3TLUA

The glic pentameric ligand-gated ion channel loop2-24' oxidized mutant in a locally-closed conformation (lc1 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPCTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tluA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tluA01
2MAWA 1I9BA 4QH4A 5HEJA 2BJ0A 5AFNA 4COFA 5AFMA 4ILBA 2BYNA 3JADA 4UM1A 2Y7YA 3RIAA 3EAMA 3WTJA 4TWFA 4DBMA 4QH1A 2UZ6A 2VL0A 2LKGA 4ILCA 4ZR6A 4UM3A 4B5DA 5HCJA 4UXUA 3WTIA 5IUXA 5AFJA 5HEHA 4QAAA 2ZJUA 3P50A 2Y57A 4BFQA 3UU5A 4A97A 5L4HA 2XYTA 5AINA 4PIRA 5BP0A 3WTHA 1OEDE 5J5HA 3U8NA 3RIFA 3UU4A 3GUAA 2PH9A 5JMEA 4UM3P 2BYRA 2PGZA 2X00D 3SQ9A 4AFGA 5HCMA 2YMEA 2XQ6A 4FRRA 4AFTA 3TLTA 3SQ6A 2YKSA 2WNCA 4ZRUA 2QC1B 2XZ5A 3IGQA 5L4EA 3RQUA 2X00A 3RI5A 1UV6A 4IREA 1UX2A 1OEDB 2XZ6A 4EZ1A 4HFIA 3SIOA 2Y56A 3UQ4A 5LXBA 3PEOA 2BYSA 5AFKA 4QH5A 3TLSA 2M6IA 3WTLA 5L47A 2C9TA 2XNTA 4IL4A 5J0ZA 2WZYA 2ZJVA 5BW2A 2BR7A 4ZK4A 3JAFA 2XNUA 3JAEA 2LKHA 3ZDGA 4TWHA 2M6BA 3UU6A 2Y54A 4D01A 3U8LA 2XQ9A 4XK9A 2XNVA 2BYPA 5LG3A 3RHWA 4LMJA 2BYQA 2BG9A 2LM2A 4WV9A 5J5GA 4UY2A 2XQAA 3C79A 3WTNA 4IL9A 5HEOA 4ZK1A 3WTOA 3U8KA 3U8JA 3EI0A 1OEDA 4A98A 4ZZBA 3WTKA 3RQWA 3TLVA 4Z90A 2BG9B 2Y58A 4QABA 2W8FA 4QACA 5BRXA 2YOEA 3UUBA 4HFDA 2LLYA 2WNJA 4HFEA 1OEDC 3C84A 5KZUA 3UU3A 2XQ7A 5SYOA 2WN9A 4TNWA 2XYSA 4AFHA 4LMKA 3PMZA 5TVCA 5HEUA 1UW6A 2YN6A 5J5FA 3ZDHA 4ZZCA 4UM3S 2XQ4A 5FJVA 2BG9C 2WNLA 4ILAA 3T4MA 4Z91A 3SH1A 3WIPA 5J5IA 4HFBA 2BR8A 3UU8A 4NPPA 4HFHA 4TWDA 3ZKRA 4ALXA 3UQ7A 4ZJTA 4TNVA 2W8GA 3TLUA 3U8MA 3EHZA 2XQ5A 5HEGA 2YMDA 4NZBA 3TLWA 5AFLA 5AFHA 4HFCA 4HQPA 2BG9E 2XQ8A 5AFMB 2KSRA 4XHEA 2XQ3A 4LMLA 4ZJSA 3P4WA 3LSVA 5CO5A 3WTMA 5CFBA 4F8HA 5KE4A 4X5TA 4BQTA
chains in the Genus database with same CATH superfamily
4LFCT 2MAWA 5JDFA 4ZI2D 2VVNA 4YLHA 3AEAA 5L3CB 3KBUA 4QH1A 2D5UA 3PJAA 3AEBA 5IUXA 2CBIA 5ABFB 2B1EA 5HXRA 4CN4A 1VOMA 3ABVA 2XAQB 3T1YT 3MXZA 3IGQA 1IZNB 3P7IA 1CUNA 4V1Av 2Y56A 4P09A 3UQ4A 5LXBA 1WR0A 2X9WA 2QA7A 4IDZA 5FXVA 4DV3T 3A5XA 5LGNB 4KUMB 4DMWA 1HNZT 1T8BA 2XQ9A 3U8LA 2ZM0A 4KBMB 2JMKA 3CQXC 4X65T 3S4UA 3OTOT 2A2FX 1HS7A 4DR5T 2WU5A 3UFGA 2VASA 1SHZC 2NTXA 2UUBT 2HHHT 2E5VA 5JRCA 2D2SA 2V6YA 4LMKA 5HEUA 3FZKB 3UT5E 2E9XA 2WP9A 3ZKRA 4TNVA 4H9SE 4H9QC 3P4PA 4MHCA 3LSVA 3J9X1 3ONLC 4X5TA 2X0HA 1KEYA 5JDGA 4DR6T 2BS3A 3ZJ1A 5IYZE 1IBMT 4X64T 2Y7YA 4ILCA 5AQMB 5FXXA 5FMNA 5HCJA 1WR6A 1ZHCA 2ZJUA 4N78D 3UULA 3UU5A 1QSDA 4YTMA 3ZT6A 2GK9A 5BMVE 3BQLA 3C4XA 2H88A 2ZLYA 4QWNB 2C5JA 5DABA 4EEDA 4EV6A 3RKGA 5JR9B 3BQKA 2DCFA 3IHRA 2BYSA 4QH5A 3TLSA 3L8RA 4J2CA 3HL6A 2WZYA 1JNRA 3PUGA 2M6BA 3AE4A 5LHIB 1HNWT 3ZC1A 2LSIA 4HWIB 3D0TA 1WFDA 4MALA 1U4QA 5AQVB 2XZEA 3E08A 2I0MA 2ZMAA 2XAFB 3MK7C 1N33T 2LT3A 1WYCA 2QGSA 3FZMB 3P4SA 5DJQC 1IBKT 1LVFA 2V7LA 4ILAA 4TV9E 2K5BB 1XNRT 5J5IA 3TLUA 1O3XA 4KMCA 2OV9A 3U8MA 3TLWA 3RIUC 2LSYA 4AISA 2X0LB 4GIWA 2F4VT 3U78A 2AE9A 3L39A 3ZSTA 4LF8T 3PV0F 3O9XA 1BR2A 1D1CA 3WTJA 4DBMA 4ZR6A 3Q5DA 4EGWA 4UXUA 5AQJB 3FHNA 2VVSA 3VKGA 3IBPA 3NRYA 3P50A 3CPZA 4A5XA 1IBLT 2H7OA 3AAEB 4QXHB 2X9HA 4YJ2E 4YY3T 3ONJA 2LHNA 2V7KA 3EUHA 4IDPA 3PUVF 2HH7A 3CX8B 1D1AA 4UR9A 3RRCA 3PJAJ 4EZHA 3SFEA 4L5GA 1ZV4X 5J1GA 1MNEA 3OPCA 4CN1A 2V8SV 2CXFA 2DWGA 3PU8A 1D0XA 2ZM6T 2LM9A 2WZIA 3EDVA 2UXDT 3PUYF 1N36T 4AQGA 2BYQA 5AQPB 2LJLA 3AE5A 5HAXA 3R6NA 3WTOA 2K48A 2HPJA 3X1DA 3EVYA 4U31A 4HWCA 3AE2A 3KDSE 4Q25A 4E7ZA 4GYRA 5JDQA 1G8XA 4B6XA 2DNXA 2XQ4A 3ANWB 1YKEB 3ZT5A 3N2GE 4ZJTA 3OVUA 4FI5A 4TX5A 4YJ3E 4TZ4C 2FJAA 5LNKA 3SRZA 3AA1B 4HQPA 5FYMA 3V5SA 4F8HA 4IDOA 2LE8A 4QH4A 3DTOA 3C98B 2NOXA 3RIUA 2VWAA 4LF4T 2PFVA 2N2NA 2CE7A 4OX9T 2DHRA 4DBRA 5HEHA 4YHJA 4A97A 4PIRA 4DIDB 2PGZA 4AFGA 5CJ5A 5ETWA 4IGUA 2QC1B 3KVAA 3RGLA 1WRDA 3NVOA 1L0VA 2X00A 2VKOA 3CX7B 3UUNA 4XAXB 1VRBA 2CA5A 5LYJE 2J62A 2JQHA 3RC3A 3QUJA 2LHRA 5HXEA 3WTLA 5L47A 3VRAA 4ZI7E 1M7KA 4CI3B 2A72A 2LKHA 3QB5K 4JI8T 1MIVA 4D01A 2DI4A 4Z8XA 2XAHB 4I4TE 4UF0A 3LK2B 4UIGA 2J47A 3JCFA 4HFDA 4NUUA 2WNJA 2V5CA 1OEDC 1D0YA 2IC9A 4ZZCA 2JQKA 3I9YA 1R8IA 4U2YA 4JI3T 4YSXA 2BVLA 4MLKA 2UUCT 3I0OA 3ZPOA 4KI0F 5AFMA 4AQFA 4DR7T 3SFDA 4QXBB 2W0GA 2W66A 5HWXA 5HXHA 1LKXA 3LDQB 2H89A 2YU2A 2WY2A 5C8YE 5EK3A 4NUVA 2CRBA 3UTKA 1OEDE 4DV2T 3RPUA 2Z6EA 4H9PC 2W67A 4I55E 1XDPA 1FEWA 4O4JE 3A8YC 4JV5T 1UCUA 4O8SA 4ZS3A 2UXXB 4AKGA 4C90A 5BR8T 2Y6XA 4YT0A 3AE8A 2R6GF 2CXLA 3O1HA 5C2TA 3T8OA 4DVDA 3AEGA 3JC6C 2XUEA 4TUYE 2WM9A 4UY2A 4IL9A 2NP9A 2WMNA 3KV5A 1N34T 2WSSV 4ZEYA 3AE6A 5KZUA 2B76A 5TVCA 4HWFA 1HR0T 2LSKA 2L9QA 4NPPA 1E2AA 5KDMC 1QLBA 4OYJA 4ANJA 1XMOT 2KSRA 2JRKA 4LMLA 4ISTA 4O2BE 4HFVA 2BJ0A 3Q5WA 3JADA 1MMDA 2QRXA 3K3QC 3PUZF 2WMOA 4LFAT 3AAIA 4H63V 2Y57A 2XM1A 4YSYA 2W63A 3U8NA 4JI1T 4OYKA 1UURA 5AQHB 4ZHQE 3SQ9A 2X00D 2JPFA 2IUBA 4ZI3C 2IHR1 2K24A 3CKDA 3ZMVB 4G63A 5AQFB 4HKAA 2PJQA 3AVSA 2Y48B 2XNUA 5LG3A 4UXNB 4U33A 2V6XA 2XQAA 2KT9A 3F2EA 3EI0A 5AQLB 2BG9B 5BRXA 2J4GA 5L3DB 2LLYA 4WBNE 3FB2A 1UX5A 4MFRA 3MKDA 4JBWF 2E9XC 5ABFA 2XTLA 4EYUA 5AQNB 1QUUA 4P0BA 2IW5B 1SA0E 3RYFE 1IJ5A 2BG9C 4ERRA 2X0YA 4PK4A 2QYWA 5LA6E 2UXBT 1KFYA 3Q9DA 3IEEA 5HEGA 4HE8A 5E0OA 3ZYLA 2WWUA 5KXJA 4X1KE 2CEAA 5CFBA 2XASB 4COFA 3HKCE 5LBQB 4QX7B 2BYNA 2X51A 5HWYA 1D0ZA 2BBJA 4UM3A 4B5DA 1YXRA 3NBXX 2UU9T 5AFJA 5AINA 3C4ZA 3G06A 2I59A 1H7CA 4CXXA 3SWHA 3N9LA 2WS3A 2BYRA 4ASKA 1CHUA 1FMWA 2XHEB 3SQ6A 3DJBA 3L09A 2X9YA 4KHZF 2DL1A 4IREA 4EZ1A 3Q5EA 4IHJE 4JI4T 4ILUA 3BK9A 4ZI2C 4YFSA 4EYYR 4KX6A 5J2UE 3HKBE 2M6IA 4U72A 5M4YA 1HX1B 4U7YA 2BKNA 4ZK4A 2XSAA 4PK6A 2JQQA 2MOZA 2CM0A 4OFZA 5DQWA 3RHWA 3WAJA 2BG9A 1AJ3A 1ZOYA 3UUMA 2H3RA 3U3IA 2YOEA 3ESLA 2V1DB 5FXZA 2SPCA 3CQCB 2D0TA 4P0AA 2CLYB 2KXPB 3AEDA 4Z91A 3UU8A 4TWDA 3MA9A 3UQ7A 4LFBT 2IIUA 2MBGA 3Q2MA 1UX4A 2C0SA 2FJDA 4NZBA 5AFLA 5AFHA 2E8IA 2EHOC 4ZS2A 3OKQA 4JI6T 5FL1A 4P1NA 2D0UA 4DUZT 2WCAA 3KBTA 4IE6A 3R84B 3N2OA 4GOUA 4DO0A 3ANWA 5CGMA 1Y64B 4HWHA 4JUYA 1W9RA 2G0UA 4TN7B 4MBQA 1NAFA 4PFOA 4QX8B 2C5IT 4AIUA 5JMEA 3UUXB 3WI3A 1MMNA 3ZCJA 1W0AA 4UF0B 3KV6A 1MMGA 3PE0A 4ZRUA 4K0UA 5DQVA 5L4EA 4IDQA 4CI2B 5H6QB 3RI5A 5KMGP 4O4LE 2YDRA 4HFIA 3PEOA 4X66T 2CPTA 5AFKA 2XNTA 5F5WA 4U7IA 1S35A 3P8CD 1XZYA 2P9BA 3FBLA 3LK42 3FZFB 2WDVA 2KINB 3AXJB 4JLEA 3WTKA 4QABA 5LJMA 4QACA 1HTJF 3UUBA 4IDNA 3PUAA 2XQ7A 5SYOA 3DP7A 2PBIA 4TNWA 4DV5T 2IAKA 2VB6A 4OK0A 3OBVE 4ALXA 4CZZB 5KX5E 1X9BA 1M62A 5LBMA 3ZYKA 2CHNA 3K1SA 2NR4A 2ZM8A 4ILBA 2ZM2A 2V7MA 1LVKA 4TWFA 3NZPA 1YW0A 3M65A 4IIJE 3ZN1B 2UXNB 4F6RC 4JEHB 2VKHA 4KP3C 3N9QA 3ZMZB 3C51A 5HCMA 2XAJB 1I6ZA 5AQIB 3ZSSA 4JI5T 3NZQA 3K8PC 2XZ6A 2ACZA 2HN2A 4L0RA 4U74A 3CQGB 5C3JA 4H9OC 2CXDA 2FJBA 3LBXA 2BR7A 4OHFA 5L3BB 4BJMA 3VKHA 2ES0A 3AAAB 2LM2A 1UK5A 2YEVC 3WTNA 4I50E 3FBZA 5ADXL 2W2UA 3GA8A 2OA5A 4NXNT 3UU3A 3QNUA 2WN9A 4AKLA 4ZXLA 1LRZA 1US7B 3RX6A 2C5KT 5JR9A 2X68A 2EHOB 1J5ET 2BG9E 2HPLA 2WWVA 5AFMB 5JREA 4IE5A 2LOSA 3O1IA 4PFPA 4DMVA 3N9MA 4DNDA 3EAMA 2UZ6A 2FBWA 2WU2A 2LEHA 2WQYA 4DUYT 4O2AE 4QKNA 3N2KE 3M3ZB 1NWMX 5FKYA 5JVDE 4BFQA 4U3CA 1Z8UA 4HTEA 5CA0E 4UM3P 3RF1A 3A7MA 5JDNA 2BKOA 2WNCA 1W09A 3W15B 1FJGT 2I6HA 5EZYE 4YTPA 2Q9QB 5L3EB 2NW9A 2LRLA 5CA1E 4TV8E 2VKDA 3JAFA 3ZDGA 4DV0T 2VQFT 4DR4T 2Y54A 4XK9A 2BDEA 3AECA 1Z0PA 4WV9A 1KF6A 4ZK1A 5JRCB 3O1JA 1T72A 4HEAA 4UVAB 5JR9C 3C4WA 4EOZB 3B57A 3H3MA 3AVRA 2XYSA 5FNVE 3ZLIA 1UW6A 5J5FA 2CWOA 4PAGA 4UVBB 2RPAA 4HFHA 2LSGA 4B3TT 1UUSA 4IE4A 2KWHA 2YMDA 4AXPA 3GN5B 2KWIB 1J5WA 1BR0A 3CX6B 5CO5A 2PH9A 5AQQB 4BQTA 2FUPA 5L2LA 2Y8DA 1X79A 2XPKA 2VL0A 2XSBA 5F3JA 5LJNA 3PUSA 5AQTB 3WTHA 1DU2A 4AKHA 3GUAA 3K3OA 4DV4T 5EK4A 1KNRA 3B13A 5LHHB 2X67A 5LB7B 1SE7A 3N9OA 3TKLB 3JC6D 3BQIA 2YDQA 3UFEA 4KHPT 2M67A 3KVBA 1XDOA 3LJCA 4GK5E 1WLXA 3PU3A 5JDHA 2ZJVA 5ABEA 4DBQA 4TWHA 2NW8A 1E1HB 3UU6A 3RYIE 2XNVA 4AKIA 1VCSA 2RA1A 4O4HE 3VHLA 2BS2A 3C79A 5HEOA 2LOPA 3V5UA 2K3WA 5AQRB 4CXWA 3TLVA 4Z90A 3QK6A 2W4XA 3I1AA 3PURA 3ZCIA 3RYHE 5ABGA 4AFHA 3PMZA 3ZC0A 3EABA 2VURA 5EK2A 3T4MA 3WIPA 4HFBA 2BR8A 4LF5T 4ZI3D 3FXDB 2LSJA 2NWBA 4JI2T 3N5LA 4PK5A 5A1LA 2UUAT 2WAUA 4EB6E 1SUMB 2X66A 2XQ3A 4PJJA 4ZJSA 2BBHA 2E2AA 4B3MT 4G2AA 5AFNA 1VCTA 4BJNA 3RIAA 4B3ST 2CLYC 2KNDA 3LG7A 3FZHB 5BP0A 3AE9A 4X1YE 4BA9A 1I94T 3IA3A 3KV4A 3LFMA 4QXCB 1YQ4A 1UX2A 2MTQA 4DV6T 3HKEE 3RC8A 2YINA 3H37A 3SIOA 4WNKA 3QOFA 3F31A 3KINB 4PNIA 1XMQT 4IL4A 2XJ7A 3SOLA 3PUQA 3KFWX 1N32T 5HYAA 4EAHA 1YKHB 2WZHA 3C64A 2V26A 2EHOA 1GQEA 3SS1A 3HI2A 4PJNA 2MPKA 2BZBA 1T98A 3C50A 2IMLA 5FL0A 3C84A 2VL8A 1B7TA 5AQGB 3AA7B 1IJ6A 3MJXA 1W0BA 3OYZA 1YQ3A 2IC6A 4LF9T 4NIQA 2XQ5A 5AQKB 2XQ8A 4YHHT 2ODVA 4M1PA 5LMNT 3NWIA 4IT4A 1MIWA 3VRBA 1ZKEA 4ISSA 3AEEA 1BR1A 4UV8B 4FJOA 4UM1A 2AXDS 2YDSA 2X9XA 1NEKA 4UV9B 4I43B 2W00A 3CVRA 3AXJA 4X1IE 4QAAA 3AB3B 5FY7A 3CIRA 4X62T 2W62A 3AE1A 3VU7H 4B3RT 2PTFA 1OXZA 4HGAA 4PJMA 4WZXA 5CB4E 2RP4A 2CCQA 4EZ4A 3ZT7A 2XZ5A 1UV6A 1OEDB 4UVCB 3ETUA 3ETVA 3PDYA 4DV7T 2L8KA 2JIWA 2WBLA 4DR1T 3MZKB 2C9TA 5J0ZA 1D1BA 5FP3A 4E7SA 5J5GA 2DLRA 1HF8A 4PJLA 1OEDA 2VK9A 5JH7E 4AI6A 2KLQA 4AQYT 3RH3A 3FXEB 3CMLA 5JDLA 1HG2A 2YN6A 3NRXA 1NENA 2WNLA 4WYVA 2W8GA 4JYAT 4JEUB 2CHOA 2JMHA 1IAPA 2XQYA 2VQET 2XY8B 1G73A 3N9NA 3N9PA 4XHEA 3WAKA 2ODUA 3CWZB 3IF8B 3RRWA 3F57A 2XAGB 4WW0A 3Q5XA 1I9BA 4GKJT 2V5DA 1HNXT 5LP6E 1V9DA 2E9XB 5FY1A 1J1JA 3ZMTB 3CK6A 4YSZA 5HXSA 3HR0A 5L4HA 3ZEFB 3RIFA 4JI7T 2YMEA 4YXDA 1WCRA 3HKDE 3GMIA 2BS4A 2WDRA 4DV1T 4GK0E 3ZYMA 4GKKT 4AKRB 3OJAA 2NTYA 5BW2A 4EXTA 2BVMA 2YK0A 3AE3A 2WDQA 2DWKA 3PTRB 3U8JA 3AA0B 2KZ7B 2V6YB 3NKZA 4ZZBA 2Y58A 2W61A 5H6RB 1Y01A 2Q9QA 2XM2A 5AFUL 3EDUA 2KMFA 2LRKA 4ADZA 5L3FB 4CQIA 4O4IE 4UM3S 3MACA 2Q9QD 4DR2T 2BKPA 3EHZA 1HG5A 5JTGA 1HFAA 4HFCA 2ACXA 4WBOA 2N1GA 3P4WA 4H9NC 5F8PA 5KE4A 3GN5A 3GWHA 4U2ZA 5HEJA 5LHGB 1FMVA 5JDMA 2E5LT 2D9DA 5FY0A 2A3DA 5HXCA 1EZ3A 5IWAT 4IE7A 5FVKA 3O4XE 3WTIA 1HCIA 3VR8A 1XNQT 2JJ9A 4LF6T 2MYSA 3ZN0B 4XBFB 5J5HA 3B5MA 5LOVE 1OWAA 4FRRA 3TLTA 3T1HT 3ONXA 2YKSA 4EEBA 3RQUA 5ABHA 5J2TE 2CBJA 4YTNA 1HX8A 3P4QA 1ZEEA 2VKJA 4H63H 2HN1A 4AQFC 5LGUB 5GONE 1MNDA 1JNZA 4BAYB 1ZP0A 3K3NA 3HA4A 2Q9QC 4A98A 2CMRA 4HFEA 5LGTB 4CXYA 4XZCA 4X20E 2EHOD 4HWDA 3AEFA 3PUWF 3ZDHA 3LK3B 3SH1A 5LXTE 5LG4A 1T7SA 4UEMA 3FZLB 1XWMA 3RLFF 4HN9A 4I0UA 3LBXB 5FVLA 3VR9A 1FIOA 2N9DA 1S94A 3AA6B 5L3GB 1U5PA 3E22E 4L9IA 4C91A 2J1DG 2L3LA 5AQOB 2V7IA 2K9AA 2LKGA 2H7VC 3H3AA 5JQGE 1E7PA 3L3PA 2OLTA 2XYTA 3UU4A 2YU1A 3PUXF 2IDOB 3E0ZA 4CI1B 2XQ6A 3P4RA 4K0KT 4AFTA 4GYSA 4EIWA 1MIYA 1KK7A 2JQ9A 4ZOLE 1KNZA 3QB5A 4PW8A 4QHOA 2PG8A 4DR3T 2QVAA 3QC9A 3JAEA 5TAOA 3KV9A 5AQUB 2BYPA 4LMJA 4LF7T 1KNPA 1WYBA 3AE7A 3U8KA 1BR4A 2NW7A 2CWYA 5AQSB 3RQWA 4A56A 4H9RC 2FJEA 2W8FA 4IE0A 4JI0T 3J7Yq 4CN6A 1YD8G 3ZMSB 5FJVA 4UELA 2WB5A 1UGOA 3ZJ2A 3RKOA 1MMAA 2V7JA 5IHYA 4NXMT 5LMUT 2UXCT 3OYXA 5LCYA 2A9UA 3RYCE 2E9XD 3I9WA 5FXWA 3I0QA 3WTMA 3ZMUB
chains in the Genus database with same CATH topology
2MAWA 1I9BA 4QH4A 5HEJA 2BJ0A 5AFNA 4COFA 5AFMA 4ILBA 2BYNA 3JADA 4UM1A 2Y7YA 3RIAA 3EAMA 3WTJA 4TWFA 4DBMA 4QH1A 2UZ6A 2VL0A 2LKGA 4ILCA 4ZR6A 4UM3A 4B5DA 5HCJA 4UXUA 3WTIA 5IUXA 5AFJA 5HEHA 4QAAA 2ZJUA 3P50A 2Y57A 4BFQA 3UU5A 4A97A 5L4HA 2XYTA 5AINA 4PIRA 5BP0A 3WTHA 1OEDE 5J5HA 3U8NA 3RIFA 3UU4A 3GUAA 2PH9A 5JMEA 4UM3P 2BYRA 2PGZA 2X00D 3SQ9A 4AFGA 5HCMA 2YMEA 2XQ6A 4FRRA 4AFTA 3TLTA 3SQ6A 2YKSA 2WNCA 4ZRUA 2QC1B 2XZ5A 3IGQA 5L4EA 3RQUA 2X00A 3RI5A 1UV6A 4IREA 1UX2A 1OEDB 2XZ6A 4EZ1A 4HFIA 3SIOA 2Y56A 3UQ4A 5LXBA 3PEOA 2BYSA 5AFKA 4QH5A 3TLSA 2M6IA 3WTLA 5L47A 2C9TA 2XNTA 4IL4A 5J0ZA 2WZYA 2ZJVA 5BW2A 2BR7A 4ZK4A 3JAFA 2XNUA 3JAEA 2LKHA 3ZDGA 4TWHA 2M6BA 3UU6A 2Y54A 4D01A 3U8LA 2XQ9A 4XK9A 2XNVA 2BYPA 5LG3A 3RHWA 4LMJA 2BYQA 2BG9A 2LM2A 4WV9A 5J5GA 4UY2A 2XQAA 3C79A 3WTNA 4IL9A 5HEOA 4ZK1A 3WTOA 3U8KA 3U8JA 3EI0A 1OEDA 4A98A 4ZZBA 3WTKA 3RQWA 3TLVA 4Z90A 2BG9B 2Y58A 4QABA 2W8FA 4QACA 5BRXA 2YOEA 3UUBA 4HFDA 2LLYA 2WNJA 4HFEA 1OEDC 3C84A 5KZUA 3UU3A 2XQ7A 5SYOA 2WN9A 4TNWA 2XYSA 4AFHA 4LMKA 3PMZA 5TVCA 5HEUA 1UW6A 2YN6A 5J5FA 3ZDHA 4ZZCA 4UM3S 2XQ4A 5FJVA 2BG9C 2WNLA 4ILAA 3T4MA 4Z91A 3SH1A 3WIPA 5J5IA 4HFBA 2BR8A 3UU8A 4NPPA 4HFHA 4TWDA 3ZKRA 4ALXA 3UQ7A 4ZJTA 4TNVA 2W8GA 3TLUA 3U8MA 3EHZA 2XQ5A 5HEGA 2YMDA 4NZBA 3TLWA 5AFLA 5AFHA 4HFCA 4HQPA 2BG9E 2XQ8A 5AFMB 2KSRA 4XHEA 2XQ3A 4LMLA 4ZJSA 3P4WA 3LSVA 5CO5A 3WTMA 5CFBA 4F8HA 5KE4A 4X5TA 4BQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MAW A;  1I9B A;  4QH4 A;  5HEJ A;  2BJ0 A;  5AFN A;  4COF A;  5AFM A;  4ILB A;  2BYN A;  3JAD A;  4UM1 A;  2Y7Y A;  3RIA A;  3EAM A;  3WTJ A;  4TWF A;  4DBM A;  4QH1 A;  2UZ6 A;  2VL0 A;  2LKG A;  4ILC A;  4ZR6 A;  4UM3 A;  4B5D A;  5HCJ A;  4UXU A;  3WTI A;  5IUX A;  5AFJ A;  5HEH A;  4QAA A;  2ZJU A;  3P50 A;  2Y57 A;  4BFQ A;  3UU5 A;  4A97 A;  5L4H A;  2XYT A;  5AIN A;  4PIR A;  5BP0 A;  3WTH A;  1OED E;  5J5H A;  3U8N A;  3RIF A;  3UU4 A;  3GUA A;  2PH9 A;  5JME A;  4UM3 P;  2BYR A;  2PGZ A;  2X00 D;  3SQ9 A;  4AFG A;  5HCM A;  2YME A;  2XQ6 A;  4FRR A;  4AFT A;  3TLT A;  3SQ6 A;  2YKS A;  2WNC A;  4ZRU A;  2QC1 B;  2XZ5 A;  3IGQ A;  5L4E A;  3RQU A;  2X00 A;  3RI5 A;  1UV6 A;  4IRE A;  1UX2 A;  1OED B;  2XZ6 A;  4EZ1 A;  4HFI A;  3SIO A;  2Y56 A;  3UQ4 A;  5LXB A;  3PEO A;  2BYS A;  5AFK A;  4QH5 A;  3TLS A;  2M6I A;  3WTL A;  5L47 A;  2C9T A;  2XNT A;  4IL4 A;  5J0Z A;  2WZY A;  2ZJV A;  5BW2 A;  2BR7 A;  4ZK4 A;  3JAF A;  2XNU A;  3JAE A;  2LKH A;  3ZDG A;  4TWH A;  2M6B A;  3UU6 A;  2Y54 A;  4D01 A;  3U8L A;  2XQ9 A;  4XK9 A;  2XNV A;  2BYP A;  5LG3 A;  3RHW A;  4LMJ A;  2BYQ A;  2BG9 A;  2LM2 A;  4WV9 A;  5J5G A;  4UY2 A;  2XQA A;  3C79 A;  3WTN A;  4IL9 A;  5HEO A;  4ZK1 A;  3WTO A;  3U8K A;  3U8J A;  3EI0 A;  1OED A;  4A98 A;  4ZZB A;  3WTK A;  3RQW A;  3TLV A;  4Z90 A;  2BG9 B;  2Y58 A;  4QAB A;  2W8F A;  4QAC A;  5BRX A;  2YOE A;  3UUB A;  4HFD A;  2LLY A;  2WNJ A;  4HFE A;  1OED C;  3C84 A;  5KZU A;  3UU3 A;  2XQ7 A;  5SYO A;  2WN9 A;  4TNW A;  2XYS A;  4AFH A;  4LMK A;  3PMZ A;  5TVC A;  5HEU A;  1UW6 A;  2YN6 A;  5J5F A;  3ZDH A;  4ZZC A;  4UM3 S;  2XQ4 A;  5FJV A;  2BG9 C;  2WNL A;  4ILA A;  3T4M A;  4Z91 A;  3SH1 A;  3WIP A;  5J5I A;  4HFB A;  2BR8 A;  3UU8 A;  4NPP A;  4HFH A;  4TWD A;  3ZKR A;  4ALX A;  3UQ7 A;  4ZJT A;  4TNV A;  2W8G A;  3TLU A;  3U8M A;  3EHZ A;  2XQ5 A;  5HEG A;  2YMD A;  4NZB A;  3TLW A;  5AFL A;  5AFH A;  4HFC A;  4HQP A;  2BG9 E;  2XQ8 A;  5AFM B;  2KSR A;  4XHE A;  2XQ3 A;  4LML A;  4ZJS A;  3P4W A;  3LSV A;  5CO5 A;  3WTM A;  5CFB A;  4F8H A;  5KE4 A;  4X5T A;  4BQT A; 
#chains in the Genus database with same CATH topology
 4LFC T;  2MAW A;  5JDF A;  4ZI2 D;  2VVN A;  4YLH A;  3AEA A;  5L3C B;  3KBU A;  4QH1 A;  2D5U A;  3PJA A;  3AEB A;  5IUX A;  2CBI A;  5ABF B;  2B1E A;  5HXR A;  4CN4 A;  1VOM A;  3ABV A;  2XAQ B;  3T1Y T;  3MXZ A;  3IGQ A;  1IZN B;  3P7I A;  1CUN A;  4V1A v;  2Y56 A;  4P09 A;  3UQ4 A;  5LXB A;  1WR0 A;  2X9W A;  2QA7 A;  4IDZ A;  5FXV A;  4DV3 T;  3A5X A;  5LGN B;  4KUM B;  4DMW A;  1HNZ T;  1T8B A;  2XQ9 A;  3U8L A;  2ZM0 A;  4KBM B;  2JMK A;  3CQX C;  4X65 T;  3S4U A;  3OTO T;  2A2F X;  1HS7 A;  4DR5 T;  2WU5 A;  3UFG A;  2VAS A;  1SHZ C;  2NTX A;  2UUB T;  2HHH T;  2E5V A;  5JRC A;  2D2S A;  2V6Y A;  4LMK A;  5HEU A;  3FZK B;  3UT5 E;  2E9X A;  2WP9 A;  3ZKR A;  4TNV A;  4H9S E;  4H9Q C;  3P4P A;  4MHC A;  3LSV A;  3J9X 1;  3ONL C;  4X5T A;  2X0H A;  1KEY A;  5JDG A;  4DR6 T;  2BS3 A;  3ZJ1 A;  5IYZ E;  1IBM T;  4X64 T;  2Y7Y A;  4ILC A;  5AQM B;  5FXX A;  5FMN A;  5HCJ A;  1WR6 A;  1ZHC A;  2ZJU A;  4N78 D;  3UUL A;  3UU5 A;  1QSD A;  4YTM A;  3ZT6 A;  2GK9 A;  5BMV E;  3BQL A;  3C4X A;  2H88 A;  2ZLY A;  4QWN B;  2C5J A;  5DAB A;  4EED A;  4EV6 A;  3RKG A;  5JR9 B;  3BQK A;  2DCF A;  3IHR A;  2BYS A;  4QH5 A;  3TLS A;  3L8R A;  4J2C A;  3HL6 A;  2WZY A;  1JNR A;  3PUG A;  2M6B A;  3AE4 A;  5LHI B;  1HNW T;  3ZC1 A;  2LSI A;  4HWI B;  3D0T A;  1WFD A;  4MAL A;  1U4Q A;  5AQV B;  2XZE A;  3E08 A;  2I0M A;  2ZMA A;  2XAF B;  3MK7 C;  1N33 T;  2LT3 A;  1WYC A;  2QGS A;  3FZM B;  3P4S A;  5DJQ C;  1IBK T;  1LVF A;  2V7L A;  4ILA A;  4TV9 E;  2K5B B;  1XNR T;  5J5I A;  3TLU A;  1O3X A;  4KMC A;  2OV9 A;  3U8M A;  3TLW A;  3RIU C;  2LSY A;  4AIS A;  2X0L B;  4GIW A;  2F4V T;  3U78 A;  2AE9 A;  3L39 A;  3ZST A;  4LF8 T;  3PV0 F;  3O9X A;  1BR2 A;  1D1C A;  3WTJ A;  4DBM A;  4ZR6 A;  3Q5D A;  4EGW A;  4UXU A;  5AQJ B;  3FHN A;  2VVS A;  3VKG A;  3IBP A;  3NRY A;  3P50 A;  3CPZ A;  4A5X A;  1IBL T;  2H7O A;  3AAE B;  4QXH B;  2X9H A;  4YJ2 E;  4YY3 T;  3ONJ A;  2LHN A;  2V7K A;  3EUH A;  4IDP A;  3PUV F;  2HH7 A;  3CX8 B;  1D1A A;  4UR9 A;  3RRC A;  3PJA J;  4EZH A;  3SFE A;  4L5G A;  1ZV4 X;  5J1G A;  1MNE A;  3OPC A;  4CN1 A;  2V8S V;  2CXF A;  2DWG A;  3PU8 A;  1D0X A;  2ZM6 T;  2LM9 A;  2WZI A;  3EDV A;  2UXD T;  3PUY F;  1N36 T;  4AQG A;  2BYQ A;  5AQP B;  2LJL A;  3AE5 A;  5HAX A;  3R6N A;  3WTO A;  2K48 A;  2HPJ A;  3X1D A;  3EVY A;  4U31 A;  4HWC A;  3AE2 A;  3KDS E;  4Q25 A;  4E7Z A;  4GYR A;  5JDQ A;  1G8X A;  4B6X A;  2DNX A;  2XQ4 A;  3ANW B;  1YKE B;  3ZT5 A;  3N2G E;  4ZJT A;  3OVU A;  4FI5 A;  4TX5 A;  4YJ3 E;  4TZ4 C;  2FJA A;  5LNK A;  3SRZ A;  3AA1 B;  4HQP A;  5FYM A;  3V5S A;  4F8H A;  4IDO A;  2LE8 A;  4QH4 A;  3DTO A;  3C98 B;  2NOX A;  3RIU A;  2VWA A;  4LF4 T;  2PFV A;  2N2N A;  2CE7 A;  4OX9 T;  2DHR A;  4DBR A;  5HEH A;  4YHJ A;  4A97 A;  4PIR A;  4DID B;  2PGZ A;  4AFG A;  5CJ5 A;  5ETW A;  4IGU A;  2QC1 B;  3KVA A;  3RGL A;  1WRD A;  3NVO A;  1L0V A;  2X00 A;  2VKO A;  3CX7 B;  3UUN A;  4XAX B;  1VRB A;  2CA5 A;  5LYJ E;  2J62 A;  2JQH A;  3RC3 A;  3QUJ A;  2LHR A;  5HXE A;  3WTL A;  5L47 A;  3VRA A;  4ZI7 E;  1M7K A;  4CI3 B;  2A72 A;  2LKH A;  3QB5 K;  4JI8 T;  1MIV A;  4D01 A;  2DI4 A;  4Z8X A;  2XAH B;  4I4T E;  4UF0 A;  3LK2 B;  4UIG A;  2J47 A;  3JCF A;  4HFD A;  4NUU A;  2WNJ A;  2V5C A;  1OED C;  1D0Y A;  2IC9 A;  4ZZC A;  2JQK A;  3I9Y A;  1R8I A;  4U2Y A;  4JI3 T;  4YSX A;  2BVL A;  4MLK A;  2UUC T;  3I0O A;  3ZPO A;  4KI0 F;  5AFM A;  4AQF A;  4DR7 T;  3SFD A;  4QXB B;  2W0G A;  2W66 A;  5HWX A;  5HXH A;  1LKX A;  3LDQ B;  2H89 A;  2YU2 A;  2WY2 A;  5C8Y E;  5EK3 A;  4NUV A;  2CRB A;  3UTK A;  1OED E;  4DV2 T;  3RPU A;  2Z6E A;  4H9P C;  2W67 A;  4I55 E;  1XDP A;  1FEW A;  4O4J E;  3A8Y C;  4JV5 T;  1UCU A;  4O8S A;  4ZS3 A;  2UXX B;  4AKG A;  4C90 A;  5BR8 T;  2Y6X A;  4YT0 A;  3AE8 A;  2R6G F;  2CXL A;  3O1H A;  5C2T A;  3T8O A;  4DVD A;  3AEG A;  3JC6 C;  2XUE A;  4TUY E;  2WM9 A;  4UY2 A;  4IL9 A;  2NP9 A;  2WMN A;  3KV5 A;  1N34 T;  2WSS V;  4ZEY A;  3AE6 A;  5KZU A;  2B76 A;  5TVC A;  4HWF A;  1HR0 T;  2LSK A;  2L9Q A;  4NPP A;  1E2A A;  5KDM C;  1QLB A;  4OYJ A;  4ANJ A;  1XMO T;  2KSR A;  2JRK A;  4LML A;  4IST A;  4O2B E;  4HFV A;  2BJ0 A;  3Q5W A;  3JAD A;  1MMD A;  2QRX A;  3K3Q C;  3PUZ F;  2WMO A;  4LFA T;  3AAI A;  4H63 V;  2Y57 A;  2XM1 A;  4YSY A;  2W63 A;  3U8N A;  4JI1 T;  4OYK A;  1UUR A;  5AQH B;  4ZHQ E;  3SQ9 A;  2X00 D;  2JPF A;  2IUB A;  4ZI3 C;  2IHR 1;  2K24 A;  3CKD A;  3ZMV B;  4G63 A;  5AQF B;  4HKA A;  2PJQ A;  3AVS A;  2Y48 B;  2XNU A;  5LG3 A;  4UXN B;  4U33 A;  2V6X A;  2XQA A;  2KT9 A;  3F2E A;  3EI0 A;  5AQL B;  2BG9 B;  5BRX A;  2J4G A;  5L3D B;  2LLY A;  4WBN E;  3FB2 A;  1UX5 A;  4MFR A;  3MKD A;  4JBW F;  2E9X C;  5ABF A;  2XTL A;  4EYU A;  5AQN B;  1QUU A;  4P0B A;  2IW5 B;  1SA0 E;  3RYF E;  1IJ5 A;  2BG9 C;  4ERR A;  2X0Y A;  4PK4 A;  2QYW A;  5LA6 E;  2UXB T;  1KFY A;  3Q9D A;  3IEE A;  5HEG A;  4HE8 A;  5E0O A;  3ZYL A;  2WWU A;  5KXJ A;  4X1K E;  2CEA A;  5CFB A;  2XAS B;  4COF A;  3HKC E;  5LBQ B;  4QX7 B;  2BYN A;  2X51 A;  5HWY A;  1D0Z A;  2BBJ A;  4UM3 A;  4B5D A;  1YXR A;  3NBX X;  2UU9 T;  5AFJ A;  5AIN A;  3C4Z A;  3G06 A;  2I59 A;  1H7C A;  4CXX A;  3SWH A;  3N9L A;  2WS3 A;  2BYR A;  4ASK A;  1CHU A;  1FMW A;  2XHE B;  3SQ6 A;  3DJB A;  3L09 A;  2X9Y A;  4KHZ F;  2DL1 A;  4IRE A;  4EZ1 A;  3Q5E A;  4IHJ E;  4JI4 T;  4ILU A;  3BK9 A;  4ZI2 C;  4YFS A;  4EYY R;  4KX6 A;  5J2U E;  3HKB E;  2M6I A;  4U72 A;  5M4Y A;  1HX1 B;  4U7Y A;  2BKN A;  4ZK4 A;  2XSA A;  4PK6 A;  2JQQ A;  2MOZ A;  2CM0 A;  4OFZ A;  5DQW A;  3RHW A;  3WAJ A;  2BG9 A;  1AJ3 A;  1ZOY A;  3UUM A;  2H3R A;  3U3I A;  2YOE A;  3ESL A;  2V1D B;  5FXZ A;  2SPC A;  3CQC B;  2D0T A;  4P0A A;  2CLY B;  2KXP B;  3AED A;  4Z91 A;  3UU8 A;  4TWD A;  3MA9 A;  3UQ7 A;  4LFB T;  2IIU A;  2MBG A;  3Q2M A;  1UX4 A;  2C0S A;  2FJD A;  4NZB A;  5AFL A;  5AFH A;  2E8I A;  2EHO C;  4ZS2 A;  3OKQ A;  4JI6 T;  5FL1 A;  4P1N A;  2D0U A;  4DUZ T;  2WCA A;  3KBT A;  4IE6 A;  3R84 B;  3N2O A;  4GOU A;  4DO0 A;  3ANW A;  5CGM A;  1Y64 B;  4HWH A;  4JUY A;  1W9R A;  2G0U A;  4TN7 B;  4MBQ A;  1NAF A;  4PFO A;  4QX8 B;  2C5I T;  4AIU A;  5JME A;  3UUX B;  3WI3 A;  1MMN A;  3ZCJ A;  1W0A A;  4UF0 B;  3KV6 A;  1MMG A;  3PE0 A;  4ZRU A;  4K0U A;  5DQV A;  5L4E A;  4IDQ A;  4CI2 B;  5H6Q B;  3RI5 A;  5KMG P;  4O4L E;  2YDR A;  4HFI A;  3PEO A;  4X66 T;  2CPT A;  5AFK A;  2XNT A;  5F5W A;  4U7I A;  1S35 A;  3P8C D;  1XZY A;  2P9B A;  3FBL A;  3LK4 2;  3FZF B;  2WDV A;  2KIN B;  3AXJ B;  4JLE A;  3WTK A;  4QAB A;  5LJM A;  4QAC A;  1HTJ F;  3UUB A;  4IDN A;  3PUA A;  2XQ7 A;  5SYO A;  3DP7 A;  2PBI A;  4TNW A;  4DV5 T;  2IAK A;  2VB6 A;  4OK0 A;  3OBV E;  4ALX A;  4CZZ B;  5KX5 E;  1X9B A;  1M62 A;  5LBM A;  3ZYK A;  2CHN A;  3K1S A;  2NR4 A;  2ZM8 A;  4ILB A;  2ZM2 A;  2V7M A;  1LVK A;  4TWF A;  3NZP A;  1YW0 A;  3M65 A;  4IIJ E;  3ZN1 B;  2UXN B;  4F6R C;  4JEH B;  2VKH A;  4KP3 C;  3N9Q A;  3ZMZ B;  3C51 A;  5HCM A;  2XAJ B;  1I6Z A;  5AQI B;  3ZSS A;  4JI5 T;  3NZQ A;  3K8P C;  2XZ6 A;  2ACZ A;  2HN2 A;  4L0R A;  4U74 A;  3CQG B;  5C3J A;  4H9O C;  2CXD A;  2FJB A;  3LBX A;  2BR7 A;  4OHF A;  5L3B B;  4BJM A;  3VKH A;  2ES0 A;  3AAA B;  2LM2 A;  1UK5 A;  2YEV C;  3WTN A;  4I50 E;  3FBZ A;  5ADX L;  2W2U A;  3GA8 A;  2OA5 A;  4NXN T;  3UU3 A;  3QNU A;  2WN9 A;  4AKL A;  4ZXL A;  1LRZ A;  1US7 B;  3RX6 A;  2C5K T;  5JR9 A;  2X68 A;  2EHO B;  1J5E T;  2BG9 E;  2HPL A;  2WWV A;  5AFM B;  5JRE A;  4IE5 A;  2LOS A;  3O1I A;  4PFP A;  4DMV A;  3N9M A;  4DND A;  3EAM A;  2UZ6 A;  2FBW A;  2WU2 A;  2LEH A;  2WQY A;  4DUY T;  4O2A E;  4QKN A;  3N2K E;  3M3Z B;  1NWM X;  5FKY A;  5JVD E;  4BFQ A;  4U3C A;  1Z8U A;  4HTE A;  5CA0 E;  4UM3 P;  3RF1 A;  3A7M A;  5JDN A;  2BKO A;  2WNC A;  1W09 A;  3W15 B;  1FJG T;  2I6H A;  5EZY E;  4YTP A;  2Q9Q B;  5L3E B;  2NW9 A;  2LRL A;  5CA1 E;  4TV8 E;  2VKD A;  3JAF A;  3ZDG A;  4DV0 T;  2VQF T;  4DR4 T;  2Y54 A;  4XK9 A;  2BDE A;  3AEC A;  1Z0P A;  4WV9 A;  1KF6 A;  4ZK1 A;  5JRC B;  3O1J A;  1T72 A;  4HEA A;  4UVA B;  5JR9 C;  3C4W A;  4EOZ B;  3B57 A;  3H3M A;  3AVR A;  2XYS A;  5FNV E;  3ZLI A;  1UW6 A;  5J5F A;  2CWO A;  4PAG A;  4UVB B;  2RPA A;  4HFH A;  2LSG A;  4B3T T;  1UUS A;  4IE4 A;  2KWH A;  2YMD A;  4AXP A;  3GN5 B;  2KWI B;  1J5W A;  1BR0 A;  3CX6 B;  5CO5 A;  2PH9 A;  5AQQ B;  4BQT A;  2FUP A;  5L2L A;  2Y8D A;  1X79 A;  2XPK A;  2VL0 A;  2XSB A;  5F3J A;  5LJN A;  3PUS A;  5AQT B;  3WTH A;  1DU2 A;  4AKH A;  3GUA A;  3K3O A;  4DV4 T;  5EK4 A;  1KNR A;  3B13 A;  5LHH B;  2X67 A;  5LB7 B;  1SE7 A;  3N9O A;  3TKL B;  3JC6 D;  3BQI A;  2YDQ A;  3UFE A;  4KHP T;  2M67 A;  3KVB A;  1XDO A;  3LJC A;  4GK5 E;  1WLX A;  3PU3 A;  5JDH A;  2ZJV A;  5ABE A;  4DBQ A;  4TWH A;  2NW8 A;  1E1H B;  3UU6 A;  3RYI E;  2XNV A;  4AKI A;  1VCS A;  2RA1 A;  4O4H E;  3VHL A;  2BS2 A;  3C79 A;  5HEO A;  2LOP A;  3V5U A;  2K3W A;  5AQR B;  4CXW A;  3TLV A;  4Z90 A;  3QK6 A;  2W4X A;  3I1A A;  3PUR A;  3ZCI A;  3RYH E;  5ABG A;  4AFH A;  3PMZ A;  3ZC0 A;  3EAB A;  2VUR A;  5EK2 A;  3T4M A;  3WIP A;  4HFB A;  2BR8 A;  4LF5 T;  4ZI3 D;  3FXD B;  2LSJ A;  2NWB A;  4JI2 T;  3N5L A;  4PK5 A;  5A1L A;  2UUA T;  2WAU A;  4EB6 E;  1SUM B;  2X66 A;  2XQ3 A;  4PJJ A;  4ZJS A;  2BBH A;  2E2A A;  4B3M T;  4G2A A;  5AFN A;  1VCT A;  4BJN A;  3RIA A;  4B3S T;  2CLY C;  2KND A;  3LG7 A;  3FZH B;  5BP0 A;  3AE9 A;  4X1Y E;  4BA9 A;  1I94 T;  3IA3 A;  3KV4 A;  3LFM A;  4QXC B;  1YQ4 A;  1UX2 A;  2MTQ A;  4DV6 T;  3HKE E;  3RC8 A;  2YIN A;  3H37 A;  3SIO A;  4WNK A;  3QOF A;  3F31 A;  3KIN B;  4PNI A;  1XMQ T;  4IL4 A;  2XJ7 A;  3SOL A;  3PUQ A;  3KFW X;  1N32 T;  5HYA A;  4EAH A;  1YKH B;  2WZH A;  3C64 A;  2V26 A;  2EHO A;  1GQE A;  3SS1 A;  3HI2 A;  4PJN A;  2MPK A;  2BZB A;  1T98 A;  3C50 A;  2IML A;  5FL0 A;  3C84 A;  2VL8 A;  1B7T A;  5AQG B;  3AA7 B;  1IJ6 A;  3MJX A;  1W0B A;  3OYZ A;  1YQ3 A;  2IC6 A;  4LF9 T;  4NIQ A;  2XQ5 A;  5AQK B;  2XQ8 A;  4YHH T;  2ODV A;  4M1P A;  5LMN T;  3NWI A;  4IT4 A;  1MIW A;  3VRB A;  1ZKE A;  4ISS A;  3AEE A;  1BR1 A;  4UV8 B;  4FJO A;  4UM1 A;  2AXD S;  2YDS A;  2X9X A;  1NEK A;  4UV9 B;  4I43 B;  2W00 A;  3CVR A;  3AXJ A;  4X1I E;  4QAA A;  3AB3 B;  5FY7 A;  3CIR A;  4X62 T;  2W62 A;  3AE1 A;  3VU7 H;  4B3R T;  2PTF A;  1OXZ A;  4HGA A;  4PJM A;  4WZX A;  5CB4 E;  2RP4 A;  2CCQ A;  4EZ4 A;  3ZT7 A;  2XZ5 A;  1UV6 A;  1OED B;  4UVC B;  3ETU A;  3ETV A;  3PDY A;  4DV7 T;  2L8K A;  2JIW A;  2WBL A;  4DR1 T;  3MZK B;  2C9T A;  5J0Z A;  1D1B A;  5FP3 A;  4E7S A;  5J5G A;  2DLR A;  1HF8 A;  4PJL A;  1OED A;  2VK9 A;  5JH7 E;  4AI6 A;  2KLQ A;  4AQY T;  3RH3 A;  3FXE B;  3CML A;  5JDL A;  1HG2 A;  2YN6 A;  3NRX A;  1NEN A;  2WNL A;  4WYV A;  2W8G A;  4JYA T;  4JEU B;  2CHO A;  2JMH A;  1IAP A;  2XQY A;  2VQE T;  2XY8 B;  1G73 A;  3N9N A;  3N9P A;  4XHE A;  3WAK A;  2ODU A;  3CWZ B;  3IF8 B;  3RRW A;  3F57 A;  2XAG B;  4WW0 A;  3Q5X A;  1I9B A;  4GKJ T;  2V5D A;  1HNX T;  5LP6 E;  1V9D A;  2E9X B;  5FY1 A;  1J1J A;  3ZMT B;  3CK6 A;  4YSZ A;  5HXS A;  3HR0 A;  5L4H A;  3ZEF B;  3RIF A;  4JI7 T;  2YME A;  4YXD A;  1WCR A;  3HKD E;  3GMI A;  2BS4 A;  2WDR A;  4DV1 T;  4GK0 E;  3ZYM A;  4GKK T;  4AKR B;  3OJA A;  2NTY A;  5BW2 A;  4EXT A;  2BVM A;  2YK0 A;  3AE3 A;  2WDQ A;  2DWK A;  3PTR B;  3U8J A;  3AA0 B;  2KZ7 B;  2V6Y B;  3NKZ A;  4ZZB A;  2Y58 A;  2W61 A;  5H6R B;  1Y01 A;  2Q9Q A;  2XM2 A;  5AFU L;  3EDU A;  2KMF A;  2LRK A;  4ADZ A;  5L3F B;  4CQI A;  4O4I E;  4UM3 S;  3MAC A;  2Q9Q D;  4DR2 T;  2BKP A;  3EHZ A;  1HG5 A;  5JTG A;  1HFA A;  4HFC A;  2ACX A;  4WBO A;  2N1G A;  3P4W A;  4H9N C;  5F8P A;  5KE4 A;  3GN5 A;  3GWH A;  4U2Z A;  5HEJ A;  5LHG B;  1FMV A;  5JDM A;  2E5L T;  2D9D A;  5FY0 A;  2A3D A;  5HXC A;  1EZ3 A;  5IWA T;  4IE7 A;  5FVK A;  3O4X E;  3WTI A;  1HCI A;  3VR8 A;  1XNQ T;  2JJ9 A;  4LF6 T;  2MYS A;  3ZN0 B;  4XBF B;  5J5H A;  3B5M A;  5LOV E;  1OWA A;  4FRR A;  3TLT A;  3T1H T;  3ONX A;  2YKS A;  4EEB A;  3RQU A;  5ABH A;  5J2T E;  2CBJ A;  4YTN A;  1HX8 A;  3P4Q A;  1ZEE A;  2VKJ A;  4H63 H;  2HN1 A;  4AQF C;  5LGU B;  5GON E;  1MND A;  1JNZ A;  4BAY B;  1ZP0 A;  3K3N A;  3HA4 A;  2Q9Q C;  4A98 A;  2CMR A;  4HFE A;  5LGT B;  4CXY A;  4XZC A;  4X20 E;  2EHO D;  4HWD A;  3AEF A;  3PUW F;  3ZDH A;  3LK3 B;  3SH1 A;  5LXT E;  5LG4 A;  1T7S A;  4UEM A;  3FZL B;  1XWM A;  3RLF F;  4HN9 A;  4I0U A;  3LBX B;  5FVL A;  3VR9 A;  1FIO A;  2N9D A;  1S94 A;  3AA6 B;  5L3G B;  1U5P A;  3E22 E;  4L9I A;  4C91 A;  2J1D G;  2L3L A;  5AQO B;  2V7I A;  2K9A A;  2LKG A;  2H7V C;  3H3A A;  5JQG E;  1E7P A;  3L3P A;  2OLT A;  2XYT A;  3UU4 A;  2YU1 A;  3PUX F;  2IDO B;  3E0Z A;  4CI1 B;  2XQ6 A;  3P4R A;  4K0K T;  4AFT A;  4GYS A;  4EIW A;  1MIY A;  1KK7 A;  2JQ9 A;  4ZOL E;  1KNZ A;  3QB5 A;  4PW8 A;  4QHO A;  2PG8 A;  4DR3 T;  2QVA A;  3QC9 A;  3JAE A;  5TAO A;  3KV9 A;  5AQU B;  2BYP A;  4LMJ A;  4LF7 T;  1KNP A;  1WYB A;  3AE7 A;  3U8K A;  1BR4 A;  2NW7 A;  2CWY A;  5AQS B;  3RQW A;  4A56 A;  4H9R C;  2FJE A;  2W8F A;  4IE0 A;  4JI0 T;  3J7Y q;  4CN6 A;  1YD8 G;  3ZMS B;  5FJV A;  4UEL A;  2WB5 A;  1UGO A;  3ZJ2 A;  3RKO A;  1MMA A;  2V7J A;  5IHY A;  4NXM T;  5LMU T;  2UXC T;  3OYX A;  5LCY A;  2A9U A;  3RYC E;  2E9X D;  3I9W A;  5FXW A;  3I0Q A;  3WTM A;  3ZMU B; 
#chains in the Genus database with same CATH homology
 2MAW A;  1I9B A;  4QH4 A;  5HEJ A;  2BJ0 A;  5AFN A;  4COF A;  5AFM A;  4ILB A;  2BYN A;  3JAD A;  4UM1 A;  2Y7Y A;  3RIA A;  3EAM A;  3WTJ A;  4TWF A;  4DBM A;  4QH1 A;  2UZ6 A;  2VL0 A;  2LKG A;  4ILC A;  4ZR6 A;  4UM3 A;  4B5D A;  5HCJ A;  4UXU A;  3WTI A;  5IUX A;  5AFJ A;  5HEH A;  4QAA A;  2ZJU A;  3P50 A;  2Y57 A;  4BFQ A;  3UU5 A;  4A97 A;  5L4H A;  2XYT A;  5AIN A;  4PIR A;  5BP0 A;  3WTH A;  1OED E;  5J5H A;  3U8N A;  3RIF A;  3UU4 A;  3GUA A;  2PH9 A;  5JME A;  4UM3 P;  2BYR A;  2PGZ A;  2X00 D;  3SQ9 A;  4AFG A;  5HCM A;  2YME A;  2XQ6 A;  4FRR A;  4AFT A;  3TLT A;  3SQ6 A;  2YKS A;  2WNC A;  4ZRU A;  2QC1 B;  2XZ5 A;  3IGQ A;  5L4E A;  3RQU A;  2X00 A;  3RI5 A;  1UV6 A;  4IRE A;  1UX2 A;  1OED B;  2XZ6 A;  4EZ1 A;  4HFI A;  3SIO A;  2Y56 A;  3UQ4 A;  5LXB A;  3PEO A;  2BYS A;  5AFK A;  4QH5 A;  3TLS A;  2M6I A;  3WTL A;  5L47 A;  2C9T A;  2XNT A;  4IL4 A;  5J0Z A;  2WZY A;  2ZJV A;  5BW2 A;  2BR7 A;  4ZK4 A;  3JAF A;  2XNU A;  3JAE A;  2LKH A;  3ZDG A;  4TWH A;  2M6B A;  3UU6 A;  2Y54 A;  4D01 A;  3U8L A;  2XQ9 A;  4XK9 A;  2XNV A;  2BYP A;  5LG3 A;  3RHW A;  4LMJ A;  2BYQ A;  2BG9 A;  2LM2 A;  4WV9 A;  5J5G A;  4UY2 A;  2XQA A;  3C79 A;  3WTN A;  4IL9 A;  5HEO A;  4ZK1 A;  3WTO A;  3U8K A;  3U8J A;  3EI0 A;  1OED A;  4A98 A;  4ZZB A;  3WTK A;  3RQW A;  3TLV A;  4Z90 A;  2BG9 B;  2Y58 A;  4QAB A;  2W8F A;  4QAC A;  5BRX A;  2YOE A;  3UUB A;  4HFD A;  2LLY A;  2WNJ A;  4HFE A;  1OED C;  3C84 A;  5KZU A;  3UU3 A;  2XQ7 A;  5SYO A;  2WN9 A;  4TNW A;  2XYS A;  4AFH A;  4LMK A;  3PMZ A;  5TVC A;  5HEU A;  1UW6 A;  2YN6 A;  5J5F A;  3ZDH A;  4ZZC A;  4UM3 S;  2XQ4 A;  5FJV A;  2BG9 C;  2WNL A;  4ILA A;  3T4M A;  4Z91 A;  3SH1 A;  3WIP A;  5J5I A;  4HFB A;  2BR8 A;  3UU8 A;  4NPP A;  4HFH A;  4TWD A;  3ZKR A;  4ALX A;  3UQ7 A;  4ZJT A;  4TNV A;  2W8G A;  3TLU A;  3U8M A;  3EHZ A;  2XQ5 A;  5HEG A;  2YMD A;  4NZB A;  3TLW A;  5AFL A;  5AFH A;  4HFC A;  4HQP A;  2BG9 E;  2XQ8 A;  5AFM B;  2KSR A;  4XHE A;  2XQ3 A;  4LML A;  4ZJS A;  3P4W A;  3LSV A;  5CO5 A;  3WTM A;  5CFB A;  4F8H A;  5KE4 A;  4X5T A;  4BQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...