3TLUA

The glic pentameric ligand-gated ion channel loop2-24' oxidized mutant in a locally-closed conformation (lc1 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPCTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tluA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tluA01
3SH1A 4TWDA 3WTOA 2YKSA 5HCJA 3C79A 3C84A 3UQ7A 3U8MA 4QH5A 2LLYA 4ILCA 2X00A 3RHWA 2BYQA 4PIRA 2XNUA 3RI5A 4ZJSA 2M6IA 5TVCA 1OEDE 4ZK1A 2XYTA 3ZKRA 4D01A 2XQ9A 4UM1A 5KZUA 4QACA 3U8KA 3EHZA 2XYSA 4ZK4A 3UU5A 4COFA 4ILAA 5IUXA 2ZJUA 2BJ0A 1OEDB 2BG9A 1UX2A 4A98A 4UY2A 4UM3A 4NZBA 3EI0A 2YN6A 3RQUA 4UM3S 3LSVA 5AFHA 3EAMA 3GUAA 3TLWA 2WN9A 3WTMA 4DBMA 4FRRA 4HQPA 3WIPA 4F8HA 3ZDHA 5J5IA 4BQTA 3UU4A 2PGZA 2YMEA 2XQ8A 5CFBA 1I9BA 5LXBA 2W8GA 2XQ5A 4ZJTA 5J5HA 3RQWA 4TNWA 5L47A 4A97A 1OEDC 2XQ4A 4IL4A 2BYNA 2BYRA 4HFCA 5J0ZA 3WTNA 4LMLA 3ZDGA 4QAAA 2PH9A 3SIOA 3UU6A 3WTIA 2XQ6A 4LMJA 4LMKA 2XNVA 2BG9E 3RIAA 2ZJVA 4ALXA 5JMEA 4NPPA 3JAEA 5HEGA 2BYPA 4AFHA 5L4EA 5AFJA 3SQ6A 2BR8A 3WTLA 5AFMB 3TLVA 1UW6A 4UM3P 5AFNA 2BG9B 3TLTA 4AFTA 5L4HA 5HEOA 3IGQA 4Z90A 3TLSA 2LKGA 2Y7YA 4ILBA 3RIFA 3JADA 3U8NA 4QH1A 5AFKA 4IREA 3U8JA 2WNCA 3P50A 5LG3A 2Y56A 3T4MA 2X00D 2WNLA 4HFIA 5HCMA 2YOEA 4XHEA 2MAWA 2BR7A 4Z91A 2BG9C 4HFBA 5J5FA 4HFDA 5HEUA 2LKHA 2Y57A 4AFGA 2Y58A 4QH4A 4IL9A 5FJVA 5J5GA 3UUBA 1OEDA 5AINA 4HFEA 2BYSA 2XQ7A 2W8FA 4TWHA 3U8LA 4XK9A 2XQ3A 2XQAA 2XZ6A 3WTJA 4TNVA 3UQ4A 3SQ9A 2WNJA 3PEOA 2KSRA 2LM2A 4QABA 5BRXA 5KE4A 3P4WA 2XNTA 2QC1B 2VL0A 4HFHA 5HEHA 5BW2A 4X5TA 5AFMA 5CO5A 2YMDA 3UU8A 3PMZA 1UV6A 4WV9A 4ZR6A 2UZ6A 2WZYA 2Y54A 4ZRUA 4EZ1A 4ZZBA 5HEJA 4BFQA 4TWFA 3TLUA 3UU3A 4ZZCA 5SYOA 4UXUA 3WTHA 3WTKA 5AFLA 4B5DA 2C9TA 3JAFA 2XZ5A 2M6BA 5BP0A
chains in the Genus database with same CATH superfamily
5LGNB 2XTLA 4F6RC 2BKOA 4ZJSA 4EEDA 1W9RA 2XYTA 3ZT5A 1WRDA 3U8KA 2V5CA 4EYUA 2CHOA 5KDMC 3ZCJA 2UXXB 5JDNA 5LGTB 4AKHA 1AJ3A 3PURA 3ZDHA 2D0UA 2KNDA 5J5HA 3E22E 4CXYA 4P1NA 2CBJA 4K0KT 4X64T 5J0ZA 1XNRT 3K8PC 4QAAA 1HFAA 3ZSSA 5J2TE 3L39A 4NPPA 4UIGA 5JRCB 3P4SA 1B7TA 3K3OA 4C91A 2JPFA 4O4HE 3TLTA 4AFTA 3OTOT 4JI2T 2W00A 1V9DA 2ODUA 4EOZB 3SOLA 4P09A 4EYYR 2CLYB 1T7SA 2LT3A 2CCQA 5AINA 4XK9A 1CHUA 2HN1A 3SQ9A 3T8OA 4WBNE 4X5TA 5F8PA 5AQOB 1YXRA 2H7VC 3LK3B 2J1DG 5IYZE 3KVBA 3ZLIA 4PK4A 5FMNA 3HA4A 2MOZA 4U2ZA 3C4WA 3EDUA 3B13A 3GMIA 4ZK4A 4ILAA 2BJ0A 5ABFA 2NTXA 1NAFA 4I55E 4GIWA 4XAXB 3BK9A 2HHHT 2CMRA 3Q5EA 5JDFA 5CA0E 2E9XC 2K24A 3QNUA 1WCRA 2Q9QC 5LMNT 4JI4T 2N9DA 3ZYLA 1EZ3A 2E9XB 4LMLA 4UF0A 2Q9QB 2G0UA 2JQQA 1T72A 3KVAA 4ALXA 4DBRA 3L8RA 3HKEE 5AFJA 3ZYKA 4L9IA 2DLRA 3O1JA 2Z6EA 4EXTA 2QGSA 2R6GF 4EB6E 3LK42 3T1HT 4IIJE 5HEUA 2LJLA 2Y58A 2OLTA 2ZM8A 4B3RT 4I50E 1FMVA 1IAPA 1J5WA 1NEKA 3AVSA 2BDEA 4TWHA 1MMAA 4TNVA 3UQ4A 3N2KE 5KE4A 5BW2A 5CO5A 4Z8XA 5TAOA 4O2AE 5LYJE 1JNRA 2E8IA 4FJOA 3RPUA 5FYMA 1LKXA 2VKDA 1N32T 4QHOA 3AA6B 3SH1A 1Z8UA 3UQ7A 3AAIA 4ZK1A 4O4LE 4P0AA 5C2TA 5JRCA 4OHFA 1IBLT 2LRKA 1YKHB 3ZPOA 2WP9A 2YINA 5LNKA 2V6XA 5AQIB 3RF1A 4YTNA 2X0HA 2XQ5A 1ZEEA 4EV6A 3N2GE 1KNPA 2BG9E 3FXEB 2XAGB 4AFHA 3UUXB 2VKHA 5LHIB 1XWMA 2LOPA 2W4XA 2W62A 3EUHA 3H3AA 1MIVA 3CX7B 4JYAT 3U8JA 2ZLYA 2Y56A 2LOSA 3OKQA 4HFIA 3ZC1A 3IF8B 3MKDA 4EIWA 5JDMA 2EHOD 2E2AA 3WI3A 5J5FA 2GK9A 5L3DB 3E0ZA 3HL6A 4IDPA 1BR0A 3AEAA 1HG5A 3ZMZB 4UV8B 4X20E 4HFVA 2XASB 3GN5B 2XY8B 2CWOA 3RRWA 3I9WA 5ABHA 3RRCA 1D0ZA 3ZJ2A 2QVAA 5M4YA 2BS3A 2VURA 1KNZA 4AKGA 4J2CA 3F2EA 2UXBT 4OYKA 4U74A 3AAAB 3ZMSB 2BYQA 5A1LA 3PUQA 3ZKRA 3FZKB 4PJMA 1HR0T 4PJLA 3V5UA 2MYSA 3X1DA 3O9XA 3N9MA 3WIPA 1U5PA 2X68A 3SFEA 4AQYT 5AQFB 2NW8A 2X0LB 4A97A 4DR1T 5LA6E 5JDHA 4G63A 2YK0A 3JAEA 3LBXB 4ZI3D 1T8BA 2NTYA 4ZXLA 2K48A 4ILBA 2YU2A 5LG4A 2XM1A 3ZJ1A 5FKYA 1XMOT 1D1CA 4NIQA 3T4MA 2WNLA 3N9QA 5DQWA 1E1HB 4AISA 2Y57A 3SFDA 5F5WA 3U78A 2NR4A 3J9X1 4LF5T 4UEMA 2WDRA 2IDOB 2ZM6T 1VCTA 3FZLB 3M3ZB 4JV5T 3J7Yq 1BR1A 5LP6E 2JJ9A 3T1YT 2BKNA 2PFVA 2X51A 3WTOA 4H63H 4DV5T 2X00A 4AXPA 3OYXA 2LSYA 4D01A 4ZS2A 3C64A 4LFAT 1OEDB 1UX2A 3EI0A 2YN6A 4JI1T 4EZ4A 1E2AA 4FRRA 2CHNA 3N9NA 2X9XA 3KDSE 2WWVA 3BQKA 5LXBA 4ZJTA 4DV7T 3RQWA 3IBPA 3PUGA 2XQ4A 3A5XA 3LK2B 2KWIB 2VWAA 3PUAA 4MFRA 3OJAA 3AAEB 2QA7A 3GN5A 2VASA 3KFWX 4H9SE 5AQMB 4DV3T 2ACXA 5JDGA 5LJMA 2VVNA 4DV0T 4UXNB 3ANWB 3AVRA 2LRLA 1XNQT 3H37A 2WNCA 3WAJA 4JEUB 4KI0F 1HNWT 3FZMB 2VVSA 4MHCA 1KEYA 1ZKEA 2UUCT 3VRAA 4YLHA 4JLEA 2D2SA 3QC9A 4ERRA 3L3PA 5HAXA 5H6RB 1MNEA 3B57A 1Y01A 4HN9A 2XAHB 5ETWA 2QC1B 5HEHA 1CUNA 4BAYB 1BR4A 4ZRUA 4AKIA 4EZ1A 5AQUB 5AQLB 4BFQA 4ZI2D 4UXUA 4KBMB 4UF0B 2V6YB 2B1EA 4PK5A 2L9QA 2XAJB 5TVCA 5LCYA 3NKZA 2V5DA 3LBXA 2V8SV 4KP3C 2XPKA 4YJ3E 2UUBT 2W67A 4UM3A 1HX1B 5EK3A 3KBTA 3N9PA 5LBMA 3HKDE 1HNZT 2H3RA 5DABA 5CA1E 4QX7B 5L3EB 3BQLA 2FBWA 5L2LA 3OBVE 5FL0A 3DTOA 3NBXX 2KXPB 2CBIA 2VQET 2LEHA 2ZM2A 5L4EA 4IGUA 3LDQB 4LF8T 4EEBA 4AKLA 4Z90A 5FXWA 3U8NA 4ISTA 4AQGA 4C90A 1O3XA 4DR4T 3ETVA 4XBFB 5LBQB 4WZXA 1YQ4A 1OWAA 2JQKA 2FJBA 5L3FB 5HYAA 3I0OA 1BR2A 3PV0F 2IIUA 1OEDA 2JRKA 4M1PA 3WTJA 4X62T 2CLYC 2FJEA 4PJNA 4E7SA 3WAKA 4WV9A 2UZ6A 5HXEA 4ZZBA 4TV8E 3RH3A 4CI2B 3GA8A 4AIUA 2X67A 2XAQB 4HKAA 5EK2A 3ZMVB 4O2BE 1D0XA 4QACA 3EABA 2D5UA 2NP9A 3PUXF 3VR8A 4A98A 4UVBB 2BVMA 4NZBA 3RQUA 4ISSA 2PBIA 3GUAA 3ANWA 4DBMA 2VB6A 4LF9T 4YTMA 1I9BA 4ASKA 4IE6A 4IDZA 2X9WA 4BJMA 4H63V 4CXWA 5JVDE 4YHJA 3RYCE 2XNVA 2LE8A 3RIAA 4E7ZA 3SQ6A 3AA0B 3FZFB 5FXXA 5LXTE 2W0GA 3EDVA 2IUBA 3PJAA 2DWGA 2WU2A 3I1AA 4X66T 2V6YA 3PUSA 2I59A 4XHEA 3R84B 2WU5A 2KZ7B 4CQIA 4DR7T 2FJAA 5IWAT 3RC3A 5BRXA 3P4WA 3C98B 3ZCIA 4OYJA 4DV6T 2CPTA 5H6QB 2DWKA 4JI7T 2C9TA 2CE7A 5HXSA 4HWHA 2V7JA 1W09A 5HXCA 4QH5A 2V7IA 2XNUA 2M6IA 5CB4E 2XQ9A 3GWHA 3IEEA 4H9NC 5AQVB 2XYSA 1UCUA 4UY2A 1NENA 5JR9B 2ES0A 3TLWA 3QOFA 3W15B 1D1AA 4IT4A 2KMFA 2XQ8A 1YQ3A 4A5XA 1I6ZA 3FXDB 4IL4A 5L3BB 2WM9A 1I94T 3ZDGA 2DL1A 1WYBA 5BMVE 4U7YA 4DVDA 3A8YC 4LMKA 1MMNA 4KHPT 2ZJVA 2BBJA 2YDQA 2CM0A 4DR3T 3PUWF 3D0TA 4DBQA 5HXHA 3NRYA 4G2AA 5L4HA 5HEOA 4CI3B 2QYWA 4ILUA 2JMKA 4UVAB 2LHNA 3OVUA 3DP7A 3O1HA 4DUYT 2LKHA 4AFGA 1XZYA 3JC6D 4GK0E 3CIRA 5FJVA 5J5GA 3FBZA 3P7IA 3UUNA 2UUAT 1R8IA 1UX4A 5EZYE 1UUSA 4Q25A 2J62A 3Q2MA 5AQTB 1UV6A 5AQPB 4ZR6A 2Y54A 2WDQA 2V1DB 4ZZCA 2CXDA 2VK9A 1YW0A 4TN7B 3ZN1B 5LHHB 3F57A 3KV5A 2EHOA 3EHZA 3CX8B 3FHNA 1IZNB 4COFA 1ZP0A 2A9UA 4P0BA 3QB5K 3WTMA 4H9RC 2WCAA 2WS3A 2L8KA 1UURA 5CFBA 2WAUA 3G06A 2E5LT 5IHYA 1QLBA 3AA7B 2BYNA 4HFCA 1KNRA 5E0OA 3WTIA 4HE8A 4ZEYA 1JNZA 2WWUA 2LM9A 4HEAA 4JEHB 3IGQA 4MBQA 1KK7A 3P50A 4ZI2C 2BR7A 1J1JA 2V7MA 4JI6T 3C4ZA 4TZ4C 2C5IT 3N9LA 3ZN0B 1D1BA 4QWNB 3U8LA 5JR9A 5FY1A 5LOVE 4NXMT 4DMWA 2LM2A 1HG2A 4HFHA 3VU7H 3K3NA 4QXCB 3FBLA 2CRBA 5AFLA 2LSGA 3AE9A 2LSJA 2ZM0A 5JDLA 3CQCB 2VL8A 5ABGA 3AEBA 3PU3A 3P4RA 1U4QA 2HPJA 2W66A 4BJNA 4YY3T 1HNXT 2UU9T 1FMWA 2X0YA 3AE7A 2WDVA 5L3CB 1OEDC 4KX6A 2LSIA 5LMUT 5AQRB 3UU6A 4EZHA 4GKKT 2VQFT 2WY2A 1L0VA 1MNDA 4LF6T 5HXRA 1UX5A 2BG9B 3ZSTA 3OPCA 1XDOA 4BA9A 3MXZA 1YKEB 3HKBE 2YDRA 4X1YE 4IREA 3LJCA 3BQIA 4LF4T 3M65A 4KUMB 3CVRA 4LFCT 2ODVA 2IC6A 4B6XA 4IDOA 2XSBA 3MACA 5EK4A 3FZHB 3K3QC 2XNTA 1X9BA 4DR2T 5AFMA 5LHGB 2B76A 4CI1B 1NWMX 3SS1A 5F3JA 2WZYA 3AEDA 4ZOLE 2IMLA 2VKOA 3KV4A 1SA0E 4UELA 1X79A 4TWDA 4IE7A 1S94A 3N9OA 4ILCA 3V5SA 5CJ5A 4U7IA 4HGAA 4DNDA 4JI0T 3MK7C 5FNVE 1IBKT 2ZJUA 5KX5E 3AE8A 3IHRA 3RKOA 4MLKA 4F8HA 2UXDT 4BQTA 1ZV4X 1N33T 2RA1A 2PGZA 4O4JE 4U3CA 3OYZA 2XQYA 3E08A 2Y8DA 4IE5A 3RC8A 4U31A 2PH9A 2CXFA 3UUMA 2FUPA 3HI2A 4KHZF 4LMJA 2NWBA 5AFUL 2JQHA 1G73A 2C5JA 2KT9A 2BKPA 3DJBA 2DHRA 4H9QC 3SRZA 3P8CD 5JDQA 2LKGA 5J1GA 3AEEA 1QUUA 4HWIB 2HN2A 5GONE 3F31A 5AQSB 2XSAA 3NVOA 2I0MA 5C3JA 3AEGA 2K9AA 4JI3T 5BR8T 2A3DA 4DV4T 4DMVA 1IBMT 3PU8A 3MZKB 5FXZA 4YSXA 4IE4A 2K5BB 4UV9B 4H9OC 4DUZT 5FVLA 2SPCA 2MBGA 1MMDA 2MPKA 1G8XA 2P9BA 5FVKA 2H89A 1WR0A 3U8MA 1T98A 4LF7T 3R6NA 4YTPA 2L3LA 1LVFA 2YU1A 2BG9A 5JH7E 1QSDA 2WB5A 1US7B 2LSKA 1VCSA 1IJ6A 2C0SA 5KMGP 2YDSA 3UU4A 4I43B 1D0YA 3O4XE 3Q5XA 3ZT7A 3NRXA 2BZBA 3S4UA 4OFZA 4B3ST 4DO0A 2KINB 4CN1A 2LHRA 4WNKA 1VOMA 2CXLA 3Q5WA 3JC6C 5C8YE 2E5VA 2PG8A 4YT0A 5DQVA 4OK0A 2K3WA 3B5MA 3TLVA 1UW6A 1IJ5A 3TLSA 2A72A 4NUUA 1W0BA 3AXJB 5AQQB 4YHHT 2XAFB 2WQYA 2EHOC 1MIYA 2JIWA 3VKGA 2YEVC 3AE3A 3C50A 3CK6A 4HFBA 5FP3A 2EHOB 5L3GB 3RLFF 4PJJA 4WBOA 2XQ7A 4KMCA 2XQ3A 2XQAA 3Q9DA 4O4IE 4L5GA 4L0RA 4DV2T 4XZCA 2YMDA 4IHJE 5LB7B 3WTKA 2OV9A 5AQJB 2WZHA 3JAFA 2XZ5A 4B5DA 1WLXA 4ZS3A 3C79A 3C84A 2ACZA 3RHWA 3CMLA 3JCFA 1XDPA 3C4XA 4QXHB 4WW0A 5AQHB 4ADZA 5KZUA 2CEAA 4CN6A 2RP4A 1S35A 1N36T 4ZHQE 3NZQA 4UM3S 4HTEA 1OXZA 2WN9A 5J5IA 3RGLA 5FL1A 3P4PA 2WMNA 3ZT6A 1E7PA 4GK5E 5KXJA 5FY0A 1FEWA 3ONLC 5JR9C 3WTNA 4GYSA 3NZPA 4QXBB 1SUMB 4ZI3C 2XHEB 4DR5T 2MTQA 5AQKB 3Q5DA 4AQFC 3ETUA 3CQGB 2Y7YA 4GKJT 5ABEA 4O8SA 4GYRA 5FY7A 4U33A 5LG3A 2JQ9A 4H9PC 3QUJA 2AE9A 2YOEA 3ESLA 2V7KA 4JBWF 3AE4A 1ZHCA 4CZZB 4HFDA 1SHZC 5ADXL 1ZOYA 3AA1B 5DJQC 4LFBT 3RYHE 4X65T 2HH7A 1WYCA 3PEOA 2RPAA 1MMGA 2X66A 5LJNA 5AQGB 2F4VT 2Y6XA 2N2NA 2J4GA 3UU8A 3PMZA 3L09A 5HEJA 4TWFA 5SYOA 3PUYF 3N5LA 5BP0A 2IW5B 2JMHA 3KV9A 4PIRA 3AE1A 1OEDE 2BVLA 1LRZA 2V26A 3CPZA 4EAHA 2DCFA 4YSYA 1N34T 2X9YA 5IUXA 4DV1T 3LSVA 3EAMA 2IHR1 2C5KT 2IAKA 3AXJA 2VKJA 3I9YA 2WMOA 2YMEA 4NUVA 2J47A 5L47A 5LGUB 3CWZB 3CX6B 4YJ2E 2V7LA 5FXVA 2DI4A 3ONXA 4CN4A 3UFGA 4OX9T 1UK5A 2H7OA 4AI6A 3CKDA 5HEGA 3PUVF 4QX8B 3KINB 3UTKA 2BR8A 1SE7A 5AFMB 5AFNA 4UM3P 2XZEA 1HTJF 2E9XD 1DU2A 3PTRB 2WZIA 4ANJA 4V1Av 2Q9QD 4PFPA 5J2UE 2NW9A 2E9XA 2PTFA 2W2UA 3P4QA 4I0UA 2Q9QA 3UUBA 2W8FA 2BYSA 2XZ6A 4YSZA 2WNJA 3H3MA 2VL0A 4UVCB 2XUEA 1FJGT 2KWHA 4FI5A 3TLUA 2IC9A 3PDYA 2LLYA 3RI5A 2XJ7A 5HWXA 2UXNB 1HCIA 3UU5A 5HWYA 1Z0PA 3RIUC 3KBUA 5AFHA 4HQPA 3IA3A 3AE6A 4UR9A 2WSSV 4AQFA 1GQEA 4EGWA 2OA5A 4A56A 4TNWA 1W0AA 3A7MA 3UULA 3CQXC 3QB5A 2PJQA 4JI5T 4U72A 5CGMA 2BS4A 4K0UA 3SIOA 1H7CA 1FIOA 4IDQA 5JMEA 1M62A 3RYIE 2BYPA 3SWHA 1YD8G 3AE5A 4WYVA 2CA5A 3VR9A 3TKLB 3VHLA 3N2OA 2XM2A 3EVYA 3ZC0A 4JUYA 2X00D 3ZMUB 4B3MT 2D0TA 2X9HA 2MAWA 4Z91A 2BG9C 4NXNT 4AKRB 2W61A 3MA9A 3C51A 3ZEFB 4QH4A 2UXCT 2NW7A 4HFEA 2N1GA 2H88A 4PFOA 3I0QA 2BS2A 3AE2A 3U3IA 1LVKA 1J5ET 3O1IA 4MALA 1HS7A 4HWFA 4PK6A 4DIDB 2M67A 2M6BA 1KFYA 3HR0A 2YKSA 3LG7A 5HCJA 4YXDA 4TUYE 2W63A 1XMQT 4UM1A 4X1KE 2A2FX 4PNIA 3KV6A 4HWDA 3FB2A 2KLQA 4U2YA 2I6HA 3ABVA 3RX6A 1HF8A 3RYFE 4ZI7E 3ZMTB 5JTGA 3RKGA 3AB3B 4QKNA 2W8GA 4PAGA 3VRBA 2QRXA 1HX8A 2BYRA 4X1IE 4TV9E 2XQ6A 4HWCA 1Y64B 2WBLA 1UGOA 3WTLA 2CWYA 4JI8T 4DR6T 5ABFB 3RIFA 3JADA 4QH1A 2HPLA 1M7KA 5AFKA 2ZMAA 1WFDA 3AEFA 1MIWA 3ONJA 1KF6A 3ZYMA 4IDNA 5HCMA 3VKHA 4GOUA 3UFEA 4YFSA 2Y48B 4N78D 3PE0A 3K1SA 2DNXA 4IL9A 3HKCE 3QK6A 2AXDS 3NWIA 5JQGE 1VRBA 4PW8A 3AECA 4QABA 2KSRA 3UT5E 4CXXA 3PJAJ 3RIUA 4B3TT 4I4TE 2BBHA 3MJXA 5AQNB 3UU3A 4TX5A 5JREA 3LFMA 2D9DA 3WTHA 4IE0A 1WR6A 2NOXA 3PUZF 2FJDA
chains in the Genus database with same CATH topology
3SH1A 4TWDA 3WTOA 2YKSA 5HCJA 3C79A 3C84A 3UQ7A 3U8MA 4QH5A 2LLYA 4ILCA 2X00A 3RHWA 2BYQA 4PIRA 2XNUA 3RI5A 4ZJSA 2M6IA 5TVCA 1OEDE 4ZK1A 2XYTA 3ZKRA 4D01A 2XQ9A 4UM1A 5KZUA 4QACA 3U8KA 3EHZA 2XYSA 4ZK4A 3UU5A 4COFA 4ILAA 5IUXA 2ZJUA 2BJ0A 1OEDB 2BG9A 1UX2A 4A98A 4UY2A 4UM3A 4NZBA 3EI0A 2YN6A 3RQUA 4UM3S 3LSVA 5AFHA 3EAMA 3GUAA 3TLWA 2WN9A 3WTMA 4DBMA 4FRRA 4HQPA 3WIPA 4F8HA 3ZDHA 5J5IA 4BQTA 3UU4A 2PGZA 2YMEA 2XQ8A 5CFBA 1I9BA 5LXBA 2W8GA 2XQ5A 4ZJTA 5J5HA 3RQWA 4TNWA 5L47A 4A97A 1OEDC 2XQ4A 4IL4A 2BYNA 2BYRA 4HFCA 5J0ZA 3WTNA 4LMLA 3ZDGA 4QAAA 2PH9A 3SIOA 3UU6A 3WTIA 2XQ6A 4LMJA 4LMKA 2XNVA 2BG9E 3RIAA 2ZJVA 4ALXA 5JMEA 4NPPA 3JAEA 5HEGA 2BYPA 4AFHA 5L4EA 5AFJA 3SQ6A 2BR8A 3WTLA 5AFMB 3TLVA 1UW6A 4UM3P 5AFNA 2BG9B 3TLTA 4AFTA 5L4HA 5HEOA 3IGQA 4Z90A 3TLSA 2LKGA 2Y7YA 4ILBA 3RIFA 3JADA 3U8NA 4QH1A 5AFKA 4IREA 3U8JA 2WNCA 3P50A 5LG3A 2Y56A 3T4MA 2X00D 2WNLA 4HFIA 5HCMA 2YOEA 4XHEA 2MAWA 2BR7A 4Z91A 2BG9C 4HFBA 5J5FA 4HFDA 5HEUA 2LKHA 2Y57A 4AFGA 2Y58A 4QH4A 4IL9A 5FJVA 5J5GA 3UUBA 1OEDA 5AINA 4HFEA 2BYSA 2XQ7A 2W8FA 4TWHA 3U8LA 4XK9A 2XQ3A 2XQAA 2XZ6A 3WTJA 4TNVA 3UQ4A 3SQ9A 2WNJA 3PEOA 2KSRA 2LM2A 4QABA 5BRXA 5KE4A 3P4WA 2XNTA 2QC1B 2VL0A 4HFHA 5HEHA 5BW2A 4X5TA 5AFMA 5CO5A 2YMDA 3UU8A 3PMZA 1UV6A 4WV9A 4ZR6A 2UZ6A 2WZYA 2Y54A 4ZRUA 4EZ1A 4ZZBA 5HEJA 4BFQA 4TWFA 3TLUA 3UU3A 4ZZCA 5SYOA 4UXUA 3WTHA 3WTKA 5AFLA 4B5DA 2C9TA 3JAFA 2XZ5A 2M6BA 5BP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SH1 A;  4TWD A;  3WTO A;  2YKS A;  5HCJ A;  3C79 A;  3C84 A;  3UQ7 A;  3U8M A;  4QH5 A;  2LLY A;  4ILC A;  2X00 A;  3RHW A;  2BYQ A;  4PIR A;  2XNU A;  3RI5 A;  4ZJS A;  2M6I A;  5TVC A;  1OED E;  4ZK1 A;  2XYT A;  3ZKR A;  4D01 A;  2XQ9 A;  4UM1 A;  5KZU A;  4QAC A;  3U8K A;  3EHZ A;  2XYS A;  4ZK4 A;  3UU5 A;  4COF A;  4ILA A;  5IUX A;  2ZJU A;  2BJ0 A;  1OED B;  2BG9 A;  1UX2 A;  4A98 A;  4UY2 A;  4UM3 A;  4NZB A;  3EI0 A;  2YN6 A;  3RQU A;  4UM3 S;  3LSV A;  5AFH A;  3EAM A;  3GUA A;  3TLW A;  2WN9 A;  3WTM A;  4DBM A;  4FRR A;  4HQP A;  3WIP A;  4F8H A;  3ZDH A;  5J5I A;  4BQT A;  3UU4 A;  2PGZ A;  2YME A;  2XQ8 A;  5CFB A;  1I9B A;  5LXB A;  2W8G A;  2XQ5 A;  4ZJT A;  5J5H A;  3RQW A;  4TNW A;  5L47 A;  4A97 A;  1OED C;  2XQ4 A;  4IL4 A;  2BYN A;  2BYR A;  4HFC A;  5J0Z A;  3WTN A;  4LML A;  3ZDG A;  4QAA A;  2PH9 A;  3SIO A;  3UU6 A;  3WTI A;  2XQ6 A;  4LMJ A;  4LMK A;  2XNV A;  2BG9 E;  3RIA A;  2ZJV A;  4ALX A;  5JME A;  4NPP A;  3JAE A;  5HEG A;  2BYP A;  4AFH A;  5L4E A;  5AFJ A;  3SQ6 A;  2BR8 A;  3WTL A;  5AFM B;  3TLV A;  1UW6 A;  4UM3 P;  5AFN A;  2BG9 B;  3TLT A;  4AFT A;  5L4H A;  5HEO A;  3IGQ A;  4Z90 A;  3TLS A;  2LKG A;  2Y7Y A;  4ILB A;  3RIF A;  3JAD A;  3U8N A;  4QH1 A;  5AFK A;  4IRE A;  3U8J A;  2WNC A;  3P50 A;  5LG3 A;  2Y56 A;  3T4M A;  2X00 D;  2WNL A;  4HFI A;  5HCM A;  2YOE A;  4XHE A;  2MAW A;  2BR7 A;  4Z91 A;  2BG9 C;  4HFB A;  5J5F A;  4HFD A;  5HEU A;  2LKH A;  2Y57 A;  4AFG A;  2Y58 A;  4QH4 A;  4IL9 A;  5FJV A;  5J5G A;  3UUB A;  1OED A;  5AIN A;  4HFE A;  2BYS A;  2XQ7 A;  2W8F A;  4TWH A;  3U8L A;  4XK9 A;  2XQ3 A;  2XQA A;  2XZ6 A;  3WTJ A;  4TNV A;  3UQ4 A;  3SQ9 A;  2WNJ A;  3PEO A;  2KSR A;  2LM2 A;  4QAB A;  5BRX A;  5KE4 A;  3P4W A;  2XNT A;  2QC1 B;  2VL0 A;  4HFH A;  5HEH A;  5BW2 A;  4X5T A;  5AFM A;  5CO5 A;  2YMD A;  3UU8 A;  3PMZ A;  1UV6 A;  4WV9 A;  4ZR6 A;  2UZ6 A;  2WZY A;  2Y54 A;  4ZRU A;  4EZ1 A;  4ZZB A;  5HEJ A;  4BFQ A;  4TWF A;  3TLU A;  3UU3 A;  4ZZC A;  5SYO A;  4UXU A;  3WTH A;  3WTK A;  5AFL A;  4B5D A;  2C9T A;  3JAF A;  2XZ5 A;  2M6B A;  5BP0 A; 
#chains in the Genus database with same CATH topology
 5LGN B;  2XTL A;  4F6R C;  2BKO A;  4ZJS A;  4EED A;  1W9R A;  2XYT A;  3ZT5 A;  1WRD A;  3U8K A;  2V5C A;  4EYU A;  2CHO A;  5KDM C;  3ZCJ A;  2UXX B;  5JDN A;  5LGT B;  4AKH A;  1AJ3 A;  3PUR A;  3ZDH A;  2D0U A;  2KND A;  5J5H A;  3E22 E;  4CXY A;  4P1N A;  2CBJ A;  4K0K T;  4X64 T;  5J0Z A;  1XNR T;  3K8P C;  4QAA A;  1HFA A;  3ZSS A;  5J2T E;  3L39 A;  4NPP A;  4UIG A;  5JRC B;  3P4S A;  1B7T A;  3K3O A;  4C91 A;  2JPF A;  4O4H E;  3TLT A;  4AFT A;  3OTO T;  4JI2 T;  2W00 A;  1V9D A;  2ODU A;  4EOZ B;  3SOL A;  4P09 A;  4EYY R;  2CLY B;  1T7S A;  2LT3 A;  2CCQ A;  5AIN A;  4XK9 A;  1CHU A;  2HN1 A;  3SQ9 A;  3T8O A;  4WBN E;  4X5T A;  5F8P A;  5AQO B;  1YXR A;  2H7V C;  3LK3 B;  2J1D G;  5IYZ E;  3KVB A;  3ZLI A;  4PK4 A;  5FMN A;  3HA4 A;  2MOZ A;  4U2Z A;  3C4W A;  3EDU A;  3B13 A;  3GMI A;  4ZK4 A;  4ILA A;  2BJ0 A;  5ABF A;  2NTX A;  1NAF A;  4I55 E;  4GIW A;  4XAX B;  3BK9 A;  2HHH T;  2CMR A;  3Q5E A;  5JDF A;  5CA0 E;  2E9X C;  2K24 A;  3QNU A;  1WCR A;  2Q9Q C;  5LMN T;  4JI4 T;  2N9D A;  3ZYL A;  1EZ3 A;  2E9X B;  4LML A;  4UF0 A;  2Q9Q B;  2G0U A;  2JQQ A;  1T72 A;  3KVA A;  4ALX A;  4DBR A;  3L8R A;  3HKE E;  5AFJ A;  3ZYK A;  4L9I A;  2DLR A;  3O1J A;  2Z6E A;  4EXT A;  2QGS A;  2R6G F;  4EB6 E;  3LK4 2;  3T1H T;  4IIJ E;  5HEU A;  2LJL A;  2Y58 A;  2OLT A;  2ZM8 A;  4B3R T;  4I50 E;  1FMV A;  1IAP A;  1J5W A;  1NEK A;  3AVS A;  2BDE A;  4TWH A;  1MMA A;  4TNV A;  3UQ4 A;  3N2K E;  5KE4 A;  5BW2 A;  5CO5 A;  4Z8X A;  5TAO A;  4O2A E;  5LYJ E;  1JNR A;  2E8I A;  4FJO A;  3RPU A;  5FYM A;  1LKX A;  2VKD A;  1N32 T;  4QHO A;  3AA6 B;  3SH1 A;  1Z8U A;  3UQ7 A;  3AAI A;  4ZK1 A;  4O4L E;  4P0A A;  5C2T A;  5JRC A;  4OHF A;  1IBL T;  2LRK A;  1YKH B;  3ZPO A;  2WP9 A;  2YIN A;  5LNK A;  2V6X A;  5AQI B;  3RF1 A;  4YTN A;  2X0H A;  2XQ5 A;  1ZEE A;  4EV6 A;  3N2G E;  1KNP A;  2BG9 E;  3FXE B;  2XAG B;  4AFH A;  3UUX B;  2VKH A;  5LHI B;  1XWM A;  2LOP A;  2W4X A;  2W62 A;  3EUH A;  3H3A A;  1MIV A;  3CX7 B;  4JYA T;  3U8J A;  2ZLY A;  2Y56 A;  2LOS A;  3OKQ A;  4HFI A;  3ZC1 A;  3IF8 B;  3MKD A;  4EIW A;  5JDM A;  2EHO D;  2E2A A;  3WI3 A;  5J5F A;  2GK9 A;  5L3D B;  3E0Z A;  3HL6 A;  4IDP A;  1BR0 A;  3AEA A;  1HG5 A;  3ZMZ B;  4UV8 B;  4X20 E;  4HFV A;  2XAS B;  3GN5 B;  2XY8 B;  2CWO A;  3RRW A;  3I9W A;  5ABH A;  3RRC A;  1D0Z A;  3ZJ2 A;  2QVA A;  5M4Y A;  2BS3 A;  2VUR A;  1KNZ A;  4AKG A;  4J2C A;  3F2E A;  2UXB T;  4OYK A;  4U74 A;  3AAA B;  3ZMS B;  2BYQ A;  5A1L A;  3PUQ A;  3ZKR A;  3FZK B;  4PJM A;  1HR0 T;  4PJL A;  3V5U A;  2MYS A;  3X1D A;  3O9X A;  3N9M A;  3WIP A;  1U5P A;  2X68 A;  3SFE A;  4AQY T;  5AQF B;  2NW8 A;  2X0L B;  4A97 A;  4DR1 T;  5LA6 E;  5JDH A;  4G63 A;  2YK0 A;  3JAE A;  3LBX B;  4ZI3 D;  1T8B A;  2NTY A;  4ZXL A;  2K48 A;  4ILB A;  2YU2 A;  5LG4 A;  2XM1 A;  3ZJ1 A;  5FKY A;  1XMO T;  1D1C A;  4NIQ A;  3T4M A;  2WNL A;  3N9Q A;  5DQW A;  1E1H B;  4AIS A;  2Y57 A;  3SFD A;  5F5W A;  3U78 A;  2NR4 A;  3J9X 1;  4LF5 T;  4UEM A;  2WDR A;  2IDO B;  2ZM6 T;  1VCT A;  3FZL B;  3M3Z B;  4JV5 T;  3J7Y q;  1BR1 A;  5LP6 E;  2JJ9 A;  3T1Y T;  2BKN A;  2PFV A;  2X51 A;  3WTO A;  4H63 H;  4DV5 T;  2X00 A;  4AXP A;  3OYX A;  2LSY A;  4D01 A;  4ZS2 A;  3C64 A;  4LFA T;  1OED B;  1UX2 A;  3EI0 A;  2YN6 A;  4JI1 T;  4EZ4 A;  1E2A A;  4FRR A;  2CHN A;  3N9N A;  2X9X A;  3KDS E;  2WWV A;  3BQK A;  5LXB A;  4ZJT A;  4DV7 T;  3RQW A;  3IBP A;  3PUG A;  2XQ4 A;  3A5X A;  3LK2 B;  2KWI B;  2VWA A;  3PUA A;  4MFR A;  3OJA A;  3AAE B;  2QA7 A;  3GN5 A;  2VAS A;  3KFW X;  4H9S E;  5AQM B;  4DV3 T;  2ACX A;  5JDG A;  5LJM A;  2VVN A;  4DV0 T;  4UXN B;  3ANW B;  3AVR A;  2LRL A;  1XNQ T;  3H37 A;  2WNC A;  3WAJ A;  4JEU B;  4KI0 F;  1HNW T;  3FZM B;  2VVS A;  4MHC A;  1KEY A;  1ZKE A;  2UUC T;  3VRA A;  4YLH A;  4JLE A;  2D2S A;  3QC9 A;  4ERR A;  3L3P A;  5HAX A;  5H6R B;  1MNE A;  3B57 A;  1Y01 A;  4HN9 A;  2XAH B;  5ETW A;  2QC1 B;  5HEH A;  1CUN A;  4BAY B;  1BR4 A;  4ZRU A;  4AKI A;  4EZ1 A;  5AQU B;  5AQL B;  4BFQ A;  4ZI2 D;  4UXU A;  4KBM B;  4UF0 B;  2V6Y B;  2B1E A;  4PK5 A;  2L9Q A;  2XAJ B;  5TVC A;  5LCY A;  3NKZ A;  2V5D A;  3LBX A;  2V8S V;  4KP3 C;  2XPK A;  4YJ3 E;  2UUB T;  2W67 A;  4UM3 A;  1HX1 B;  5EK3 A;  3KBT A;  3N9P A;  5LBM A;  3HKD E;  1HNZ T;  2H3R A;  5DAB A;  5CA1 E;  4QX7 B;  5L3E B;  3BQL A;  2FBW A;  5L2L A;  3OBV E;  5FL0 A;  3DTO A;  3NBX X;  2KXP B;  2CBI A;  2VQE T;  2LEH A;  2ZM2 A;  5L4E A;  4IGU A;  3LDQ B;  4LF8 T;  4EEB A;  4AKL A;  4Z90 A;  5FXW A;  3U8N A;  4IST A;  4AQG A;  4C90 A;  1O3X A;  4DR4 T;  3ETV A;  4XBF B;  5LBQ B;  4WZX A;  1YQ4 A;  1OWA A;  2JQK A;  2FJB A;  5L3F B;  5HYA A;  3I0O A;  1BR2 A;  3PV0 F;  2IIU A;  1OED A;  2JRK A;  4M1P A;  3WTJ A;  4X62 T;  2CLY C;  2FJE A;  4PJN A;  4E7S A;  3WAK A;  4WV9 A;  2UZ6 A;  5HXE A;  4ZZB A;  4TV8 E;  3RH3 A;  4CI2 B;  3GA8 A;  4AIU A;  2X67 A;  2XAQ B;  4HKA A;  5EK2 A;  3ZMV B;  4O2B E;  1D0X A;  4QAC A;  3EAB A;  2D5U A;  2NP9 A;  3PUX F;  3VR8 A;  4A98 A;  4UVB B;  2BVM A;  4NZB A;  3RQU A;  4ISS A;  2PBI A;  3GUA A;  3ANW A;  4DBM A;  2VB6 A;  4LF9 T;  4YTM A;  1I9B A;  4ASK A;  4IE6 A;  4IDZ A;  2X9W A;  4BJM A;  4H63 V;  4CXW A;  5JVD E;  4YHJ A;  3RYC E;  2XNV A;  2LE8 A;  3RIA A;  4E7Z A;  3SQ6 A;  3AA0 B;  3FZF B;  5FXX A;  5LXT E;  2W0G A;  3EDV A;  2IUB A;  3PJA A;  2DWG A;  2WU2 A;  3I1A A;  4X66 T;  2V6Y A;  3PUS A;  2I59 A;  4XHE A;  3R84 B;  2WU5 A;  2KZ7 B;  4CQI A;  4DR7 T;  2FJA A;  5IWA T;  3RC3 A;  5BRX A;  3P4W A;  3C98 B;  3ZCI A;  4OYJ A;  4DV6 T;  2CPT A;  5H6Q B;  2DWK A;  4JI7 T;  2C9T A;  2CE7 A;  5HXS A;  4HWH A;  2V7J A;  1W09 A;  5HXC A;  4QH5 A;  2V7I A;  2XNU A;  2M6I A;  5CB4 E;  2XQ9 A;  3GWH A;  3IEE A;  4H9N C;  5AQV B;  2XYS A;  1UCU A;  4UY2 A;  1NEN A;  5JR9 B;  2ES0 A;  3TLW A;  3QOF A;  3W15 B;  1D1A A;  4IT4 A;  2KMF A;  2XQ8 A;  1YQ3 A;  4A5X A;  1I6Z A;  3FXD B;  4IL4 A;  5L3B B;  2WM9 A;  1I94 T;  3ZDG A;  2DL1 A;  1WYB A;  5BMV E;  4U7Y A;  4DVD A;  3A8Y C;  4LMK A;  1MMN A;  4KHP T;  2ZJV A;  2BBJ A;  2YDQ A;  2CM0 A;  4DR3 T;  3PUW F;  3D0T A;  4DBQ A;  5HXH A;  3NRY A;  4G2A A;  5L4H A;  5HEO A;  4CI3 B;  2QYW A;  4ILU A;  2JMK A;  4UVA B;  2LHN A;  3OVU A;  3DP7 A;  3O1H A;  4DUY T;  2LKH A;  4AFG A;  1XZY A;  3JC6 D;  4GK0 E;  3CIR A;  5FJV A;  5J5G A;  3FBZ A;  3P7I A;  3UUN A;  2UUA T;  1R8I A;  1UX4 A;  5EZY E;  1UUS A;  4Q25 A;  2J62 A;  3Q2M A;  5AQT B;  1UV6 A;  5AQP B;  4ZR6 A;  2Y54 A;  2WDQ A;  2V1D B;  4ZZC A;  2CXD A;  2VK9 A;  1YW0 A;  4TN7 B;  3ZN1 B;  5LHH B;  3F57 A;  3KV5 A;  2EHO A;  3EHZ A;  3CX8 B;  3FHN A;  1IZN B;  4COF A;  1ZP0 A;  2A9U A;  4P0B A;  3QB5 K;  3WTM A;  4H9R C;  2WCA A;  2WS3 A;  2L8K A;  1UUR A;  5CFB A;  2WAU A;  3G06 A;  2E5L T;  5IHY A;  1QLB A;  3AA7 B;  2BYN A;  4HFC A;  1KNR A;  5E0O A;  3WTI A;  4HE8 A;  4ZEY A;  1JNZ A;  2WWU A;  2LM9 A;  4HEA A;  4JEH B;  3IGQ A;  4MBQ A;  1KK7 A;  3P50 A;  4ZI2 C;  2BR7 A;  1J1J A;  2V7M A;  4JI6 T;  3C4Z A;  4TZ4 C;  2C5I T;  3N9L A;  3ZN0 B;  1D1B A;  4QWN B;  3U8L A;  5JR9 A;  5FY1 A;  5LOV E;  4NXM T;  4DMW A;  2LM2 A;  1HG2 A;  4HFH A;  3VU7 H;  3K3N A;  4QXC B;  3FBL A;  2CRB A;  5AFL A;  2LSG A;  3AE9 A;  2LSJ A;  2ZM0 A;  5JDL A;  3CQC B;  2VL8 A;  5ABG A;  3AEB A;  3PU3 A;  3P4R A;  1U4Q A;  2HPJ A;  2W66 A;  4BJN A;  4YY3 T;  1HNX T;  2UU9 T;  1FMW A;  2X0Y A;  3AE7 A;  2WDV A;  5L3C B;  1OED C;  4KX6 A;  2LSI A;  5LMU T;  5AQR B;  3UU6 A;  4EZH A;  4GKK T;  2VQF T;  2WY2 A;  1L0V A;  1MND A;  4LF6 T;  5HXR A;  1UX5 A;  2BG9 B;  3ZST A;  3OPC A;  1XDO A;  4BA9 A;  3MXZ A;  1YKE B;  3HKB E;  2YDR A;  4X1Y E;  4IRE A;  3LJC A;  3BQI A;  4LF4 T;  3M65 A;  4KUM B;  3CVR A;  4LFC T;  2ODV A;  2IC6 A;  4B6X A;  4IDO A;  2XSB A;  3MAC A;  5EK4 A;  3FZH B;  3K3Q C;  2XNT A;  1X9B A;  4DR2 T;  5AFM A;  5LHG B;  2B76 A;  4CI1 B;  1NWM X;  3SS1 A;  5F3J A;  2WZY A;  3AED A;  4ZOL E;  2IML A;  2VKO A;  3KV4 A;  1SA0 E;  4UEL A;  1X79 A;  4TWD A;  4IE7 A;  1S94 A;  3N9O A;  4ILC A;  3V5S A;  5CJ5 A;  4U7I A;  4HGA A;  4DND A;  4JI0 T;  3MK7 C;  5FNV E;  1IBK T;  2ZJU A;  5KX5 E;  3AE8 A;  3IHR A;  3RKO A;  4MLK A;  4F8H A;  2UXD T;  4BQT A;  1ZV4 X;  1N33 T;  2RA1 A;  2PGZ A;  4O4J E;  4U3C A;  3OYZ A;  2XQY A;  3E08 A;  2Y8D A;  4IE5 A;  3RC8 A;  4U31 A;  2PH9 A;  2CXF A;  3UUM A;  2FUP A;  3HI2 A;  4KHZ F;  4LMJ A;  2NWB A;  5AFU L;  2JQH A;  1G73 A;  2C5J A;  2KT9 A;  2BKP A;  3DJB A;  2DHR A;  4H9Q C;  3SRZ A;  3P8C D;  5JDQ A;  2LKG A;  5J1G A;  3AEE A;  1QUU A;  4HWI B;  2HN2 A;  5GON E;  3F31 A;  5AQS B;  2XSA A;  3NVO A;  2I0M A;  5C3J A;  3AEG A;  2K9A A;  4JI3 T;  5BR8 T;  2A3D A;  4DV4 T;  4DMV A;  1IBM T;  3PU8 A;  3MZK B;  5FXZ A;  4YSX A;  4IE4 A;  2K5B B;  4UV9 B;  4H9O C;  4DUZ T;  5FVL A;  2SPC A;  2MBG A;  1MMD A;  2MPK A;  1G8X A;  2P9B A;  5FVK A;  2H89 A;  1WR0 A;  3U8M A;  1T98 A;  4LF7 T;  3R6N A;  4YTP A;  2L3L A;  1LVF A;  2YU1 A;  2BG9 A;  5JH7 E;  1QSD A;  2WB5 A;  1US7 B;  2LSK A;  1VCS A;  1IJ6 A;  2C0S A;  5KMG P;  2YDS A;  3UU4 A;  4I43 B;  1D0Y A;  3O4X E;  3Q5X A;  3ZT7 A;  3NRX A;  2BZB A;  3S4U A;  4OFZ A;  4B3S T;  4DO0 A;  2KIN B;  4CN1 A;  2LHR A;  4WNK A;  1VOM A;  2CXL A;  3Q5W A;  3JC6 C;  5C8Y E;  2E5V A;  2PG8 A;  4YT0 A;  5DQV A;  4OK0 A;  2K3W A;  3B5M A;  3TLV A;  1UW6 A;  1IJ5 A;  3TLS A;  2A72 A;  4NUU A;  1W0B A;  3AXJ B;  5AQQ B;  4YHH T;  2XAF B;  2WQY A;  2EHO C;  1MIY A;  2JIW A;  3VKG A;  2YEV C;  3AE3 A;  3C50 A;  3CK6 A;  4HFB A;  5FP3 A;  2EHO B;  5L3G B;  3RLF F;  4PJJ A;  4WBO A;  2XQ7 A;  4KMC A;  2XQ3 A;  2XQA A;  3Q9D A;  4O4I E;  4L5G A;  4L0R A;  4DV2 T;  4XZC A;  2YMD A;  4IHJ E;  5LB7 B;  3WTK A;  2OV9 A;  5AQJ B;  2WZH A;  3JAF A;  2XZ5 A;  4B5D A;  1WLX A;  4ZS3 A;  3C79 A;  3C84 A;  2ACZ A;  3RHW A;  3CML A;  3JCF A;  1XDP A;  3C4X A;  4QXH B;  4WW0 A;  5AQH B;  4ADZ A;  5KZU A;  2CEA A;  4CN6 A;  2RP4 A;  1S35 A;  1N36 T;  4ZHQ E;  3NZQ A;  4UM3 S;  4HTE A;  1OXZ A;  2WN9 A;  5J5I A;  3RGL A;  5FL1 A;  3P4P A;  2WMN A;  3ZT6 A;  1E7P A;  4GK5 E;  5KXJ A;  5FY0 A;  1FEW A;  3ONL C;  5JR9 C;  3WTN A;  4GYS A;  3NZP A;  4QXB B;  1SUM B;  4ZI3 C;  2XHE B;  4DR5 T;  2MTQ A;  5AQK B;  3Q5D A;  4AQF C;  3ETU A;  3CQG B;  2Y7Y A;  4GKJ T;  5ABE A;  4O8S A;  4GYR A;  5FY7 A;  4U33 A;  5LG3 A;  2JQ9 A;  4H9P C;  3QUJ A;  2AE9 A;  2YOE A;  3ESL A;  2V7K A;  4JBW F;  3AE4 A;  1ZHC A;  4CZZ B;  4HFD A;  1SHZ C;  5ADX L;  1ZOY A;  3AA1 B;  5DJQ C;  4LFB T;  3RYH E;  4X65 T;  2HH7 A;  1WYC A;  3PEO A;  2RPA A;  1MMG A;  2X66 A;  5LJN A;  5AQG B;  2F4V T;  2Y6X A;  2N2N A;  2J4G A;  3UU8 A;  3PMZ A;  3L09 A;  5HEJ A;  4TWF A;  5SYO A;  3PUY F;  3N5L A;  5BP0 A;  2IW5 B;  2JMH A;  3KV9 A;  4PIR A;  3AE1 A;  1OED E;  2BVL A;  1LRZ A;  2V26 A;  3CPZ A;  4EAH A;  2DCF A;  4YSY A;  1N34 T;  2X9Y A;  5IUX A;  4DV1 T;  3LSV A;  3EAM A;  2IHR 1;  2C5K T;  2IAK A;  3AXJ A;  2VKJ A;  3I9Y A;  2WMO A;  2YME A;  4NUV A;  2J47 A;  5L47 A;  5LGU B;  3CWZ B;  3CX6 B;  4YJ2 E;  2V7L A;  5FXV A;  2DI4 A;  3ONX A;  4CN4 A;  3UFG A;  4OX9 T;  1UK5 A;  2H7O A;  4AI6 A;  3CKD A;  5HEG A;  3PUV F;  4QX8 B;  3KIN B;  3UTK A;  2BR8 A;  1SE7 A;  5AFM B;  5AFN A;  4UM3 P;  2XZE A;  1HTJ F;  2E9X D;  1DU2 A;  3PTR B;  2WZI A;  4ANJ A;  4V1A v;  2Q9Q D;  4PFP A;  5J2U E;  2NW9 A;  2E9X A;  2PTF A;  2W2U A;  3P4Q A;  4I0U A;  2Q9Q A;  3UUB A;  2W8F A;  2BYS A;  2XZ6 A;  4YSZ A;  2WNJ A;  3H3M A;  2VL0 A;  4UVC B;  2XUE A;  1FJG T;  2KWH A;  4FI5 A;  3TLU A;  2IC9 A;  3PDY A;  2LLY A;  3RI5 A;  2XJ7 A;  5HWX A;  2UXN B;  1HCI A;  3UU5 A;  5HWY A;  1Z0P A;  3RIU C;  3KBU A;  5AFH A;  4HQP A;  3IA3 A;  3AE6 A;  4UR9 A;  2WSS V;  4AQF A;  1GQE A;  4EGW A;  2OA5 A;  4A56 A;  4TNW A;  1W0A A;  3A7M A;  3UUL A;  3CQX C;  3QB5 A;  2PJQ A;  4JI5 T;  4U72 A;  5CGM A;  2BS4 A;  4K0U A;  3SIO A;  1H7C A;  1FIO A;  4IDQ A;  5JME A;  1M62 A;  3RYI E;  2BYP A;  3SWH A;  1YD8 G;  3AE5 A;  4WYV A;  2CA5 A;  3VR9 A;  3TKL B;  3VHL A;  3N2O A;  2XM2 A;  3EVY A;  3ZC0 A;  4JUY A;  2X00 D;  3ZMU B;  4B3M T;  2D0T A;  2X9H A;  2MAW A;  4Z91 A;  2BG9 C;  4NXN T;  4AKR B;  2W61 A;  3MA9 A;  3C51 A;  3ZEF B;  4QH4 A;  2UXC T;  2NW7 A;  4HFE A;  2N1G A;  2H88 A;  4PFO A;  3I0Q A;  2BS2 A;  3AE2 A;  3U3I A;  1LVK A;  1J5E T;  3O1I A;  4MAL A;  1HS7 A;  4HWF A;  4PK6 A;  4DID B;  2M67 A;  2M6B A;  1KFY A;  3HR0 A;  2YKS A;  3LG7 A;  5HCJ A;  4YXD A;  4TUY E;  2W63 A;  1XMQ T;  4UM1 A;  4X1K E;  2A2F X;  4PNI A;  3KV6 A;  4HWD A;  3FB2 A;  2KLQ A;  4U2Y A;  2I6H A;  3ABV A;  3RX6 A;  1HF8 A;  3RYF E;  4ZI7 E;  3ZMT B;  5JTG A;  3RKG A;  3AB3 B;  4QKN A;  2W8G A;  4PAG A;  3VRB A;  2QRX A;  1HX8 A;  2BYR A;  4X1I E;  4TV9 E;  2XQ6 A;  4HWC A;  1Y64 B;  2WBL A;  1UGO A;  3WTL A;  2CWY A;  4JI8 T;  4DR6 T;  5ABF B;  3RIF A;  3JAD A;  4QH1 A;  2HPL A;  1M7K A;  5AFK A;  2ZMA A;  1WFD A;  3AEF A;  1MIW A;  3ONJ A;  1KF6 A;  3ZYM A;  4IDN A;  5HCM A;  3VKH A;  4GOU A;  3UFE A;  4YFS A;  2Y48 B;  4N78 D;  3PE0 A;  3K1S A;  2DNX A;  4IL9 A;  3HKC E;  3QK6 A;  2AXD S;  3NWI A;  5JQG E;  1VRB A;  4PW8 A;  3AEC A;  4QAB A;  2KSR A;  3UT5 E;  4CXX A;  3PJA J;  3RIU A;  4B3T T;  4I4T E;  2BBH A;  3MJX A;  5AQN B;  3UU3 A;  4TX5 A;  5JRE A;  3LFM A;  2D9D A;  3WTH A;  4IE0 A;  1WR6 A;  2NOX A;  3PUZ F;  2FJD A; 
#chains in the Genus database with same CATH homology
 3SH1 A;  4TWD A;  3WTO A;  2YKS A;  5HCJ A;  3C79 A;  3C84 A;  3UQ7 A;  3U8M A;  4QH5 A;  2LLY A;  4ILC A;  2X00 A;  3RHW A;  2BYQ A;  4PIR A;  2XNU A;  3RI5 A;  4ZJS A;  2M6I A;  5TVC A;  1OED E;  4ZK1 A;  2XYT A;  3ZKR A;  4D01 A;  2XQ9 A;  4UM1 A;  5KZU A;  4QAC A;  3U8K A;  3EHZ A;  2XYS A;  4ZK4 A;  3UU5 A;  4COF A;  4ILA A;  5IUX A;  2ZJU A;  2BJ0 A;  1OED B;  2BG9 A;  1UX2 A;  4A98 A;  4UY2 A;  4UM3 A;  4NZB A;  3EI0 A;  2YN6 A;  3RQU A;  4UM3 S;  3LSV A;  5AFH A;  3EAM A;  3GUA A;  3TLW A;  2WN9 A;  3WTM A;  4DBM A;  4FRR A;  4HQP A;  3WIP A;  4F8H A;  3ZDH A;  5J5I A;  4BQT A;  3UU4 A;  2PGZ A;  2YME A;  2XQ8 A;  5CFB A;  1I9B A;  5LXB A;  2W8G A;  2XQ5 A;  4ZJT A;  5J5H A;  3RQW A;  4TNW A;  5L47 A;  4A97 A;  1OED C;  2XQ4 A;  4IL4 A;  2BYN A;  2BYR A;  4HFC A;  5J0Z A;  3WTN A;  4LML A;  3ZDG A;  4QAA A;  2PH9 A;  3SIO A;  3UU6 A;  3WTI A;  2XQ6 A;  4LMJ A;  4LMK A;  2XNV A;  2BG9 E;  3RIA A;  2ZJV A;  4ALX A;  5JME A;  4NPP A;  3JAE A;  5HEG A;  2BYP A;  4AFH A;  5L4E A;  5AFJ A;  3SQ6 A;  2BR8 A;  3WTL A;  5AFM B;  3TLV A;  1UW6 A;  4UM3 P;  5AFN A;  2BG9 B;  3TLT A;  4AFT A;  5L4H A;  5HEO A;  3IGQ A;  4Z90 A;  3TLS A;  2LKG A;  2Y7Y A;  4ILB A;  3RIF A;  3JAD A;  3U8N A;  4QH1 A;  5AFK A;  4IRE A;  3U8J A;  2WNC A;  3P50 A;  5LG3 A;  2Y56 A;  3T4M A;  2X00 D;  2WNL A;  4HFI A;  5HCM A;  2YOE A;  4XHE A;  2MAW A;  2BR7 A;  4Z91 A;  2BG9 C;  4HFB A;  5J5F A;  4HFD A;  5HEU A;  2LKH A;  2Y57 A;  4AFG A;  2Y58 A;  4QH4 A;  4IL9 A;  5FJV A;  5J5G A;  3UUB A;  1OED A;  5AIN A;  4HFE A;  2BYS A;  2XQ7 A;  2W8F A;  4TWH A;  3U8L A;  4XK9 A;  2XQ3 A;  2XQA A;  2XZ6 A;  3WTJ A;  4TNV A;  3UQ4 A;  3SQ9 A;  2WNJ A;  3PEO A;  2KSR A;  2LM2 A;  4QAB A;  5BRX A;  5KE4 A;  3P4W A;  2XNT A;  2QC1 B;  2VL0 A;  4HFH A;  5HEH A;  5BW2 A;  4X5T A;  5AFM A;  5CO5 A;  2YMD A;  3UU8 A;  3PMZ A;  1UV6 A;  4WV9 A;  4ZR6 A;  2UZ6 A;  2WZY A;  2Y54 A;  4ZRU A;  4EZ1 A;  4ZZB A;  5HEJ A;  4BFQ A;  4TWF A;  3TLU A;  3UU3 A;  4ZZC A;  5SYO A;  4UXU A;  3WTH A;  3WTK A;  5AFL A;  4B5D A;  2C9T A;  3JAF A;  2XZ5 A;  2M6B A;  5BP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...