;  3RYH E;  4JLE A;  3AA7 B;  2H89 A;  3PEO A;  4CXX A;  1MIY A;  3T4M A;  3CPZ A;  4GIW A;  3ONL C;  4HQP A;  4L9I A;  4DUY T;  3AVR A;  3A5X A;  4AFG A;  4QXH B;  2VL8 A;  2LOP A;  2Y57 A;  4PFO A;  4QH5 A;  4PJM A;  1WYB A;  4IRE A;  3ZEF B;  3FBL A;  1BR4 A;  1LKX A;  5JR9 B;  3K3Q C;  1WR0 A;  4IE6 A;  4X20 E;  1HNX T;  2E9X D;  3LBX A;  3ANW B;  2CRB A;  2X9W A;  3CWZ B;  2XSB A;  3P8C D;  3HKC E;  4J2C A;  3U78 A;  4EED A;  1AJ3 A;  2NTY A;  1MND A;  4IDZ A;  5LCY A;  2DWK A;  2BG9 C;  1IZN B;  1KNR A;  3Q5X A;  2M6B A;  5JDH A;  3RH3 A;  4G2A A;  5J2U E;  4UM3 S;  4BJM A;  3SQ9 A;  2WZY A;  1US7 B;  4I50 E;  3BK9 A;  3JC6 D;  3N9Q A;  4XAX B;  1HS7 A;  2F4V T;  3N2K E;  4PK5 A;  4ALX A;  3ONX A;  4NIQ A;  4GKJ T;  4AI6 A;  3RRW A;  1YKE B;  2JMK A;  3ZJ2 A;  1D1C A;  1MNE A;  1Y64 B;  1HCI A;  4ZRU A;  2PH9 A;  3PUR A;  3U8L A;  2VQF T;  4AKG A;  4M1P A;  2BYN A;  4AIU A;  2VUR A;  3D0T A;  2LHN A;  3PUQ A;  4X5T A;  5LYJ E;  5L3G B;  4CXW A;  4JI5 T;  4Z91 A;  4DR4 T;  4LFB T;  1U4Q A;  5IWA T;  3MK7 C;  3KVA A;  3RI5 A;  4YJ3 E;  4UVA B;  5JRC A;  4UV9 B;  4UIG A;  2P9B A;  3NZQ A;  4B5D A;  2XAS B;  2Q9Q D;  3B5M A;  5FL1 A;  4ISS A;  2YU1 A;  5FXW A;  5M4Y A;  4DV5 T;  2ZMA A;  4EOZ B;  2XZ5 A;  1UX4 A;  1I9B A;  4YTN A;  5BMV E;  5KDM C;  4GKK T;  3TLV A;  5JRE A;  1KK7 A;  5FXX A;  2ODU A;  4A97 A;  2E2A A;  1XMO T;  3RIU C;  2ACX A;  4HFC A;  2V6Y A;  3PTR B;  3CQC B;  2ZM6 T;  5L4E A;  2X0H A;  2OV9 A;  2E9X B;  4ASK A;  3AAE B;  3NZP A;  4IDO A;  3DP7 A;  2YDR A;  4QAA A;  2CXL A;  4DV4 T;  3PUX F;  4UM3 A;  2UXB T;  4UEL A;  3IEE A;  5IUX A;  3TLU A;  1J1J A;  3FHN A;  3ZJ1 A;  4O8S A;  3PUW F;  4PJN A;  4ZI3 D;  3KV9 A;  4L0R A;  4LF9 T;  2Y58 A;  2FJB A;  2V6X A;  2LM9 A;  1D0Z A;  4AXP A;  4ZK1 A;  3LBX B;  2I0M A;  4DBR A;  3AA6 B;  4TV8 E;  2DI4 A;  5C8Y E;  2CLY C;  5TAO A;  4ZI2 D;  5HCM A;  2MAW A;  1B7T A;  2AXD S;  3WTH A;  2QA7 A;  2KIN B;  4JI6 T;  3DTO A;  3N9O A;  4HN9 A;  3BQK A;  2AE9 A;  3KV4 A;  2L3L A;  3EAM A;  3EDV A;  3VRA A;  1MMG A;  2XQ6 A;  5F3J A;  2CCQ A;  3PUZ F;  2YU2 A;  2FJA A;  5GON E;  3VKH A;  1UX2 A;  2W00 A;  3AAI A;  5DQW A;  4HE8 A;  4HEA A;  1KF6 A;  2Q9Q B;  2YN6 A;  3ZPO A;  4CN6 A;  4BA9 A;  3AXJ A;  5H6Q B;  3ZST A;  1YW0 A;  3I1A A;  4AIS A;  5A1L A;  2UUC T;  3P50 A;  3DJB A;  3W15 B;  1NEK A;  4BQT A;  3PE0 A;  3ZDG A;  2XNU A;  5LJN A;  3WTI A;  5JRC B;  4NXM T;  2K48 A;  1FEW A;  2L8K A;  2YME A;  4CZZ B;  4LF8 T;  2K24 A;  4UF0 B;  1W9R A;  2QC1 B;  2BVM A;  3CKD A;  3RIF A;  4LMJ A;  4IDP A;  2V5C A;  2WWU A;  1QUU A;  4DV1 T;  2CWO A;  4D01 A;  3HKD E;  2X9X A;  3Q9D A;  5JDM A;  3N9P A;  4X1K E;  1HTJ F;  2A3D A;  5EK4 A;  5J5F A;  4HFH A;  4ZJS A;  3LSV A;  4TV9 E;  1JNZ A;  4X66 T;  5AQU B;  2W61 A;  4P09 A;  2V5D A;  4U74 A;  1S35 A;  2UU9 T;  1HNZ T;  2KWH A;  1IJ5 A;  1YXR A;  3C50 A;  2V6Y B;  4CN1 A;  2I59 A;  4U7Y A;  4O4J E;  5J2T E;  3AE6 A;  3OVU A;  1OED B;  1D0X A;  2LKG A;  2WS3 A;  3RF1 A;  4DV2 T;  5TVC A;  4ZOL E;  2B1E A;  3NWI A;  5BR8 T;  2XZE A;  3GUA A;  4YSX A;  2D0U A;  5AFM A;  4ILU A;  3RC8 A;  3NRY A;  3IGQ A;  1FIO A;  2WZI A;  3NKZ A;  4YXD A;  2GK9 A;  2H7V C;  4QWN B;  1JNR A;  3CX7 B;  3PJA J;  3LK3 B;  1WYC A;  3P4R A;  3VU7 H;  2WDQ A;  2LLY A;  3OYX A;  4KUM B;  2LSY A;  4AFT A;  4B6X A;  4H9R C;  3QB5 K;  2K3W A;  5AQI B;  5LHH B;  4TX5 A;  2ZM8 A;  4QAB A;  4QH1 A;  2BBJ A;  4PIR A;  3X1D A;  2XZ6 A;  5L3D B;  5JTG A;  2OA5 A;  2JIW A;  2BS4 A;  3SFD A;  3C4X A;  3N9L A;  3WTO A;  3ZSS A;  4C91 A;  3AEA A;  2HPL A;  4EV6 A;  4YTM A;  3EVY A;  2J62 A;  2EHO C;  3TLS A;  4O2A E;  3K3N A;  3AXJ B;  2XHE B;  3ZMT B;  4ZZC A;  3QNU A;  2K5B B;  4F8H A;  3U8J A;  3V5U A;  2BYP A;  3P7I A;  5AQN B;  5AQJ B;  3RYC E;  5HYA A;  2X00 A;  2N2N A;  4C90 A;  3UTK A;  3ZLI A;  1SUM B;  3GN5 A;  5JDN A;  5AQS B;  2WCA A;  2BVL A;  1OXZ A;  2M6I A;  5AFN A;  3S4U A;  3RX6 A;  3EDU A;  4KX6 A;  5KZU A;  2KWI B;  4UVC B;  2C5I T;  3FBZ A;  2WU5 A;  3ESL A;  2XJ7 A;  4B3T T;  3VR8 A;  3UUB A;  2D5U A;  1XWM A;  5ABF A;  1HNW T;  3SWH A;  3LFM A;  2WDV A;  4YHJ A;  4IHJ E;  4EGW A;  2XSA A;  3IA3 A;  1M62 A;  1T7S A;  3ZN0 B;  5HXS A;  3QB5 A;  3MXZ A;  4JI3 T;  3ZYL A;  2W2U A;  4LMK A;  5FP3 A;  2X68 A;  3RLF F;  2W8G A;  5LA6 E;  4EYU A;  2E9X C;  2PGZ A;  2WP9 A;  1VCS A;  3C84 A;  2UXD T;  3ZKR A;  2LRL A;  3ZT6 A;  4GK0 E;  2JJ9 A;  2C0S A;  3AE7 A;  1L0V A;  2L9Q A;  3C64 A;  3HI2 A;  5AFM B;  3J7Y q;  4BJN A;  2WWV A;  4H9Q C;  4GOU A;  4AKL A;  3VRB A;  4ILC A;  2JQK A;  1N32 T;  2ZM2 A;  3VHL A;  1UUS A;  3ETU A;  1QSD A;  4CI1 B;  4GK5 E;  2XUE A;  3UT5 E;  4HWC A;  2LSJ A;  3I0O A;  5ADX L;  3C51 A;  4HFE A;  4CN4 A;  4DMV A;  5LG3 A;  2QRX A;  3U8M A;  4WYV A;  4DR5 T;  4EXT A;  2BKP A;  4QX7 B;  5FKY A;  2WM9 A;  3RGL A;  1D1A A;  4HFD A;  3N2G E;  2UXX B;  2UUB T;  3AED A;  3O9X A;  2SPC A;  3JAE A;  4OHF A;  4I0U A;  2JQQ A;  3T1H T;  4DV0 T;  4JI8 T;  1YQ4 A;  4HWI B;  4XZC A;  3JAF A;  2WSS V;  2XQ8 A;  4EZH A;  4K0U A;  2BG9 A;  3E22 E;  1UX5 A;  1DU2 A;  4ERR A;  4TNW A;  2Q9Q C;  1MMA A;  5C2T A;  4EYY R;  4MHC A;  3HL6 A;  3B13 A;  3UU4 A;  2BYR A;  2XQA A;  5LGN B;  4JV5 T;  1E2A A;  2VL0 A;  3UFG A;  3GWH A;  4CXY A;  3RQW A;  4DR6 T;  1HR0 T;  1W0B A;  4YSY A;  4EZ4 A;  4ZS3 A;  5ABG A;  3A7M A;  5H6R B;  4OX9 T;  2IW5 B;  3KBU A;  3LG7 A;  3MA9 A;  5CJ5 A;  4JUY A;  2XNV A;  3L8R A;  2W0G A;  4MLK A;  4KBM B;  1FMW A;  2IHR 1;  3UQ4 A;  1D0Y A;  3FZK B;  3ETV A;  1OWA A;  4XHE A;  4JEH B;  5AQO B;  5ABH A;  2LEH A;  3HR0 A;  5AQK B;  3AA0 B;  2CEA A;  3MZK B;  3OTO T;  2CWY A;  3SOL A;  2CBJ A;  3KDS E;  4ZI3 C;  3BQI A;  5DAB A;  2WNL A;  1N33 T;  4DID B;  2XAF B;  3AE2 A;  3WTK A;  3AA1 B;  2WNJ A;  4IE0 A;  3HKE E;  4MBQ A;  1NEN A;  4P0A A;  1OED C;  2YEV C;  5CGM A;  3GMI A;  4DMW A;  4QXC B;  3RIU A;  4H63 V;  4PJJ A;  3AEG A;  2XAJ B;  3F31 A;  4E7S A;  4HFI A;  4ZI2 C;  1IBM T;  4JI1 T;  5BP0 A;  2X51 A;  2WZH A;  2XM1 A;  2UZ6 A;  5JDG A;  4DUZ T;  2LHR A;  2FBW A;  1ZEE A;  2V7J A;  3OYZ A;  2XAG B;  5DJQ C;  5HEH A;  3U8N A;  2XQ5 A;  2DL1 A;  3KBT A;  2V7M A;  3QOF A;  3RPU A;  2Y54 A;  4FRR A;  4PW8 A;  4TZ4 C;  3L3P A;  5HXR A;  3M65 A;  4ZI7 E;  4F6R C;  3FXD B;  5CA1 E;  5KE4 A;  4DV7 T;  3IBP A;  3FZH B;  2VKH A;  2MBG A;  2MOZ A;  4QAC A;  4H9N C;  4DBM A;  4I4T E;  2PFV A;  3A8Y C;  5HXC A;  2ES0 A;  4U72 A;  2VKJ A;  2Y56 A;  2IUB A;  2Y6X A;  3LJC A;  3N9M A;  1KNZ A;  2CHN A;  5DQV A;  1UV6 A;  3UU6 A;  1O3X A;  2BG9 B;  4KI0 F;  1BR1 A;  3L39 A;  2UXC T;  2A72 A;  1YD8 G;  1S94 A;  2JRK A;  3PJA A;  4IE5 A;  3RQU A;  4YLH A;  1FJG T;  2YK0 A;  2YMD A;  4WNK A;  1XZY A;  3KV6 A;  4COF A;  2VK9 A;  3CQX C;  2NTX A;  2JQ9 A;  2UXN B;  4NUV A;  2PG8 A;  2ZLY A;  4DVD A;  2E8I A;  2N9D A;  2NOX A;  5AQP B;  1I6Z A;  3ABV A;  3UQ7 A;  3PV0 F;  3UU5 A;  4KMC A;  5AFH A;  5LP6 E;  5L3E B;  2Y8D A;  2BYS A;  5HWY A;  2VVS A;  2XYS A;  3RKG A;  1SA0 E;  2CM0 A;  2W8F A;  5L2L A;  3U8K A;  4JEU B;  3H37 A;  2W63 A;  3CVR A;  4NUU A;  5C3J A;  5L47 A;  4QKN A;  5F8P A;  2IDO B;  4KHP T;  1XNR T;  1UW6 A;  4A98 A;  1MMN A;  4H9S E;  2V7I A;  5FNV E;  5FXV A;  5HWX A;  4H63 H;  4HWF A;  1HFA A;  1T72 A;  4Q25 A;  2FUP A;  1X79 A;  3M3Z B;  5AQR B;  2X67 A;  2LRK A;  5AFJ A;  2D2S A;  2RPA A;  5BW2 A;  1HG2 A;  2VVN A;  4LFC T;  5JR9 C;  3QC9 A;  4O4H E;  3PU3 A;  3RIA A;  4IL4 A;  2JMH A;  4LF5 T;  2BYQ A;  5FXZ A;  4LF6 T;  3AEF A;  3KV5 A;  2BG9 E;  2MPK A;  2VKD A;  5AQM B;  5J5H A;  4FJO A;  3CX6 B;  5HEG A;  3UFE A;  2W62 A;  3GA8 A;  1ZOY A;  3NRX A;  3WTM A;  4IGU A;  4P1N A;  2WY2 A;  3PUG A;  4YSZ A;  5CA0 E;  4DR7 T;  2VB6 A;  2BJ0 A;  3R6N A;  2H88 A;  5L3F B;  2DHR A;  4DV6 T;  3EAB A;  3UU8 A;  4GYR A;  3LK2 B;  2RA1 A;  1R8I A;  4V1A v;  3G06 A;  2X9Y A;  4UVB B;  4DBQ A;  2VWA A;  3O1J A;  4DO0 A;  1N36 T;  3F57 A;  5FY7 A;  1WR6 A;  2WQY A;  2ACZ A;  2EHO A;  3P4W A;  1CHU A;  1X9B A;  3AAA B;  4Z90 A;  4ZXL A;  2NW9 A;  2W4X A;  5JDL A;  5FVK A;  3QUJ A;  2Y48 B;  3AEE A;  2Y7Y A;  3EUH A;  2PBI A;  5EZY E;  2WAU A;  4WZX A;  4IE4 A;  1YQ3 A;  4LFA T;  3WI3 A;  2HH7 A;  4JI4 T;  4JI0 T;  2R6G F;  2M67 A;  2A9U A;  2XTL A;  1MMD A;  2NW8 A;  5LXT E;  2X00 D;  4Z8X A;  2DWG A;  2LM2 A;  4U2Z A;  2XY8 B;  3CQG B;  3I0Q A;  4QHO A;  1IBL T;  4ZEY A;  3C4Z A;  4IDQ A;  3P4S A;  5LBM A;  4YY3 T;  2LSI A;  3N5L A;  2XYT A;  5AQF B;  4ZZB A;  2XQY A;  2WU2 A;  4QX8 B;  3JCF A;  4U2Y A;  1Z0P A;  1VCT A;  4AQF C;  5CFB A;  5L3C B;  3SFE A;  3CML A;  1IBK T;  5AQL B;  2X66 A;  1U5P A;  3EHZ A;  4EIW A;  2IC9 A;  1WCR A;  3IF8 B;  2VAS A;  2NW7 A;  5LJM A;  3I9Y A;  2N1G A;  2HN1 A;  2C5J A;  2NP9 A;  4X1I E;  4HGA A;  4U31 A;  2RP4 A;  4PJL A;  4TWH A;  3AE9 A;  4AQF A;  2E9X A;  1NAF A;  4OK0 A;  3FZF B;  2KT9 A;  3JC6 C;  2C5K T;  4IL9 A;  3ZMS B;  2UUA T;  5JDF A;  5L3B B;  3C79 A;  4HWD A;  2NR4 A;  3AE3 A;  4X1Y E;  2KZ7 B;  2V26 A;  4AQG A;  1G73 A;  2ZM0 A;  4DND A;  4YJ2 E;  2IIU A;  2PJQ A;  2IAK A;  3ONJ A;  4YFS A;  3ZMU B;  3UUM A;  3FB2 A;  5KX5 E;  3PU8 A;  5HXH A;  2X0Y A;  4TWF A;  5JVD E;  2HHH T;  3VKG A;  2XNT A;  4XK9 A;  5HEJ A;  2DNX A;  1W0A A;  3ZCJ A;  4UM3 P;  2YIN A;  1GQE A;  5FY1 A;  3AEC A;  3PUY F;  3RC3 A;  2LE8 A;  4QH4 A;  2LT3 A;  4E7Z A;  3RRC A;  2QVA A;  3F2E A;  3KVB A;  2KLQ A;  4U3C A;  4EZ1 A;  5AIN A;  3UUL A;  4L5G A;  2YDS A;  4HKA A;  2KXP B;  4AKH A;  4EAH A;  4A5X A;  4PK6 A;  4ZJT A;  4NXN T;  3NBX X;  2EHO B;  2X9H A;  3ZCI A;  4JI7 T;  3PUS A;  4KP3 C;  3GN5 B;  2Q9Q A;  4DR3 T; 
#chains in the Genus database with same CATH homology
 4NZB A;  4DBM A;  3TLT A;  3UQ4 A;  3GUA A;  3SQ9 A;  4AFH A;  2WZY A;  4WV9 A;  2XQ9 A;  5L4H A;  5L4E A;  5HCJ A;  4ZR6 A;  2M6I A;  2Y56 A;  4HFE A;  1OED E;  5AFN A;  5AFM A;  4TWH A;  3TLW A;  4XHE A;  2ZJU A;  5LG3 A;  2BR7 A;  3PMZ A;  3RHW A;  3U8M A;  4ALX A;  3IGQ A;  3P50 A;  5KZU A;  2WNC A;  1UV6 A;  3UU6 A;  2BG9 B;  5J0Z A;  3P4W A;  4BQT A;  3WTN A;  4QAA A;  3ZDG A;  4Z90 A;  2XNU A;  3WTI A;  4HFD A;  4UM3 A;  4UM1 A;  4TNV A;  4ZRU A;  2PH9 A;  3U8L A;  5IUX A;  4IL9 A;  4NPP A;  2WNL A;  3C79 A;  3TLU A;  3UUB A;  2BYN A;  2YME A;  4ZK4 A;  3JAE A;  4BFQ A;  2LLY A;  3RQU A;  3SIO A;  3WTK A;  3WIP A;  2Y7Y A;  2WNJ A;  2YOE A;  2YMD A;  4AFT A;  2C9T A;  3WTJ A;  4X5T A;  2YKS A;  4HFB A;  1OED C;  5HEO A;  3UU3 A;  4COF A;  5AFJ A;  5AFK A;  2QC1 B;  2Y58 A;  2ZJV A;  4Z91 A;  5BW2 A;  4UXU A;  4QAB A;  3JAF A;  2LKH A;  2XQ8 A;  4QH1 A;  3RIF A;  4LMJ A;  2BG9 A;  3PEO A;  3ZDH A;  3RIA A;  4IL4 A;  3RI5 A;  2BR8 A;  5J5I A;  2XQ4 A;  4PIR A;  2BYQ A;  2XZ6 A;  4D01 A;  3T4M A;  4ZK1 A;  4HQP A;  4TNW A;  4HFI A;  5FJV A;  4TWF A;  4LMK A;  2X00 D;  4AFG A;  2XNT A;  2Y57 A;  4B5D A;  3SQ6 A;  5BP0 A;  5BRX A;  5J5F A;  2LM2 A;  4QH5 A;  5JME A;  3JAD A;  2BG9 E;  4HFH A;  2UZ6 A;  4XK9 A;  4ZJS A;  3LSV A;  4IRE A;  3WTO A;  2W8G A;  5HEJ A;  3UU4 A;  2BYR A;  2PGZ A;  5HCM A;  2XQA A;  2MAW A;  5J5H A;  3UQ7 A;  3UU5 A;  2XQ7 A;  4UM3 P;  3WTH A;  5HEG A;  5LXB A;  3C84 A;  5AFH A;  4ILA A;  2VL0 A;  5HEH A;  5CO5 A;  3U8N A;  4QH4 A;  5HEU A;  3TLS A;  3ZKR A;  3EI0 A;  2WN9 A;  2BYS A;  2XQ5 A;  3RQW A;  2XYT A;  2XYS A;  2XZ5 A;  3WTM A;  2Y54 A;  2W8F A;  4FRR A;  3EAM A;  4ZZB A;  1I9B A;  4LML A;  4EZ1 A;  4ZZC A;  4ILB A;  5AIN A;  2XQ6 A;  5AFM B;  3TLV A;  4UY2 A;  3WTL A;  3U8K A;  4F8H A;  3SH1 A;  1OED B;  1OED A;  2LKG A;  3U8J A;  2BYP A;  5KE4 A;  4ZJT A;  2BJ0 A;  4ILC A;  4A97 A;  5TVC A;  2KSR A;  5CFB A;  1UX2 A;  2XQ3 A;  5L47 A;  5J5G A;  5AFL A;  2X00 A;  2XNV A;  2BG9 C;  3EHZ A;  2M6B A;  1UW6 A;  3UU8 A;  4QAC A;  5SYO A;  4HFC A;  4UM3 S;  4A98 A;  4TWD A;  2YN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...