5L47A

X-ray structure of the 2-22' locally-closed mutant of glic in complex with cyanoselenobarbital (seleniated barbiturate)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
source organism Gloeobacter
molecule tags Membrane protein, transport protein
total genus 88
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l47A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l47A01
5AFHA 3EAMA 3WTNA 5J5GA 5HCMA 5LXBA 4ZK4A 4F8HA 3WTKA 1OEDE 5FJVA 2KSRA 4WV9A 2XQ6A 2YKSA 3EHZA 2BJ0A 2W8FA 2PGZA 3U8MA 4ILBA 4IL9A 4ZZBA 4UM3A 4IL4A 5SYOA 2XQ5A 2PH9A 3SQ9A 2WZYA 3RIFA 2BYSA 5AFLA 2M6IA 3UU8A 3ZKRA 3U8JA 3ZDGA 4IREA 2ZJUA 4HQPA 4XK9A 2XYTA 5L4EA 3WTJA 4QACA 4ILAA 4QH5A 2XZ6A 2BG9C 5HEGA 3TLTA 2WN9A 2X00D 4NPPA 3JAFA 2MAWA 3WTLA 4UXUA 4EZ1A 4D01A 4ZJSA 3SH1A 2W8GA 5HEOA 4PIRA 2BG9A 4QABA 4UM3S 5HEUA 4ALXA 2WNCA 3LSVA 3UU6A 4AFHA 3RHWA 4A98A 4COFA 3WIPA 3C84A 5AINA 5TVCA 2XQ9A 3C79A 2WNJA 2LKHA 2XNTA 5J5FA 2Y56A 5HEHA 4TNVA 5IUXA 5L47A 3P4WA 5CO5A 2LKGA 4ILCA 2BYPA 2BG9B 2XQAA 4BQTA 1UV6A 1UX2A 2VL0A 3EI0A 5HCJA 5AFMA 5AFKA 4HFIA 3GUAA 4HFBA 5CFBA 4ZRUA 5BP0A 3UU4A 3RQUA 2QC1B 4UM3P 2BYQA 3SQ6A 4AFGA 3TLWA 2YN6A 3PMZA 4FRRA 4QAAA 5BW2A 3P50A 5AFNA 3TLUA 4LMKA 4HFHA 4Z90A 4NZBA 4TNWA 2Y58A 4DBMA 3WTIA 3UQ7A 3RI5A 3RIAA 1UW6A 3UUBA 4ZR6A 5AFJA 4QH4A 4HFDA 4A97A 2ZJVA 3WTMA 3WTHA 5HEJA 5AFMB 3U8KA 2XQ8A 2XNUA 1OEDC 5J5IA 3TLVA 4TWHA 4TWDA 3PEOA 2M6BA 1I9BA 4X5TA 2XZ5A 4HFEA 2XQ7A 2Y57A 2Y7YA 4UM1A 1OEDA 5KE4A 2YMDA 2C9TA 4XHEA 5JMEA 5KZUA 2BYRA 4QH1A 3UU3A 2BR7A 3ZDHA 4LMLA 4BFQA 2XNVA 3JADA 4ZZCA 2BYNA 4TWFA 3SIOA 2LM2A 2YOEA 4HFCA 3TLSA 5LG3A 2X00A 3U8LA 5L4HA 5J5HA 2BG9E 3RQWA 3WTOA 4B5DA 2LLYA 5J0ZA 2WNLA 4UY2A 3U8NA 2XQ3A 3JAEA 2BR8A 4Z91A 2UZ6A 3UQ4A 4ZJTA 2Y54A 4ZK1A 1OEDB 3T4MA 3IGQA 2XYSA 4AFTA 2XQ4A 4LMJA 3UU5A 2YMEA 5BRXA
chains in the Genus database with same CATH superfamily
2ACXA 2X51A 3WI3A 4AQGA 5JRCB 5FMNA 5LXBA 3EHZA 3F31A 4DMVA 2UXXB 1SHZC 5KDMC 2P9BA 4JI3T 3LG7A 3ZYKA 2UUCT 3I9YA 4IREA 3RIUA 4ZI7E 3N9PA 2DWKA 3RRWA 1ZEEA 4YY3T 3N9QA 5DQVA 3CIRA 4QXCB 3J7Yq 2A2FX 4O4HE 4N78D 1HNWT 2C5KT 4WBNE 4HWIB 3FB2A 5JDHA 2H3RA 3NBXX 5JTGA 2XNTA 1D1BA 2XQYA 4BQTA 2Z6EA 2A9UA 2WU5A 3VHLA 3AEBA 5HWXA 3ZMTB 5FXVA 2BKNA 4Z90A 3BQIA 3Q9DA 5IHYA 3H3MA 4CI1B 4PFOA 5J5IA 4PJNA 3SS1A 2CE7A 4X5TA 2E5LT 2JQHA 2L3LA 4EB6E 3MA9A 2CBJA 4TV8E 3RYFE 3QUJA 2NW9A 5JVDE 2LLYA 3VRAA 4U33A 2WP9A 4JI2T 5AQOB 2VKOA 2VVSA 2W00A 2XYSA 4QXBB 2YMEA 2IAKA 5AFHA 5HYAA 2IIUA 5AQFB 5F3JA 2V5DA 4C91A 5LJNA 4L9IA 5FXWA 3SFDA 3RIUC 3NKZA 5KX5E 4HQPA 4UV8B 2XYTA 3UUXB 5LGNB 4YFSA 4NPPA 4HE8A 5HWYA 3ZT7A 3LDQB 4UV9B 4LFCT 2ZM2A 3PUSA 4IE0A 4CXXA 5HEHA 2LKGA 4E7ZA 1E1HB 3N2GE 3LBXA 4EGWA 3PUVF 4KX6A 4O2BE 5LBQB 5HXRA 3CWZB 2YN6A 4YJ3E 4O2AE 5AFNA 4O4IE 2Y8DA 3QB5A 3C4ZA 1WYCA 3AE4A 3OJAA 3PUQA 2QYWA 2I0MA 2K5BB 5FVKA 2JMKA 2XQ8A 4JYAT 2PFVA 4TWDA 3PEOA 3I9WA 3QNUA 1WCRA 2WDQA 3PURA 1SA0E 3EDUA 1LVKA 3WAJA 2W62A 2ODVA 1VCSA 2BZBA 5ABEA 2WNLA 1AJ3A 2H88A 1SUMB 1T8BA 4H9PC 3IGQA 4UVAB 2VQFT 1KNZA 4I0UA 4WNKA 3WTNA 3ZJ1A 3QB5K 2WQYA 3KBTA 5JH7E 4WV9A 2UU9T 4BJMA 2W8FA 2WMNA 1WR0A 5ETWA 3M65A 4DV5T 5EK2A 2HPJA 3O4XE 4DBQA 4CN1A 5C3JA 2XQ5A 3E08A 4EYYR 5L3GB 3MACA 3ZC0A 2HN2A 2LE8A 4DR5T 2DCFA 5AQQB 3JAFA 1MIVA 5J2TE 2WCAA 1N32T 4AKLA 2NOXA 3HKCE 3VKHA 2CXDA 3ZLIA 5AQHB 2CCQA 3HKBE 2Y56A 2JMHA 1NAFA 2CRBA 4IDNA 3WAKA 2CBIA 3F57A 1UV6A 3EABA 5EZYE 3JC6C 1IZNB 3RQUA 2BYQA 4UF0A 4IGUA 3P50A 1HNZT 4U3CA 4HFHA 4NZBA 2V7MA 2LEHA 3ZSSA 5AQLB 2CHOA 4UF0B 5KZUA 2BYRA 3DP7A 1JNRA 4U74A 3JADA 2BYNA 4QWNB 5IWAT 4JLEA 3RQWA 4EXTA 5J1GA 2H7OA 3C50A 2YDQA 3UUNA 4B3ST 3AEFA 2BS4A 3G06A 4YTNA 5AQMB 2FBWA 4DV7T 2KSRA 4X1IE 1MNEA 1UK5A 2IUBA 5FKYA 2LRLA 1I94T 1IBLT 5AFLA 4U7IA 2W63A 1XWMA 2M6IA 3VKGA 4L5GA 4FI5A 1T7SA 1E2AA 3FZHB 5L3BB 4PIRA 2WNCA 1BR4A 2C5IT 3N9LA 5LB7B 2BDEA 3AEGA 4DUZT 2LOSA 2IHR1 3J9X1 5TAOA 3MJXA 5DQWA 4G2AA 2KWHA 3KBUA 5LOVE 4CQIA 4ANJA 2N1GA 2X0HA 3UU4A 3ZMVB 4AFGA 2LSJA 4EAHA 4HEAA 1XNQT 2XSAA 3I0OA 3NZPA 3RKGA 4O4JE 3UUBA 1M62A 2E9XA 3U8KA 4L0RA 2LHNA 3S4UA 3C4WA 5L3DB 2M67A 2YU2A 2X9XA 4KP3C 1XNRT 2E9XB 2LM2A 2YOEA 5LG3A 4V1Av 1LRZA 2XAJB 2BR8A 4UR9A 4YLHA 4J2CA 4ZK1A 4LFBT 3T4MA 4DR7T 4I50E 3E22E 4DR4T 4DV3T 4UVBB 4IE7A 1KEYA 3CX7B 1HNXT 1ZV4X 2FJEA 2VASA 4GK0E 2WZIA 3NVOA 2OA5A 3NZQA 4IE5A 3ETUA 4NUUA 2XAFB 3BK9A 4D01A 4ZI3D 4JEUB 3CX8B 2KWIB 2KXPB 2VKJA 1N34T 3WIPA 3C84A 4P1NA 3QOFA 2WDVA 5AQKB 4Q25A 4YT0A 5HCJA 3GUAA 2D2SA 4AKGA 2RA1A 4PJJA 1UCUA 2BS2A 4GOUA 2E9XC 2MPKA 4DV4T 2OLTA 4A97A 2HN1A 2ZJVA 2C5JA 3VR8A 4DV6T 2V7KA 3TLVA 3QK6A 4HFEA 4X64T 1HX1B 4XHEA 3OYXA 4OYKA 3NRYA 3JCFA 4O8SA 1W9RA 4ZZCA 4ZI3C 4TWFA 4IE6A 4KI0F 2BG9E 2JJ9A 2UZ6A 4A5XA 2Y54A 4K0KT 3Q5WA 3OTOT 2UXBT 4ZS3A 3FBLA 2W61A 4QXHB 2KNDA 4E7SA 1UUSA 2MBGA 3KV6A 3AB3B 4NXNT 3SRZA 1T72A 3FZMB 1HTJF 2NTYA 3ZCIA 3Q5XA 5J2UE 2LOPA 3AE1A 3H37A 5LCYA 2IMLA 2MTQA 3WTJA 3N2OA 2DL1A 2YDSA 3OYZA 4ZJSA 3SH1A 1MIWA 5HEOA 4U72A 4ZHQE 4QABA 3RHWA 1SE7A 1CHUA 2X0YA 3DTOA 2IC9A 4LF5T 1Y64B 1FMVA 2XHEB 5LGUB 4ILCA 4PJMA 5JQGE 5BP0A 5FL0A 1FMWA 4JI0T 5DABA 3E0ZA 4GIWA 5LA6E 3RI5A 2MYSA 5AFJA 4ZR6A 1XZYA 4JUYA 2WZHA 4TX5A 2K3WA 1UX4A 3Q5DA 4YTMA 2QA7A 4UM1A 4DV0T 4YXDA 3CQGB 3AA7B 2XUEA 3MK7C 2XAGB 3WTOA 3FZLB 1ZHCA 1YKHB 4MLKA 3AEEA 1WR6A 3UT5E 3MKDA 3PUWF 3O1IA 2CWOA 2XAQB 4JI8T 4GYSA 5IYZE 5FL1A 5KMGP 1KK7A 4UM3A 4ZXLA 5CB4E 2CLYB 2MOZA 2W0GA 3RYIE 2IDOB 4ZEYA 3CK6A 4AXPA 2B1EA 2NW8A 5HXEA 3RX6A 3ONJA 2WDRA 3UU6A 4KHPT 4EEBA 2XQ9A 4MHCA 2YINA 4X62T 2VKHA 3RLFF 1D0XA 4HWFA 5LBMA 3O9XA 4B6XA 3T1YT 3A5XA 3UFGA 4YTPA 2HHHT 2GK9A 4HFBA 3B5MA 1YD8G 3OPCA 5JDFA 5CGMA 3OKQA 3H3AA 4CN6A 5LNKA 3Q5EA 4HFDA 2UUAT 2PBIA 5FXXA 5C8YE 3L3PA 5LMUT 3BQLA 4BFQA 2DHRA 4WBOA 1JNZA 5J5HA 4ZOLE 3UQ4A 3QC9A 2CLYC 3W15B 4UVCB 3EAMA 5HCMA 4OHFA 4F8HA 3T8OA 4B3RT 5FY1A 1IJ5A 5A1LA 2XJ7A 3A7MA 3C4XA 1BR1A 3R84B 4ISTA 5SYOA 4GK5E 5JDLA 5JR9A 4X65T 3RF1A 2XSBA 2FJAA 3PJAJ 4X1YE 4NUVA 4KUMB 3MZKB 2Q9QD 5FY0A 2V26A 2EHOA 5EK3A 5JDGA 4EIWA 1BR0A 3FXEB 5DJQC 4COFA 1ZOYA 5JR9B 5AQSB 4OYJA 3AA6B 4UELA 3C79A 1HFAA 5H6QB 4EZ4A 2BBHA 5L47A 2EHOB 4H63H 2PJQA 3EI0A 4PNIA 3ZMZB 3P7IA 2CHNA 1ZKEA 4FRRA 4QAAA 5AQVB 3KVBA 3VR9A 3FBZA 2EHOD 4U2ZA 3AXJB 2JQQA 3KV5A 4HFVA 4MBQA 5CA1E 4DR3T 3N9MA 2E5VA 4LF8T 4DO0A 2UXCT 4Z8XA 2BR7A 3FHNA 3ZJ2A 1MMAA 2F4VT 3CQCB 4B5DA 3HA4A 4ZS2A 4B3MT 4UY2A 4Z91A 3EVYA 2UXNB 4XAXB 3PUZF 3RKOA 3UU5A 2V6XA 3AA1B 2JIWA 1R8IA 4I55E 1YQ3A 2V5CA 5GONE 4PFPA 3AE5A 5JR9C 2XM2A 2PG8A 1H7CA 2CXLA 2X67A 3ZKRA 3L8RA 1IBMT 2EHOC 1J5WA 2XZ6A 3AECA 3UFEA 5HEGA 3TLTA 1MMDA 3K8PC 2XASB 4UM3S 3L39A 5FVLA 1KFYA 5LGTB 2N2NA 4X20E 2SPCA 3PTRB 4IIJE 5EK4A 3RPUA 2W66A 4DBRA 3GN5A 4O4LE 1HF8A 4YSZA 4ZRUA 4AKHA 1WRDA 3PMZA 5AQPB 2D5UA 1LVFA 4DBMA 1UX5A 4QH4A 1D0YA 3SWHA 5HEJA 3GN5B 4GKKT 3KV9A 2Y48B 3KINB 1VRBA 1OEDA 2H7VC 4HN9A 2K48A 4JI1T 1HG2A 3UTKA 1MIYA 5JDNA 4HFCA 1QUUA 3AAAB 1N36T 4IT4A 4DIDB 4EOZB 1OEDB 4KBMB 2W67A 3SOLA 4LMJA 4TN7B 4HWHA 3K3NA 1BR2A 3P4PA 2FJBA 2XQ6A 1D1AA 3IBPA 2K24A 2J4GA 3SQ9A 1YW0A 3U8JA 2L9QA 3B57A 3HL6A 2DWGA 1HCIA 5H6RB 4IE4A 4OX9T 2CM0A 5HEUA 4ALXA 4YSYA 3PDYA 5AINA 1DU2A 3ZN1B 2LT3A 2L8KA 4LF4T 5AQTB 5FNVE 1S94A 1UX2A 2V7IA 4HFIA 1WFDA 3ESLA 4NIQA 3TLWA 1O3XA 3TLUA 4DR2T 4KHZF 5LJMA 5C2TA 4AISA 2IW5B 1G8XA 3Q2MA 5AQUB 3ZYMA 1OEDC 3CKDA 2BKPA 4B3TT 2NTXA 4QH1A 2B76A 2VL8A 3DJBA 4LMLA 2XNVA 2NR4A 1FJGT 2V7JA 4HKAA 2WS3A 2KINB 2LSYA 1M7KA 3F2EA 5AFUL 4WZXA 5LMNT 2WU2A 3VU7H 2XQ4A 2CA5A 3VRBA 1VCTA 2A3DA 2BBJA 5LHGB 3LJCA 5FJVA 4U31A 2PGZA 2KLQA 3N2KE 4LF9T 3KVAA 4ZZBA 4M1PA 4MFRA 3MXZA 3RIFA 5FY7A 1V9DA 3AVRA 3T1HT 4XK9A 4DR1T 2ES0A 4QACA 4JBWF 2K9AA 3SFEA 2VWAA 4HWDA 3PUAA 4UXNB 3LSVA 3ABVA 2WWVA 4DMWA 1LKXA 1HG5A 4DV1T 2AE9A 3LK42 3AE8A 2XTLA 3HR0A 1IBKT 2CMRA 3KDSE 3IEEA 3L09A 4QHOA 1KNPA 4DR6T 5LYJE 4BJNA 2H89A 1UURA 2KZ7B 2VQET 3X1DA 4AKRB 3RYCE 4TZ4C 2VKDA 4JI4T 4BA9A 3WTMA 5ABFA 2ZM6T 4AI6A 3UUMA 5JREA 2M6BA 2V7LA 3RC8A 4TUYE 4X1KE 2JQKA 2YU1A 5ABGA 3I1AA 2NP9A 2X00A 5ABFB 3PU8A 2YK0A 3U8NA 3ZT5A 4IDPA 2CPTA 3GA8A 2LJLA 3LK3B 3PUYF 4ZK4A 3IF8B 2QGSA 2YKSA 4IHJE 3U8MA 4ILBA 1OWAA 1QLBA 4IL4A 1X9BA 2PH9A 3ONXA 2J1DG 5F5WA 2X9YA 4ILAA 3CPZA 4QH5A 4JI7T 2X00D 1J5ET 3WTLA 5CA0E 2WWUA 3OBVE 4H9OC 2W8GA 3PJAA 5AQNB 4DUYT 3RC3A 1U4QA 4A98A 3ZPOA 2LSKA 4CN4A 2IC6A 2N9DA 1MNDA 3GWHA 4AQYT 3AE9A 1Y01A 3LK2B 3PE0A 3C64A 5IUXA 5CO5A 3P4WA 1Z8UA 4QX7B 4TV9E 5AQRB 2VL0A 5AQIB 4CI2B 2LSGA 3K3OA 3PV0F 4H63V 2ODUA 2ZMAA 3KV4A 1U5PA 4TWHA 3IHRA 2Y7YA 1W0AA 1WLXA 3BQKA 2C9TA 5JMEA 2BVMA 2XPKA 3IA3A 3P8CD 2D9DA 4XZCA 3U8LA 1L0VA 4HGAA 3AA0B 1HR0T 4ASKA 4HTEA 2X0LB 5J5GA 4I4TE 3PUGA 1OEDE 2XM1A 4DNDA 2HH7A 2Q9QA 2D0TA 4YJ2E 5AQGB 2BS3A 3UU8A 4GKJT 4CXWA 4A56A 4XBFB 2WMOA 4LFAT 1W09A 2W2UA 1KF6A 2BG9A 2Q9QB 4PK6A 5LXTE 4AFHA 2CEAA 3HKDE 4ZI2D 2E2AA 1EZ3A 3O1HA 2AXDS 4WYVA 1UGOA 3LBXB 1US7B 5JDQA 1VOMA 5CJ5A 3R6NA 3EDVA 3ONLC 5FXZA 2BG9B 3ZN0B 2VB6A 4P0BA 4MALA 5HXHA 4UM3P 2WY2A 2X9WA 4H9RC 5HXSA 2YDRA 3UQ7A 3RIAA 2CWYA 3HI2A 2J62A 2XNUA 2KT9A 1W0BA 5M4YA 5L3FB 4H9SE 2XZ5A 4PW8A 3JC6D 2JQ9A 2Y57A 4U2YA 5KE4A 3AXJA 2YMDA 4EZHA 4QKNA 1I6ZA 4PJLA 4U7YA 2ZLYA 1IAPA 5L4HA 4I43B 4ZI2C 5JDMA 5HXCA 3B13A 1HS7A 3KFWX 2LSIA 3FZKB 4ILUA 3M3ZB 3RH3A 4AFTA 5BRXA 1FIOA 3AE2A 3ZC1A 3AE3A 4C90A 3LFMA 2Q9QC 2J47A 4KMCA 2BJ0A 4JI6T 3NRXA 5LP6E 2WZYA 2BYSA 4UIGA 3AEDA 2LHRA 5L4EA 4BAYB 2BG9C 2WN9A 2XAHB 4PK4A 2X66A 3ZMSB 2PTFA 3AE7A 3HKEE 3GMIA 5L3CB 3C51A 2WSSV 2LKHA 4ERRA 4TNVA 4LF6T 5ADXL 4AKIA 2XQAA 5AFKA 2HPLA 5AQJB 2QC1B 2YEVC 3FZFB 5BW2A 4F6RC 1XDPA 4TNWA 2BVLA 2Y58A 3TKLB 3WTIA 4YHHT 4ADZA 2QVAA 5E0OA 1T98A 2A72A 2XZEA 5HAXA 4P09A 3ETVA 4EV6A 5F8PA 4P0AA 4CXYA 3V5SA 2OV9A 3OVUA 3FXDB 1NEKA 3D0TA 3CMLA 2D0UA 2NW7A 1HX8A 4CI3B 2JRKA 5KXJA 4ZJTA 2VK9A 4NXMT 2UXDT 3P4SA 3RYHE 3N5LA 3WTKA 4IDZA 2DLRA 2LM9A 3EUHA 1J1JA 4YSXA 3ZDGA 2VVNA 4G63A 2ZJUA 4DVDA 4EZ1A 4AQFA 4UXUA 4PK5A 5LG4A 1X79A 1IJ6A 2XY8B 2WM9A 1NENA 2X9HA 4EEDA 1N33T 5J5FA 5BMVE 3A8YC 1FEWA 2BYPA 2ZM8A 5AFMA 2CXFA 5CFBA 3SQ6A 5L3EB 4YHJA 1NWMX 4LMKA 3U3IA 3CQXC 2JPFA 1UW6A 1XMOT 1CUNA 5AFMB 3PUXF 3RRCA 4DV2T 1E7PA 4AIUA 1I9BA 1XMQT 3NWIA 2E8IA 3UU3A 2E9XD 2C0SA 2V1DB 4LF7T 1YQ4A 3C98B 3TLSA 3ZCJA 4OFZA 3ZMUB 2UUBT 2FUPA 3PU3A 2G0UA 5J0ZA 1QSDA 5BR8T 3AE6A 4PAGA 3V5UA 3UULA 2I6HA 3ZYLA 2QRXA 5FYMA 2ZM0A 4JI5T 3ZT6A 3U78A 3AAIA 4UEMA 3ZEFB 4IL9A 3CVRA 3ANWA 1S35A 1GQEA 3RGLA 4AQFC 2RPAA 2WAUA 2MAWA 2WBLA 2FJDA 4H9QC 2X68A 1ZP0A 2Y6XA 3ANWB 1WYBA 1YKEB 2W4XA 5TVCA 2LRKA 1XDOA 2WNJA 2DNXA 2DI4A 1D1CA 4JEHB 1Z0PA 3AAEB 3CX6B 5LHIB 1KNRA 4JV5T 4EYUA 4OK0A 2V6YA 4FJOA 4GYRA 3O1JA 4CZZB 2KMFA 3I0QA 1MMGA 1MMNA 1G73A 2V8SV 2NWBA 3P4QA 3WTHA 2V6YB 3N9OA 2R6GF 3K3QC 2RP4A 2I59A 3N9NA 5LHHB 5L2LA 4IDOA 2XQ7A 2VURA 3P4RA 5ABHA 3AEAA 3ZDHA 2BKOA 2WB5A 4IDQA 3AVSA 4WW0A 4HWCA 5JRCA 3SIOA 2ACZA 3ZSTA 1OXZA 5FP3A 2XQ3A 3JAEA 4H9NC 4X66T 3K1SA 1D0ZA 1YXRA 4K0UA 4ISSA 1B7TA 4QX8B
chains in the Genus database with same CATH topology
5AFHA 3EAMA 3WTNA 5J5GA 5HCMA 5LXBA 4ZK4A 4F8HA 3WTKA 1OEDE 5FJVA 2KSRA 4WV9A 2XQ6A 2YKSA 3EHZA 2BJ0A 2W8FA 2PGZA 3U8MA 4ILBA 4IL9A 4ZZBA 4UM3A 4IL4A 5SYOA 2XQ5A 2PH9A 3SQ9A 2WZYA 3RIFA 2BYSA 5AFLA 2M6IA 3UU8A 3ZKRA 3U8JA 3ZDGA 4IREA 2ZJUA 4HQPA 4XK9A 2XYTA 5L4EA 3WTJA 4QACA 4ILAA 4QH5A 2XZ6A 2BG9C 5HEGA 3TLTA 2WN9A 2X00D 4NPPA 3JAFA 2MAWA 3WTLA 4UXUA 4EZ1A 4D01A 4ZJSA 3SH1A 2W8GA 5HEOA 4PIRA 2BG9A 4QABA 4UM3S 5HEUA 4ALXA 2WNCA 3LSVA 3UU6A 4AFHA 3RHWA 4A98A 4COFA 3WIPA 3C84A 5AINA 5TVCA 2XQ9A 3C79A 2WNJA 2LKHA 2XNTA 5J5FA 2Y56A 5HEHA 4TNVA 5IUXA 5L47A 3P4WA 5CO5A 2LKGA 4ILCA 2BYPA 2BG9B 2XQAA 4BQTA 1UV6A 1UX2A 2VL0A 3EI0A 5HCJA 5AFMA 5AFKA 4HFIA 3GUAA 4HFBA 5CFBA 4ZRUA 5BP0A 3UU4A 3RQUA 2QC1B 4UM3P 2BYQA 3SQ6A 4AFGA 3TLWA 2YN6A 3PMZA 4FRRA 4QAAA 5BW2A 3P50A 5AFNA 3TLUA 4LMKA 4HFHA 4Z90A 4NZBA 4TNWA 2Y58A 4DBMA 3WTIA 3UQ7A 3RI5A 3RIAA 1UW6A 3UUBA 4ZR6A 5AFJA 4QH4A 4HFDA 4A97A 2ZJVA 3WTMA 3WTHA 5HEJA 5AFMB 3U8KA 2XQ8A 2XNUA 1OEDC 5J5IA 3TLVA 4TWHA 4TWDA 3PEOA 2M6BA 1I9BA 4X5TA 2XZ5A 4HFEA 2XQ7A 2Y57A 2Y7YA 4UM1A 1OEDA 5KE4A 2YMDA 2C9TA 4XHEA 5JMEA 5KZUA 2BYRA 4QH1A 3UU3A 2BR7A 3ZDHA 4LMLA 4BFQA 2XNVA 3JADA 4ZZCA 2BYNA 4TWFA 3SIOA 2LM2A 2YOEA 4HFCA 3TLSA 5LG3A 2X00A 3U8LA 5L4HA 5J5HA 2BG9E 3RQWA 3WTOA 4B5DA 2LLYA 5J0ZA 2WNLA 4UY2A 3U8NA 2XQ3A 3JAEA 2BR8A 4Z91A 2UZ6A 3UQ4A 4ZJTA 2Y54A 4ZK1A 1OEDB 3T4MA 3IGQA 2XYSA 4AFTA 2XQ4A 4LMJA 3UU5A 2YMEA 5BRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFH A;  3EAM A;  3WTN A;  5J5G A;  5HCM A;  5LXB A;  4ZK4 A;  4F8H A;  3WTK A;  1OED E;  5FJV A;  2KSR A;  4WV9 A;  2XQ6 A;  2YKS A;  3EHZ A;  2BJ0 A;  2W8F A;  2PGZ A;  3U8M A;  4ILB A;  4IL9 A;  4ZZB A;  4UM3 A;  4IL4 A;  5SYO A;  2XQ5 A;  2PH9 A;  3SQ9 A;  2WZY A;  3RIF A;  2BYS A;  5AFL A;  2M6I A;  3UU8 A;  3ZKR A;  3U8J A;  3ZDG A;  4IRE A;  2ZJU A;  4HQP A;  4XK9 A;  2XYT A;  5L4E A;  3WTJ A;  4QAC A;  4ILA A;  4QH5 A;  2XZ6 A;  2BG9 C;  5HEG A;  3TLT A;  2WN9 A;  2X00 D;  4NPP A;  3JAF A;  2MAW A;  3WTL A;  4UXU A;  4EZ1 A;  4D01 A;  4ZJS A;  3SH1 A;  2W8G A;  5HEO A;  4PIR A;  2BG9 A;  4QAB A;  4UM3 S;  5HEU A;  4ALX A;  2WNC A;  3LSV A;  3UU6 A;  4AFH A;  3RHW A;  4A98 A;  4COF A;  3WIP A;  3C84 A;  5AIN A;  5TVC A;  2XQ9 A;  3C79 A;  2WNJ A;  2LKH A;  2XNT A;  5J5F A;  2Y56 A;  5HEH A;  4TNV A;  5IUX A;  5L47 A;  3P4W A;  5CO5 A;  2LKG A;  4ILC A;  2BYP A;  2BG9 B;  2XQA A;  4BQT A;  1UV6 A;  1UX2 A;  2VL0 A;  3EI0 A;  5HCJ A;  5AFM A;  5AFK A;  4HFI A;  3GUA A;  4HFB A;  5CFB A;  4ZRU A;  5BP0 A;  3UU4 A;  3RQU A;  2QC1 B;  4UM3 P;  2BYQ A;  3SQ6 A;  4AFG A;  3TLW A;  2YN6 A;  3PMZ A;  4FRR A;  4QAA A;  5BW2 A;  3P50 A;  5AFN A;  3TLU A;  4LMK A;  4HFH A;  4Z90 A;  4NZB A;  4TNW A;  2Y58 A;  4DBM A;  3WTI A;  3UQ7 A;  3RI5 A;  3RIA A;  1UW6 A;  3UUB A;  4ZR6 A;  5AFJ A;  4QH4 A;  4HFD A;  4A97 A;  2ZJV A;  3WTM A;  3WTH A;  5HEJ A;  5AFM B;  3U8K A;  2XQ8 A;  2XNU A;  1OED C;  5J5I A;  3TLV A;  4TWH A;  4TWD A;  3PEO A;  2M6B A;  1I9B A;  4X5T A;  2XZ5 A;  4HFE A;  2XQ7 A;  2Y57 A;  2Y7Y A;  4UM1 A;  1OED A;  5KE4 A;  2YMD A;  2C9T A;  4XHE A;  5JME A;  5KZU A;  2BYR A;  4QH1 A;  3UU3 A;  2BR7 A;  3ZDH A;  4LML A;  4BFQ A;  2XNV A;  3JAD A;  4ZZC A;  2BYN A;  4TWF A;  3SIO A;  2LM2 A;  2YOE A;  4HFC A;  3TLS A;  5LG3 A;  2X00 A;  3U8L A;  5L4H A;  5J5H A;  2BG9 E;  3RQW A;  3WTO A;  4B5D A;  2LLY A;  5J0Z A;  2WNL A;  4UY2 A;  3U8N A;  2XQ3 A;  3JAE A;  2BR8 A;  4Z91 A;  2UZ6 A;  3UQ4 A;  4ZJT A;  2Y54 A;  4ZK1 A;  1OED B;  3T4M A;  3IGQ A;  2XYS A;  4AFT A;  2XQ4 A;  4LMJ A;  3UU5 A;  2YME A;  5BRX A; 
#chains in the Genus database with same CATH topology
 2ACX A;  2X51 A;  3WI3 A;  4AQG A;  5JRC B;  5FMN A;  5LXB A;  3EHZ A;  3F31 A;  4DMV A;  2UXX B;  1SHZ C;  5KDM C;  2P9B A;  4JI3 T;  3LG7 A;  3ZYK A;  2UUC T;  3I9Y A;  4IRE A;  3RIU A;  4ZI7 E;  3N9P A;  2DWK A;  3RRW A;  1ZEE A;  4YY3 T;  3N9Q A;  5DQV A;  3CIR A;  4QXC B;  3J7Y q;  2A2F X;  4O4H E;  4N78 D;  1HNW T;  2C5K T;  4WBN E;  4HWI B;  3FB2 A;  5JDH A;  2H3R A;  3NBX X;  5JTG A;  2XNT A;  1D1B A;  2XQY A;  4BQT A;  2Z6E A;  2A9U A;  2WU5 A;  3VHL A;  3AEB A;  5HWX A;  3ZMT B;  5FXV A;  2BKN A;  4Z90 A;  3BQI A;  3Q9D A;  5IHY A;  3H3M A;  4CI1 B;  4PFO A;  5J5I A;  4PJN A;  3SS1 A;  2CE7 A;  4X5T A;  2E5L T;  2JQH A;  2L3L A;  4EB6 E;  3MA9 A;  2CBJ A;  4TV8 E;  3RYF E;  3QUJ A;  2NW9 A;  5JVD E;  2LLY A;  3VRA A;  4U33 A;  2WP9 A;  4JI2 T;  5AQO B;  2VKO A;  2VVS A;  2W00 A;  2XYS A;  4QXB B;  2YME A;  2IAK A;  5AFH A;  5HYA A;  2IIU A;  5AQF B;  5F3J A;  2V5D A;  4C91 A;  5LJN A;  4L9I A;  5FXW A;  3SFD A;  3RIU C;  3NKZ A;  5KX5 E;  4HQP A;  4UV8 B;  2XYT A;  3UUX B;  5LGN B;  4YFS A;  4NPP A;  4HE8 A;  5HWY A;  3ZT7 A;  3LDQ B;  4UV9 B;  4LFC T;  2ZM2 A;  3PUS A;  4IE0 A;  4CXX A;  5HEH A;  2LKG A;  4E7Z A;  1E1H B;  3N2G E;  3LBX A;  4EGW A;  3PUV F;  4KX6 A;  4O2B E;  5LBQ B;  5HXR A;  3CWZ B;  2YN6 A;  4YJ3 E;  4O2A E;  5AFN A;  4O4I E;  2Y8D A;  3QB5 A;  3C4Z A;  1WYC A;  3AE4 A;  3OJA A;  3PUQ A;  2QYW A;  2I0M A;  2K5B B;  5FVK A;  2JMK A;  2XQ8 A;  4JYA T;  2PFV A;  4TWD A;  3PEO A;  3I9W A;  3QNU A;  1WCR A;  2WDQ A;  3PUR A;  1SA0 E;  3EDU A;  1LVK A;  3WAJ A;  2W62 A;  2ODV A;  1VCS A;  2BZB A;  5ABE A;  2WNL A;  1AJ3 A;  2H88 A;  1SUM B;  1T8B A;  4H9P C;  3IGQ A;  4UVA B;  2VQF T;  1KNZ A;  4I0U A;  4WNK A;  3WTN A;  3ZJ1 A;  3QB5 K;  2WQY A;  3KBT A;  5JH7 E;  4WV9 A;  2UU9 T;  4BJM A;  2W8F A;  2WMN A;  1WR0 A;  5ETW A;  3M65 A;  4DV5 T;  5EK2 A;  2HPJ A;  3O4X E;  4DBQ A;  4CN1 A;  5C3J A;  2XQ5 A;  3E08 A;  4EYY R;  5L3G B;  3MAC A;  3ZC0 A;  2HN2 A;  2LE8 A;  4DR5 T;  2DCF A;  5AQQ B;  3JAF A;  1MIV A;  5J2T E;  2WCA A;  1N32 T;  4AKL A;  2NOX A;  3HKC E;  3VKH A;  2CXD A;  3ZLI A;  5AQH B;  2CCQ A;  3HKB E;  2Y56 A;  2JMH A;  1NAF A;  2CRB A;  4IDN A;  3WAK A;  2CBI A;  3F57 A;  1UV6 A;  3EAB A;  5EZY E;  3JC6 C;  1IZN B;  3RQU A;  2BYQ A;  4UF0 A;  4IGU A;  3P50 A;  1HNZ T;  4U3C A;  4HFH A;  4NZB A;  2V7M A;  2LEH A;  3ZSS A;  5AQL B;  2CHO A;  4UF0 B;  5KZU A;  2BYR A;  3DP7 A;  1JNR A;  4U74 A;  3JAD A;  2BYN A;  4QWN B;  5IWA T;  4JLE A;  3RQW A;  4EXT A;  5J1G A;  2H7O A;  3C50 A;  2YDQ A;  3UUN A;  4B3S T;  3AEF A;  2BS4 A;  3G06 A;  4YTN A;  5AQM B;  2FBW A;  4DV7 T;  2KSR A;  4X1I E;  1MNE A;  1UK5 A;  2IUB A;  5FKY A;  2LRL A;  1I94 T;  1IBL T;  5AFL A;  4U7I A;  2W63 A;  1XWM A;  2M6I A;  3VKG A;  4L5G A;  4FI5 A;  1T7S A;  1E2A A;  3FZH B;  5L3B B;  4PIR A;  2WNC A;  1BR4 A;  2C5I T;  3N9L A;  5LB7 B;  2BDE A;  3AEG A;  4DUZ T;  2LOS A;  2IHR 1;  3J9X 1;  5TAO A;  3MJX A;  5DQW A;  4G2A A;  2KWH A;  3KBU A;  5LOV E;  4CQI A;  4ANJ A;  2N1G A;  2X0H A;  3UU4 A;  3ZMV B;  4AFG A;  2LSJ A;  4EAH A;  4HEA A;  1XNQ T;  2XSA A;  3I0O A;  3NZP A;  3RKG A;  4O4J E;  3UUB A;  1M62 A;  2E9X A;  3U8K A;  4L0R A;  2LHN A;  3S4U A;  3C4W A;  5L3D B;  2M67 A;  2YU2 A;  2X9X A;  4KP3 C;  1XNR T;  2E9X B;  2LM2 A;  2YOE A;  5LG3 A;  4V1A v;  1LRZ A;  2XAJ B;  2BR8 A;  4UR9 A;  4YLH A;  4J2C A;  4ZK1 A;  4LFB T;  3T4M A;  4DR7 T;  4I50 E;  3E22 E;  4DR4 T;  4DV3 T;  4UVB B;  4IE7 A;  1KEY A;  3CX7 B;  1HNX T;  1ZV4 X;  2FJE A;  2VAS A;  4GK0 E;  2WZI A;  3NVO A;  2OA5 A;  3NZQ A;  4IE5 A;  3ETU A;  4NUU A;  2XAF B;  3BK9 A;  4D01 A;  4ZI3 D;  4JEU B;  3CX8 B;  2KWI B;  2KXP B;  2VKJ A;  1N34 T;  3WIP A;  3C84 A;  4P1N A;  3QOF A;  2WDV A;  5AQK B;  4Q25 A;  4YT0 A;  5HCJ A;  3GUA A;  2D2S A;  4AKG A;  2RA1 A;  4PJJ A;  1UCU A;  2BS2 A;  4GOU A;  2E9X C;  2MPK A;  4DV4 T;  2OLT A;  4A97 A;  2HN1 A;  2ZJV A;  2C5J A;  3VR8 A;  4DV6 T;  2V7K A;  3TLV A;  3QK6 A;  4HFE A;  4X64 T;  1HX1 B;  4XHE A;  3OYX A;  4OYK A;  3NRY A;  3JCF A;  4O8S A;  1W9R A;  4ZZC A;  4ZI3 C;  4TWF A;  4IE6 A;  4KI0 F;  2BG9 E;  2JJ9 A;  2UZ6 A;  4A5X A;  2Y54 A;  4K0K T;  3Q5W A;  3OTO T;  2UXB T;  4ZS3 A;  3FBL A;  2W61 A;  4QXH B;  2KND A;  4E7S A;  1UUS A;  2MBG A;  3KV6 A;  3AB3 B;  4NXN T;  3SRZ A;  1T72 A;  3FZM B;  1HTJ F;  2NTY A;  3ZCI A;  3Q5X A;  5J2U E;  2LOP A;  3AE1 A;  3H37 A;  5LCY A;  2IML A;  2MTQ A;  3WTJ A;  3N2O A;  2DL1 A;  2YDS A;  3OYZ A;  4ZJS A;  3SH1 A;  1MIW A;  5HEO A;  4U72 A;  4ZHQ E;  4QAB A;  3RHW A;  1SE7 A;  1CHU A;  2X0Y A;  3DTO A;  2IC9 A;  4LF5 T;  1Y64 B;  1FMV A;  2XHE B;  5LGU B;  4ILC A;  4PJM A;  5JQG E;  5BP0 A;  5FL0 A;  1FMW A;  4JI0 T;  5DAB A;  3E0Z A;  4GIW A;  5LA6 E;  3RI5 A;  2MYS A;  5AFJ A;  4ZR6 A;  1XZY A;  4JUY A;  2WZH A;  4TX5 A;  2K3W A;  1UX4 A;  3Q5D A;  4YTM A;  2QA7 A;  4UM1 A;  4DV0 T;  4YXD A;  3CQG B;  3AA7 B;  2XUE A;  3MK7 C;  2XAG B;  3WTO A;  3FZL B;  1ZHC A;  1YKH B;  4MLK A;  3AEE A;  1WR6 A;  3UT5 E;  3MKD A;  3PUW F;  3O1I A;  2CWO A;  2XAQ B;  4JI8 T;  4GYS A;  5IYZ E;  5FL1 A;  5KMG P;  1KK7 A;  4UM3 A;  4ZXL A;  5CB4 E;  2CLY B;  2MOZ A;  2W0G A;  3RYI E;  2IDO B;  4ZEY A;  3CK6 A;  4AXP A;  2B1E A;  2NW8 A;  5HXE A;  3RX6 A;  3ONJ A;  2WDR A;  3UU6 A;  4KHP T;  4EEB A;  2XQ9 A;  4MHC A;  2YIN A;  4X62 T;  2VKH A;  3RLF F;  1D0X A;  4HWF A;  5LBM A;  3O9X A;  4B6X A;  3T1Y T;  3A5X A;  3UFG A;  4YTP A;  2HHH T;  2GK9 A;  4HFB A;  3B5M A;  1YD8 G;  3OPC A;  5JDF A;  5CGM A;  3OKQ A;  3H3A A;  4CN6 A;  5LNK A;  3Q5E A;  4HFD A;  2UUA T;  2PBI A;  5FXX A;  5C8Y E;  3L3P A;  5LMU T;  3BQL A;  4BFQ A;  2DHR A;  4WBO A;  1JNZ A;  5J5H A;  4ZOL E;  3UQ4 A;  3QC9 A;  2CLY C;  3W15 B;  4UVC B;  3EAM A;  5HCM A;  4OHF A;  4F8H A;  3T8O A;  4B3R T;  5FY1 A;  1IJ5 A;  5A1L A;  2XJ7 A;  3A7M A;  3C4X A;  1BR1 A;  3R84 B;  4IST A;  5SYO A;  4GK5 E;  5JDL A;  5JR9 A;  4X65 T;  3RF1 A;  2XSB A;  2FJA A;  3PJA J;  4X1Y E;  4NUV A;  4KUM B;  3MZK B;  2Q9Q D;  5FY0 A;  2V26 A;  2EHO A;  5EK3 A;  5JDG A;  4EIW A;  1BR0 A;  3FXE B;  5DJQ C;  4COF A;  1ZOY A;  5JR9 B;  5AQS B;  4OYJ A;  3AA6 B;  4UEL A;  3C79 A;  1HFA A;  5H6Q B;  4EZ4 A;  2BBH A;  5L47 A;  2EHO B;  4H63 H;  2PJQ A;  3EI0 A;  4PNI A;  3ZMZ B;  3P7I A;  2CHN A;  1ZKE A;  4FRR A;  4QAA A;  5AQV B;  3KVB A;  3VR9 A;  3FBZ A;  2EHO D;  4U2Z A;  3AXJ B;  2JQQ A;  3KV5 A;  4HFV A;  4MBQ A;  5CA1 E;  4DR3 T;  3N9M A;  2E5V A;  4LF8 T;  4DO0 A;  2UXC T;  4Z8X A;  2BR7 A;  3FHN A;  3ZJ2 A;  1MMA A;  2F4V T;  3CQC B;  4B5D A;  3HA4 A;  4ZS2 A;  4B3M T;  4UY2 A;  4Z91 A;  3EVY A;  2UXN B;  4XAX B;  3PUZ F;  3RKO A;  3UU5 A;  2V6X A;  3AA1 B;  2JIW A;  1R8I A;  4I55 E;  1YQ3 A;  2V5C A;  5GON E;  4PFP A;  3AE5 A;  5JR9 C;  2XM2 A;  2PG8 A;  1H7C A;  2CXL A;  2X67 A;  3ZKR A;  3L8R A;  1IBM T;  2EHO C;  1J5W A;  2XZ6 A;  3AEC A;  3UFE A;  5HEG A;  3TLT A;  1MMD A;  3K8P C;  2XAS B;  4UM3 S;  3L39 A;  5FVL A;  1KFY A;  5LGT B;  2N2N A;  4X20 E;  2SPC A;  3PTR B;  4IIJ E;  5EK4 A;  3RPU A;  2W66 A;  4DBR A;  3GN5 A;  4O4L E;  1HF8 A;  4YSZ A;  4ZRU A;  4AKH A;  1WRD A;  3PMZ A;  5AQP B;  2D5U A;  1LVF A;  4DBM A;  1UX5 A;  4QH4 A;  1D0Y A;  3SWH A;  5HEJ A;  3GN5 B;  4GKK T;  3KV9 A;  2Y48 B;  3KIN B;  1VRB A;  1OED A;  2H7V C;  4HN9 A;  2K48 A;  4JI1 T;  1HG2 A;  3UTK A;  1MIY A;  5JDN A;  4HFC A;  1QUU A;  3AAA B;  1N36 T;  4IT4 A;  4DID B;  4EOZ B;  1OED B;  4KBM B;  2W67 A;  3SOL A;  4LMJ A;  4TN7 B;  4HWH A;  3K3N A;  1BR2 A;  3P4P A;  2FJB A;  2XQ6 A;  1D1A A;  3IBP A;  2K24 A;  2J4G A;  3SQ9 A;  1YW0 A;  3U8J A;  2L9Q A;  3B57 A;  3HL6 A;  2DWG A;  1HCI A;  5H6R B;  4IE4 A;  4OX9 T;  2CM0 A;  5HEU A;  4ALX A;  4YSY A;  3PDY A;  5AIN A;  1DU2 A;  3ZN1 B;  2LT3 A;  2L8K A;  4LF4 T;  5AQT B;  5FNV E;  1S94 A;  1UX2 A;  2V7I A;  4HFI A;  1WFD A;  3ESL A;  4NIQ A;  3TLW A;  1O3X A;  3TLU A;  4DR2 T;  4KHZ F;  5LJM A;  5C2T A;  4AIS A;  2IW5 B;  1G8X A;  3Q2M A;  5AQU B;  3ZYM A;  1OED C;  3CKD A;  2BKP A;  4B3T T;  2NTX A;  4QH1 A;  2B76 A;  2VL8 A;  3DJB A;  4LML A;  2XNV A;  2NR4 A;  1FJG T;  2V7J A;  4HKA A;  2WS3 A;  2KIN B;  2LSY A;  1M7K A;  3F2E A;  5AFU L;  4WZX A;  5LMN T;  2WU2 A;  3VU7 H;  2XQ4 A;  2CA5 A;  3VRB A;  1VCT A;  2A3D A;  2BBJ A;  5LHG B;  3LJC A;  5FJV A;  4U31 A;  2PGZ A;  2KLQ A;  3N2K E;  4LF9 T;  3KVA A;  4ZZB A;  4M1P A;  4MFR A;  3MXZ A;  3RIF A;  5FY7 A;  1V9D A;  3AVR A;  3T1H T;  4XK9 A;  4DR1 T;  2ES0 A;  4QAC A;  4JBW F;  2K9A A;  3SFE A;  2VWA A;  4HWD A;  3PUA A;  4UXN B;  3LSV A;  3ABV A;  2WWV A;  4DMW A;  1LKX A;  1HG5 A;  4DV1 T;  2AE9 A;  3LK4 2;  3AE8 A;  2XTL A;  3HR0 A;  1IBK T;  2CMR A;  3KDS E;  3IEE A;  3L09 A;  4QHO A;  1KNP A;  4DR6 T;  5LYJ E;  4BJN A;  2H89 A;  1UUR A;  2KZ7 B;  2VQE T;  3X1D A;  4AKR B;  3RYC E;  4TZ4 C;  2VKD A;  4JI4 T;  4BA9 A;  3WTM A;  5ABF A;  2ZM6 T;  4AI6 A;  3UUM A;  5JRE A;  2M6B A;  2V7L A;  3RC8 A;  4TUY E;  4X1K E;  2JQK A;  2YU1 A;  5ABG A;  3I1A A;  2NP9 A;  2X00 A;  5ABF B;  3PU8 A;  2YK0 A;  3U8N A;  3ZT5 A;  4IDP A;  2CPT A;  3GA8 A;  2LJL A;  3LK3 B;  3PUY F;  4ZK4 A;  3IF8 B;  2QGS A;  2YKS A;  4IHJ E;  3U8M A;  4ILB A;  1OWA A;  1QLB A;  4IL4 A;  1X9B A;  2PH9 A;  3ONX A;  2J1D G;  5F5W A;  2X9Y A;  4ILA A;  3CPZ A;  4QH5 A;  4JI7 T;  2X00 D;  1J5E T;  3WTL A;  5CA0 E;  2WWU A;  3OBV E;  4H9O C;  2W8G A;  3PJA A;  5AQN B;  4DUY T;  3RC3 A;  1U4Q A;  4A98 A;  3ZPO A;  2LSK A;  4CN4 A;  2IC6 A;  2N9D A;  1MND A;  3GWH A;  4AQY T;  3AE9 A;  1Y01 A;  3LK2 B;  3PE0 A;  3C64 A;  5IUX A;  5CO5 A;  3P4W A;  1Z8U A;  4QX7 B;  4TV9 E;  5AQR B;  2VL0 A;  5AQI B;  4CI2 B;  2LSG A;  3K3O A;  3PV0 F;  4H63 V;  2ODU A;  2ZMA A;  3KV4 A;  1U5P A;  4TWH A;  3IHR A;  2Y7Y A;  1W0A A;  1WLX A;  3BQK A;  2C9T A;  5JME A;  2BVM A;  2XPK A;  3IA3 A;  3P8C D;  2D9D A;  4XZC A;  3U8L A;  1L0V A;  4HGA A;  3AA0 B;  1HR0 T;  4ASK A;  4HTE A;  2X0L B;  5J5G A;  4I4T E;  3PUG A;  1OED E;  2XM1 A;  4DND A;  2HH7 A;  2Q9Q A;  2D0T A;  4YJ2 E;  5AQG B;  2BS3 A;  3UU8 A;  4GKJ T;  4CXW A;  4A56 A;  4XBF B;  2WMO A;  4LFA T;  1W09 A;  2W2U A;  1KF6 A;  2BG9 A;  2Q9Q B;  4PK6 A;  5LXT E;  4AFH A;  2CEA A;  3HKD E;  4ZI2 D;  2E2A A;  1EZ3 A;  3O1H A;  2AXD S;  4WYV A;  1UGO A;  3LBX B;  1US7 B;  5JDQ A;  1VOM A;  5CJ5 A;  3R6N A;  3EDV A;  3ONL C;  5FXZ A;  2BG9 B;  3ZN0 B;  2VB6 A;  4P0B A;  4MAL A;  5HXH A;  4UM3 P;  2WY2 A;  2X9W A;  4H9R C;  5HXS A;  2YDR A;  3UQ7 A;  3RIA A;  2CWY A;  3HI2 A;  2J62 A;  2XNU A;  2KT9 A;  1W0B A;  5M4Y A;  5L3F B;  4H9S E;  2XZ5 A;  4PW8 A;  3JC6 D;  2JQ9 A;  2Y57 A;  4U2Y A;  5KE4 A;  3AXJ A;  2YMD A;  4EZH A;  4QKN A;  1I6Z A;  4PJL A;  4U7Y A;  2ZLY A;  1IAP A;  5L4H A;  4I43 B;  4ZI2 C;  5JDM A;  5HXC A;  3B13 A;  1HS7 A;  3KFW X;  2LSI A;  3FZK B;  4ILU A;  3M3Z B;  3RH3 A;  4AFT A;  5BRX A;  1FIO A;  3AE2 A;  3ZC1 A;  3AE3 A;  4C90 A;  3LFM A;  2Q9Q C;  2J47 A;  4KMC A;  2BJ0 A;  4JI6 T;  3NRX A;  5LP6 E;  2WZY A;  2BYS A;  4UIG A;  3AED A;  2LHR A;  5L4E A;  4BAY B;  2BG9 C;  2WN9 A;  2XAH B;  4PK4 A;  2X66 A;  3ZMS B;  2PTF A;  3AE7 A;  3HKE E;  3GMI A;  5L3C B;  3C51 A;  2WSS V;  2LKH A;  4ERR A;  4TNV A;  4LF6 T;  5ADX L;  4AKI A;  2XQA A;  5AFK A;  2HPL A;  5AQJ B;  2QC1 B;  2YEV C;  3FZF B;  5BW2 A;  4F6R C;  1XDP A;  4TNW A;  2BVL A;  2Y58 A;  3TKL B;  3WTI A;  4YHH T;  4ADZ A;  2QVA A;  5E0O A;  1T98 A;  2A72 A;  2XZE A;  5HAX A;  4P09 A;  3ETV A;  4EV6 A;  5F8P A;  4P0A A;  4CXY A;  3V5S A;  2OV9 A;  3OVU A;  3FXD B;  1NEK A;  3D0T A;  3CML A;  2D0U A;  2NW7 A;  1HX8 A;  4CI3 B;  2JRK A;  5KXJ A;  4ZJT A;  2VK9 A;  4NXM T;  2UXD T;  3P4S A;  3RYH E;  3N5L A;  3WTK A;  4IDZ A;  2DLR A;  2LM9 A;  3EUH A;  1J1J A;  4YSX A;  3ZDG A;  2VVN A;  4G63 A;  2ZJU A;  4DVD A;  4EZ1 A;  4AQF A;  4UXU A;  4PK5 A;  5LG4 A;  1X79 A;  1IJ6 A;  2XY8 B;  2WM9 A;  1NEN A;  2X9H A;  4EED A;  1N33 T;  5J5F A;  5BMV E;  3A8Y C;  1FEW A;  2BYP A;  2ZM8 A;  5AFM A;  2CXF A;  5CFB A;  3SQ6 A;  5L3E B;  4YHJ A;  1NWM X;  4LMK A;  3U3I A;  3CQX C;  2JPF A;  1UW6 A;  1XMO T;  1CUN A;  5AFM B;  3PUX F;  3RRC A;  4DV2 T;  1E7P A;  4AIU A;  1I9B A;  1XMQ T;  3NWI A;  2E8I A;  3UU3 A;  2E9X D;  2C0S A;  2V1D B;  4LF7 T;  1YQ4 A;  3C98 B;  3TLS A;  3ZCJ A;  4OFZ A;  3ZMU B;  2UUB T;  2FUP A;  3PU3 A;  2G0U A;  5J0Z A;  1QSD A;  5BR8 T;  3AE6 A;  4PAG A;  3V5U A;  3UUL A;  2I6H A;  3ZYL A;  2QRX A;  5FYM A;  2ZM0 A;  4JI5 T;  3ZT6 A;  3U78 A;  3AAI A;  4UEM A;  3ZEF B;  4IL9 A;  3CVR A;  3ANW A;  1S35 A;  1GQE A;  3RGL A;  4AQF C;  2RPA A;  2WAU A;  2MAW A;  2WBL A;  2FJD A;  4H9Q C;  2X68 A;  1ZP0 A;  2Y6X A;  3ANW B;  1WYB A;  1YKE B;  2W4X A;  5TVC A;  2LRK A;  1XDO A;  2WNJ A;  2DNX A;  2DI4 A;  1D1C A;  4JEH B;  1Z0P A;  3AAE B;  3CX6 B;  5LHI B;  1KNR A;  4JV5 T;  4EYU A;  4OK0 A;  2V6Y A;  4FJO A;  4GYR A;  3O1J A;  4CZZ B;  2KMF A;  3I0Q A;  1MMG A;  1MMN A;  1G73 A;  2V8S V;  2NWB A;  3P4Q A;  3WTH A;  2V6Y B;  3N9O A;  2R6G F;  3K3Q C;  2RP4 A;  2I59 A;  3N9N A;  5LHH B;  5L2L A;  4IDO A;  2XQ7 A;  2VUR A;  3P4R A;  5ABH A;  3AEA A;  3ZDH A;  2BKO A;  2WB5 A;  4IDQ A;  3AVS A;  4WW0 A;  4HWC A;  5JRC A;  3SIO A;  2ACZ A;  3ZST A;  1OXZ A;  5FP3 A;  2XQ3 A;  3JAE A;  4H9N C;  4X66 T;  3K1S A;  1D0Z A;  1YXR A;  4K0U A;  4ISS A;  1B7T A;  4QX8 B; 
#chains in the Genus database with same CATH homology
 5AFH A;  3EAM A;  3WTN A;  5J5G A;  5HCM A;  5LXB A;  4ZK4 A;  4F8H A;  3WTK A;  1OED E;  5FJV A;  2KSR A;  4WV9 A;  2XQ6 A;  2YKS A;  3EHZ A;  2BJ0 A;  2W8F A;  2PGZ A;  3U8M A;  4ILB A;  4IL9 A;  4ZZB A;  4UM3 A;  4IL4 A;  5SYO A;  2XQ5 A;  2PH9 A;  3SQ9 A;  2WZY A;  3RIF A;  2BYS A;  5AFL A;  2M6I A;  3UU8 A;  3ZKR A;  3U8J A;  3ZDG A;  4IRE A;  2ZJU A;  4HQP A;  4XK9 A;  2XYT A;  5L4E A;  3WTJ A;  4QAC A;  4ILA A;  4QH5 A;  2XZ6 A;  2BG9 C;  5HEG A;  3TLT A;  2WN9 A;  2X00 D;  4NPP A;  3JAF A;  2MAW A;  3WTL A;  4UXU A;  4EZ1 A;  4D01 A;  4ZJS A;  3SH1 A;  2W8G A;  5HEO A;  4PIR A;  2BG9 A;  4QAB A;  4UM3 S;  5HEU A;  4ALX A;  2WNC A;  3LSV A;  3UU6 A;  4AFH A;  3RHW A;  4A98 A;  4COF A;  3WIP A;  3C84 A;  5AIN A;  5TVC A;  2XQ9 A;  3C79 A;  2WNJ A;  2LKH A;  2XNT A;  5J5F A;  2Y56 A;  5HEH A;  4TNV A;  5IUX A;  5L47 A;  3P4W A;  5CO5 A;  2LKG A;  4ILC A;  2BYP A;  2BG9 B;  2XQA A;  4BQT A;  1UV6 A;  1UX2 A;  2VL0 A;  3EI0 A;  5HCJ A;  5AFM A;  5AFK A;  4HFI A;  3GUA A;  4HFB A;  5CFB A;  4ZRU A;  5BP0 A;  3UU4 A;  3RQU A;  2QC1 B;  4UM3 P;  2BYQ A;  3SQ6 A;  4AFG A;  3TLW A;  2YN6 A;  3PMZ A;  4FRR A;  4QAA A;  5BW2 A;  3P50 A;  5AFN A;  3TLU A;  4LMK A;  4HFH A;  4Z90 A;  4NZB A;  4TNW A;  2Y58 A;  4DBM A;  3WTI A;  3UQ7 A;  3RI5 A;  3RIA A;  1UW6 A;  3UUB A;  4ZR6 A;  5AFJ A;  4QH4 A;  4HFD A;  4A97 A;  2ZJV A;  3WTM A;  3WTH A;  5HEJ A;  5AFM B;  3U8K A;  2XQ8 A;  2XNU A;  1OED C;  5J5I A;  3TLV A;  4TWH A;  4TWD A;  3PEO A;  2M6B A;  1I9B A;  4X5T A;  2XZ5 A;  4HFE A;  2XQ7 A;  2Y57 A;  2Y7Y A;  4UM1 A;  1OED A;  5KE4 A;  2YMD A;  2C9T A;  4XHE A;  5JME A;  5KZU A;  2BYR A;  4QH1 A;  3UU3 A;  2BR7 A;  3ZDH A;  4LML A;  4BFQ A;  2XNV A;  3JAD A;  4ZZC A;  2BYN A;  4TWF A;  3SIO A;  2LM2 A;  2YOE A;  4HFC A;  3TLS A;  5LG3 A;  2X00 A;  3U8L A;  5L4H A;  5J5H A;  2BG9 E;  3RQW A;  3WTO A;  4B5D A;  2LLY A;  5J0Z A;  2WNL A;  4UY2 A;  3U8N A;  2XQ3 A;  3JAE A;  2BR8 A;  4Z91 A;  2UZ6 A;  3UQ4 A;  4ZJT A;  2Y54 A;  4ZK1 A;  1OED B;  3T4M A;  3IGQ A;  2XYS A;  4AFT A;  2XQ4 A;  4LMJ A;  3UU5 A;  2YME A;  5BRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...