3TLUA

The glic pentameric ligand-gated ion channel loop2-24' oxidized mutant in a locally-closed conformation (lc1 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPCTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tluA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tluA01
4ILCA 2WNLA 2XYTA 4UM1A 4XK9A 5TVCA 4ZK1A 2XNUA 2WZYA 4LMKA 4ILBA 3WTJA 4D01A 5J0ZA 5LXBA 4TWDA 3UUBA 1UW6A 3WTMA 2XYSA 4WV9A 4UM3A 2BR7A 3WTOA 2Y7YA 4HFDA 4QH1A 2QC1B 2Y54A 2YMDA 5KZUA 2M6BA 2XQ8A 3SIOA 4TNVA 5J5HA 3PMZA 4QABA 5KE4A 3EAMA 2LKGA 4LMLA 2BYRA 2BR8A 2ZJUA 2BG9C 5BP0A 3TLWA 3UU6A 3JADA 3TLUA 3P50A 2YOEA 1OEDB 2Y58A 3U8LA 4IL4A 1UV6A 3EHZA 4B5DA 4UM3S 4ZZBA 5J5IA 4BQTA 2XQAA 2XQ4A 2X00D 2YMEA 4QH5A 4A97A 4HFHA 2WNJA 2BYSA 4QAAA 4QACA 3ZDHA 2KSRA 1OEDA 4HFIA 4IREA 3UU8A 1OEDE 5HEHA 2BG9A 4HFBA 5CO5A 2ZJVA 3U8JA 2BYPA 3ZKRA 3LSVA 4AFTA 5AFJA 4DBMA 4NZBA 5L4HA 2C9TA 5LG3A 3JAFA 4QH4A 3UQ7A 5AINA 3WIPA 3PEOA 2PGZA 4UXUA 3WTNA 3U8KA 2XZ6A 5AFLA 3UU5A 2BYNA 3JAEA 4NPPA 4ALXA 4Z90A 2XQ9A 2BG9B 5SYOA 4AFGA 4TNWA 3UU4A 4PIRA 4HQPA 3UU3A 3ZDGA 4ILAA 5HCJA 5AFKA 4TWHA 3T4MA 2VL0A 5HEGA 3C79A 2WN9A 5FJVA 3SQ6A 2BJ0A 2W8GA 4X5TA 2WNCA 4TWFA 2XQ3A 3U8MA 2MAWA 5HEOA 2XQ6A 3RHWA 5HCMA 5L4EA 3TLTA 4ZZCA 2M6IA 3TLSA 4UY2A 4FRRA 2Y57A 2BG9E 2YN6A 4A98A 5HEJA 5AFMA 4ZJTA 3P4WA 4LMJA 3RIFA 3WTLA 4IL9A 3C84A 3GUAA 4AFHA 3WTKA 2XZ5A 2YKSA 1UX2A 5CFBA 3UQ4A 3IGQA 5BRXA 4ZJSA 2XNVA 4UM3P 5L47A 2BYQA 4XHEA 4ZK4A 2UZ6A 2LKHA 4COFA 2XQ5A 3TLVA 3RQUA 5J5GA 2X00A 4ZR6A 4EZ1A 4BFQA 3SQ9A 2Y56A 5AFMB 4ZRUA 3RQWA 1I9BA 5AFHA 4HFCA 4HFEA 1OEDC 5HEUA 3SH1A 5J5FA 3WTIA 4Z91A 2PH9A 2XQ7A 3WTHA 2W8FA 4F8HA 5AFNA 2LM2A 3RI5A 3RIAA 2LLYA 3U8NA 2XNTA 5JMEA 5IUXA 5BW2A 3EI0A
chains in the Genus database with same CATH superfamily
2WZHA 3PJAA 3G06A 4DMVA 5LXBA 2CHOA 2H7VC 3AA0B 1W0BA 3KINB 2YDSA 2HHHT 2N9DA 4QXCB 4KHZF 1ZP0A 4OX9T 3VHLA 1OXZA 1UV6A 2Q9QD 4B5DA 3OPCA 3ZYMA 4KMCA 5DJQC 3Q2MA 2YMEA 5H6RB 4JUYA 2BKPA 1HX1B 2YDRA 1MNDA 5J2UE 4X20E 4O4IE 5FMNA 4F6RC 1T8BA 2LJLA 5HXCA 2XTLA 3N9LA 5AINA 2PGZA 3OVUA 5JREA 1OWAA 3UTKA 2BG9B 2LSJA 4YTNA 4NIQA 1SHZC 2K3WA 5FJVA 3SQ6A 3U8MA 2V7IA 2MAWA 2WY2A 2XQ6A 3RHWA 5LGNB 3ABVA 1J5ET 2AXDS 2ZM8A 4CXWA 1NEKA 4EYYR 3T8OA 3HKBE 3C4ZA 2Q9QA 2WQYA 2WSSV 2JQHA 2BS3A 2KWIB 4U31A 4ZK4A 4GKKT 3RQWA 3RYCE 3AEEA 5J5FA 5FXWA 4XBFB 1Y64B 3ANWA 2J62A 2B1EA 2XNUA 1FMWA 4WV9A 2WBLA 4QHOA 3AEFA 4JEUB 4OYKA 2N1GA 5LBMA 2D2SA 2PTFA 4AKIA 3PUVF 4MFRA 3EDUA 4LFBT 2Y48B 3BQLA 3P50A 2F4VT 3SS1A 5JTGA 2UXXB 3ZC1A 4BQTA 3HKCE 4U2YA 2LHNA 2QYWA 4K0KT 2CWOA 3RC3A 2V5DA 4A97A 4TV9E 3RH3A 2VASA 2NOXA 1OEDE 5ABEA 2FJAA 5CO5A 2X66A 2VQFT 4QH4A 4QX7B 1UX5A 2ACXA 5H6QB 1E2AA 3T1YT 4JI4T 2BVMA 3ZDGA 4J2CA 2I0MA 4UIGA 3AEDA 2E2AA 1MNEA 4X62T 5FY1A 5EK2A 3MZKB 2YN6A 3UFEA 3ZMUB 2VKDA 3L09A 3BQKA 2V6YB 3KBUA 1QSDA 4ISTA 3I0OA 3P4PA 3K3NA 3AAAB 1B7TA 2J1DG 5ABGA 3ZC0A 2XNTA 2J4GA 5FXZA 4ZXLA 4LF9T 3A7MA 2UUAT 2Y8DA 4QH1A 2M6BA 5EK4A 4DO0A 3CX6B 5L3CB 4LF5T 4DMWA 2E8IA 5L3DB 4IE6A 4UELA 2FBWA 4AXPA 2ZM0A 4O2AE 2CA5A 5AQUB 3VRBA 3VU7H 2H3RA 2JPFA 4OHFA 5LA6E 1BR4A 4CXXA 3KV5A 5BMVE 3SFEA 3AE3A 2CXDA 3UFGA 5FXXA 3KVAA 1MIYA 4DR3T 3FZKB 4EZHA 2D0UA 4DR7T 1UX4A 3O1IA 5LG4A 4EEBA 3HKEE 5JDQA 3PUYF 1J1JA 2WCAA 2BJ0A 3ZEFB 4AQGA 3AECA 2CXLA 3I9YA 3LG7A 5HEJA 5AFMA 2VL8A 5L3BB 1HF8A 4IDPA 2LOPA 4UR9A 3WAJA 2YKSA 2LSYA 4H9QC 4U74A 4IT4A 4EOZB 1J5WA 4DUYT 1YW0A 2E9XD 3EVYA 2YINA 1KK7A 4F8HA 3AE4A 2LLYA 3AXJA 1D1BA 3DJBA 2JMHA 5ETWA 5GONE 1MMAA 4LMKA 2OV9A 5AQOB 5LHIB 5AQFB 4QXBB 3GMIA 1WR6A 2V26A 4JI3T 2WAUA 2XAGB 4GOUA 5F5WA 2BYRA 2ZJUA 4IL4A 1UK5A 2NR4A 2XJ7A 1GQEA 4ZS3A 4PK5A 2GK9A 3QNUA 2OA5A 2NW9A 4C91A 1D1AA 2BVLA 5HEHA 2ZLYA 2E9XA 4NZBA 4UVAB 2IUBA 1VCTA 4AI6A 3R6NA 4EGWA 2CCQA 4U33A 2XQ9A 4KX6A 4A56A 1W0AA 5HCJA 3PUQA 2WNCA 4TN7B 4U7IA 4AISA 4JLEA 3BQIA 5JR9C 4YSYA 4DV4T 3O1JA 2Y57A 3L8RA 3N9MA 4B3ST 2PJQA 5JRCA 5L3FB 2W4XA 3CX7B 3QK6A 5KXJA 2XM1A 3AA7B 3RC8A 1XDOA 4UXNB 1Z8UA 4IE7A 2UXBT 5AQNB 4X66T 3AE2A 4DV7T 4XK9A 3I1AA 4BJNA 5FYMA 5AQRB 2X9XA 2WS3A 4H9OC 1N34T 4HFDA 2Y54A 2AE9A 4JI8T 2ODUA 2HPLA 5J5HA 3VRAA 2LOSA 3PUWF 4PAGA 4NUVA 3I0QA 3EABA 2LRKA 1N32T 1U5PA 4EAHA 1ZHCA 1BR2A 5AQQB 4ZZBA 1QUUA 2X00D 4ILUA 3C51A 4PFOA 1SE7A 5C2TA 2D0TA 2WWVA 2HH7A 1FEWA 3U8JA 2UXDT 2VWAA 1FMVA 4M1PA 2VKHA 4O4JE 3J9X1 3AA6B 2KINB 2KXPB 3SRZA 1YKEB 5CJ5A 4CZZB 4DV5T 2X51A 4CN6A 1NWMX 4HQPA 2CRBA 3I9WA 4LFCT 3OTOT 4AQYT 3RYIE 2A9UA 2Q9QB 2QGSA 4PJLA 2P9BA 3P4WA 4DUZT 2WWUA 4L9IA 3LBXB 4AKRB 4DV0T 3ANWB 1VRBA 4U7YA 4ISSA 2X00A 3R84B 2Y56A 4YT0A 1OEDC 3SH1A 4Z91A 2XQ7A 3WTHA 4O4LE 4QWNB 3RF1A 3VKHA 5DQWA 2NW7A 4GK5E 2MYSA 5TAOA 3ZLIA 2UXCT 4E7SA 5BR8T 1WFDA 3RKGA 4A5XA 2ODVA 1MMDA 4U3CA 1D0YA 5JDGA 3KV9A 2LEHA 1S35A 3A5XA 3W15B 1IJ6A 2QA7A 3MXZA 3ONLC 5BP0A 4UF0A 3ZCJA 3N2GE 3HA4A 3PUGA 4Q25A 1T98A 3PE0A 2MOZA 3UU8A 2ZMAA 3ZPOA 4EXTA 5LJMA 2WU5A 2LE8A 2X9WA 5J2TE 2BZBA 4IDNA 4GK0E 2VQET 4BA9A 4H63V 5JQGE 4U72A 5AQJB 3PV0F 2K48A 2ZM2A 3UU3A 1H7CA 3WAKA 4YTMA 4I0UA 4WZXA 2LSKA 1HG2A 3ETVA 4QXHB 3KVBA 1VCSA 3B13A 4YHJA 3E0ZA 3ZMZB 2I59A 4DV6T 3L3PA 3QC9A 3RIFA 1EZ3A 5CFBA 4IE0A 4ZJSA 5HXEA 3C98B 2LRLA 4ZR6A 2EHOB 3K1SA 4TZ4C 1VOMA 3ETUA 4HFCA 3FZLB 1M62A 3RIAA 5KMGP 5LXTE 4I4TE 2WNLA 4LF7T 3CPZA 3WTJA 2MBGA 3WTMA 1UW6A 3IEEA 3HI2A 4HE8A 5KZUA 3FXDB 4DR1T 5JDFA 1KEYA 5JR9A 2WMOA 5DABA 2OLTA 2XAFB 3AE9A 3TLUA 3AE6A 2E9XC 3EHZA 4TUYE 5AQMB 4YLHA 5CA1E 1KNRA 4HFHA 2YU1A 3ZMVB 3CWZB 2VKOA 3NRXA 5ABFA 2YU2A 3C4XA 3N2KE 5FP3A 3ZKRA 4WBNE 5AFJA 5LG3A 2JQ9A 3UUXB 3U8KA 3OYXA 3Q5EA 5LP6E 2BBHA 4ZHQE 3C79A 3BK9A 2E5LT 2WN9A 4X5TA 1ZEEA 3AAIA 2M6IA 2D9DA 3VR8A 2XQYA 2BG9E 3U78A 4KP3C 2XZEA 2CLYC 3ZT7A 3F2EA 4IHJE 1HNWT 5AQGB 2DHRA 1IBMT 4UM3P 5AQLB 2H89A 3TLVA 2CWYA 5IHYA 4B3RT 4P0BA 4UVBB 2VKJA 2UU9T 3KBTA 3LJCA 1I9BA 2W00A 5AQTB 2JRKA 2VVNA 3X1DA 4HWHA 2ZM6T 4CXYA 3SWHA 4JI7T 3ZT5A 2HN1A 3CQXC 2N2NA 3HL6A 4YJ2E 3TKLB 5CB4E 4KUMB 4H9RC 3NBXX 4PJJA 3SIOA 3PU8A 3PUZF 2VURA 4LMLA 3ZYLA 4HTEA 2X0HA 2CBIA 3UUNA 1WYBA 4FJOA 2BKNA 4WNKA 4N78D 2XQ4A 3ZJ2A 2E9XB 1OEDA 2CE7A 3FHNA 2BG9A 2KLQA 3CKDA 3N2OA 2ZJVA 2I6HA 5AFUL 4X1YE 2XY8B 3RKOA 4LF6T 1BR0A 5FKYA 3JAFA 3ZSTA 3PEOA 5ADXL 3JAEA 2BS4A 4AFGA 3N9PA 2HPJA 2VVSA 2RP4A 1HR0T 5JRCB 2BBJA 3H37A 4UY2A 4FRRA 5LMNT 4ZJTA 2H88A 2WP9A 3WTLA 2R6GF 4YHHT 4JI0T 3GA8A 3E22E 1MMGA 4PK4A 5EK3A 4XHEA 4JYAT 1G73A 4I43B 2A3DA 4HFEA 2C0SA 1V9DA 4QKNA 2W61A 3QB5K 3RI5A 3AB3B 3PTRB 4P0AA 4ILCA 3PUAA 3WI3A 2XAJB 1YQ4A 2DLRA 4WYVA 4JI1T 3KDSE 1I94T 3KV6A 4OYJA 4AIUA 5LBQB 2X0YA 4IDQA 2UXNB 4NUUA 1HX8A 2E5VA 4O8SA 3FBZA 3CQCB 2Y58A 5AQVB 4DBRA 3OBVE 2XQAA 4IDOA 1ZKEA 4QH5A 2UUBT 4QAAA 3C64A 4WBOA 5DQVA 3RGLA 4ADZA 4PNIA 5L3EB 4CI1B 3ZMSB 4NXMT 3RYHE 2DNXA 4AQFA 5F3JA 5AFKA 3CMLA 3QB5A 2YEVC 5LHGB 2V6YA 3AVSA 5HAXA 4EV6A 2JQQA 2CHNA 3C84A 5JH7E 2MPKA 4QX8B 3K8PC 3N5LA 4X1KE 3UQ4A 3IGQA 5BRXA 2V7MA 3SQ9A 1I6ZA 3RIUC 3PUXF 4WW0A 4Z8XA 2D5UA 4UEMA 4HWIB 3U8NA 4DV1T 4UM1A 4DNDA 4ZK1A 4X1IE 4D01A 5EZYE 1SA0E 4V1Av 3WTOA 3K3OA 2YMDA 3CX8B 3IHRA 4X64T 2KZ7B 5E0OA 4XAXB 2QVAA 2CPTA 2IHR1 1WYCA 3B5MA 4DR6T 1BR1A 1UCUA 3F57A 3AAEB 2H7OA 2NP9A 4OK0A 5ABHA 4ZEYA 2VK9A 3S4UA 1D0ZA 2QRXA 2PFVA 2WB5A 1NENA 3V5SA 2C9TA 4L5GA 2XZ6A 1IZNB 4UV9B 2V8SV 1D0XA 4Z90A 2RPAA 2W8GA 4MLKA 1HTJF 4TX5A 3TLTA 4NXNT 3ZJ1A 1LVKA 2FJDA 5L3GB 2YDQA 1N33T 1U4QA 3SFDA 2X0LB 3PUSA 4TV8E 1O3XA 1UX2A 4GKJT 1HNZT 2W8FA 1YKHB 2X67A 2CXFA 4PW8A 1HFAA 2CMRA 3AE7A 5AQIB 5JR9B 2LSIA 5JVDE 4PJNA 3PJAJ 4KI0F 5LHHB 4E7ZA 3KV4A 4HKAA 2VB6A 5AQHB 4LF4T 2J47A 3PMZA 3M3ZB 5KE4A 3T1HT 2BR8A 2BG9C 2YOEA 4HN9A 4MALA 5ABFB 1FIOA 2V7KA 4BAYB 2Y6XA 4H9NC 2BYSA 3AE1A 4QACA 5JDNA 3IBPA 1X79A 3FZMB 1CUNA 2X68A 4B3TT 1MIWA 2BYPA 1MMNA 4AFTA 3RPUA 2HN2A 4ZI7E 1LVFA 2XASB 4AKLA 5A1LA 4UXUA 3WTNA 3GN5A 3ZN1B 2V1DB 5IYZE 2BYNA 3ZYKA 1KF6A 2WU2A 4GYRA 3NWIA 3VKGA 2VL0A 5KX5E 3IF8B 4KBMB 1SUMB 5C3JA 5HXSA 3JC6D 4I55E 4K0UA 3LK3B 4YJ3E 2LHRA 3TLSA 1JNZA 3K3QC 2NTYA 4XZCA 3LDQB 4LMJA 4ANJA 1IAPA 3N9OA 4H63H 5LMUT 5L47A 3O1HA 2BYQA 3AEBA 5JDLA 2BKOA 3LK42 4COFA 2XQ5A 3D0TA 2IDOB 2W0GA 3WTIA 5CA0E 2CBJA 4JBWF 2WM9A 3FZFB 4ZOLE 2IAKA 3EI0A 2XYTA 4AKHA 1QLBA 4ILBA 4LF8T 3FBLA 1KNPA 5F8PA 2BR7A 1IBLT 3FB2A 2IC9A 3LK2B 2W62A 4QABA 3AVRA 3JADA 1OEDB 1W09A 3U8LA 3NVOA 3RYFE 4FI5A 4KHPT 3F31A 4AQFC 3RIUA 1FJGT 2KSRA 2XUEA 5CGMA 5L2LA 4CI3B 4DBMA 3Q5WA 4MHCA 3UQ7A 5M4YA 3CQGB 3J7Yq 5SYOA 1HG5A 1WR0A 5HEGA 5HXHA 3SOLA 3LBXA 3PDYA 2NTXA 3JCFA 2ACZA 5LOVE 4EEDA 2K5BB 3MJXA 3QUJA 5AQKB 3P4RA 1E7PA 1HCIA 3N9NA 4IL9A 1T7SA 5FNVE 3GUAA 2L3LA 2UZ6A 2LKHA 3ZCIA 5AFMB 4PFPA 2JJ9A 5AFHA 3Q9DA 3ZMTB 2W63A 4B3MT 5AFNA 4ZI2D 4HGAA 2IC6A 4B6XA 2WDVA 3AA1B 2FJEA 3UUBA 5FL0A 3ZN0B 2KWHA 2QC1B 2JQKA 5LCYA 3AXJB 2W2UA 4I50E 2JIWA 1HS7A 2MTQA 1WLXA 2EHOD 5KDMC 4YSZA 1YQ3A 3TLWA 2Z6EA 2IMLA 2KMFA 4UM3S 2DWGA 2RA1A 1XDPA 3Q5XA 4DR2T 3ZSSA 4HWCA 4MBQA 2LSGA 3AE5A 4ZS2A 2XAHB 3L39A 3OYZA 1W9RA 2XAQB 2NWBA 4PJMA 5L4HA 2WDRA 1US7B 2XSAA 5AFLA 2FUPA 1R8IA 3LFMA 2PBIA 4TNWA 5FL1A 3UU4A 2V7JA 3RRCA 4ILAA 2BS2A 4DR5T 3UT5E 5HWXA 2DWKA 2XQ3A 5HEOA 2L9QA 5L4EA 3V5UA 4ZZCA 2WMNA 2JMKA 4DV2T 4ZI3C 2EHOA 2KNDA 4IGUA 5HWYA 3OKQA 1ZV4X 4AFHA 4EB6E 4GIWA 1UURA 2DL1A 3P7IA 4ZRUA 4DR4T 3A8YC 5LGUB 2XHEB 2KT9A 3Q5DA 5FY0A 4CQIA 4TWDA 4PK6A 4C90A 3P4QA 2CLYB 3O9XA 2XQ8A 2SPCA 4TNVA 3RLFF 3HKDE 3C50A 3N9QA 3UU6A 5JDMA 3M65A 4JI5T 5FY7A 3EUHA 4CN1A 2FJBA 4JI6T 2WNJA 4HFIA 3FZHB 1L0VA 1E1HB 4YY3T 2XSBA 4H9SE 4JV5T 1IBKT 3WIPA 2K9AA 3UU5A 4IE5A 4G2AA 4PIRA 2BDEA 2XPKA 4O2BE 3ZT6A 1D1CA 4L0RA 2CM0A 4YFSA 5HCMA 3RX6A 4YXDA 4A98A 3MKDA 4P09A 3WTKA 4HEAA 1UGOA 2X9HA 3PU3A 2CEAA 2UUCT 2XNVA 4X65T 3QOFA 1ZOYA 5LNKA 3RQUA 5J5GA 3O4XE 4BFQA 4DIDB 2LM9A 2W67A 4G63A 1MIVA 2DI4A 2C5KT 2M67A 4IE4A 4YTPA 2W66A 1S94A 3NRYA 5IUXA 3JC6C 5BW2A 2PH9A 1M7KA 4HFVA 5TVCA 2K24A 2DCFA 4O4HE 5J0ZA 2Y7YA 4HWFA 3IA3A 4EYUA 4LFAT 2XM2A 1XMOT 3EAMA 3MA9A 2LKGA 3PURA 1HNXT 5AQSB 1Y01A 2A72A 3MK7C 1DU2A 4JEHB 3ZDHA 2Q9QC 4IIJE 4UF0B 4P1NA 3GN5B 1JNRA 4EIWA 3DP7A 4ERRA 4AKGA 1AJ3A 3B57A 5LYJE 5HXRA 4ASKA 2PG8A 4DBQA 4NPPA 4ALXA 3P8CD 4YSXA 4TWHA 3T4MA 2C5IT 4ZI3D 4EZ4A 3C4WA 4DV3T 2NW8A 1Z0PA 5LJNA 2IIUA 1XNRT 4GYSA 5LGTB 5J1GA 5IWAT 2WZIA 4EZ1A 1T72A 3AE8A 3ESLA 3P4SA 4DVDA 1LRZA 2LM2A 5FXVA 3DTOA 2X9YA 3H3AA 5JDHA 5JMEA 2YK0A 3E08A 5LB7B 2WZYA 4H9PC 1YXRA 3HR0A 4BJMA 2XYSA 4UM3A 4CN4A 3OJAA 5C8YE 2V7LA 1CHUA 4U2ZA 3FXEB 3AEAA 2G0UA 3NZPA 1WRDA 2L8KA 2ES0A 3UUMA 5J5IA 1X9BA 4ZI2C 2A2FX 3ONJA 1YD8G 3ONXA 3CVRA 3GWHA 5AQPB 3CIRA 4IDZA 3MACA 4IREA 1G8XA 1XNQT 4HFBA 1IJ5A 3LSVA 3RRWA 2V6XA 3NKZA 3H3MA 2V5CA 2EHOC 5FVLA 2B76A 4JI2T 4HWDA 3NZQA 1KNZA 1LKXA 4TWFA 4CI2B 1KFYA 5FVKA 1UUSA 1XMQT 1N36T 2LT3A 1XZYA 3VR9A 1NAFA 3AEGA 2XZ5A 1XWMA 2IW5B 2WDQA 3EDVA 5HYAA 3KFWX 5HEUA 4UVCB 3UULA 3U3IA 3CK6A 1WCRA 4OFZA 2C5JA 4UV8B
chains in the Genus database with same CATH topology
4ILCA 2WNLA 2XYTA 4UM1A 4XK9A 5TVCA 4ZK1A 2XNUA 2WZYA 4LMKA 4ILBA 3WTJA 4D01A 5J0ZA 5LXBA 4TWDA 3UUBA 1UW6A 3WTMA 2XYSA 4WV9A 4UM3A 2BR7A 3WTOA 2Y7YA 4HFDA 4QH1A 2QC1B 2Y54A 2YMDA 5KZUA 2M6BA 2XQ8A 3SIOA 4TNVA 5J5HA 3PMZA 4QABA 5KE4A 3EAMA 2LKGA 4LMLA 2BYRA 2BR8A 2ZJUA 2BG9C 5BP0A 3TLWA 3UU6A 3JADA 3TLUA 3P50A 2YOEA 1OEDB 2Y58A 3U8LA 4IL4A 1UV6A 3EHZA 4B5DA 4UM3S 4ZZBA 5J5IA 4BQTA 2XQAA 2XQ4A 2X00D 2YMEA 4QH5A 4A97A 4HFHA 2WNJA 2BYSA 4QAAA 4QACA 3ZDHA 2KSRA 1OEDA 4HFIA 4IREA 3UU8A 1OEDE 5HEHA 2BG9A 4HFBA 5CO5A 2ZJVA 3U8JA 2BYPA 3ZKRA 3LSVA 4AFTA 5AFJA 4DBMA 4NZBA 5L4HA 2C9TA 5LG3A 3JAFA 4QH4A 3UQ7A 5AINA 3WIPA 3PEOA 2PGZA 4UXUA 3WTNA 3U8KA 2XZ6A 5AFLA 3UU5A 2BYNA 3JAEA 4NPPA 4ALXA 4Z90A 2XQ9A 2BG9B 5SYOA 4AFGA 4TNWA 3UU4A 4PIRA 4HQPA 3UU3A 3ZDGA 4ILAA 5HCJA 5AFKA 4TWHA 3T4MA 2VL0A 5HEGA 3C79A 2WN9A 5FJVA 3SQ6A 2BJ0A 2W8GA 4X5TA 2WNCA 4TWFA 2XQ3A 3U8MA 2MAWA 5HEOA 2XQ6A 3RHWA 5HCMA 5L4EA 3TLTA 4ZZCA 2M6IA 3TLSA 4UY2A 4FRRA 2Y57A 2BG9E 2YN6A 4A98A 5HEJA 5AFMA 4ZJTA 3P4WA 4LMJA 3RIFA 3WTLA 4IL9A 3C84A 3GUAA 4AFHA 3WTKA 2XZ5A 2YKSA 1UX2A 5CFBA 3UQ4A 3IGQA 5BRXA 4ZJSA 2XNVA 4UM3P 5L47A 2BYQA 4XHEA 4ZK4A 2UZ6A 2LKHA 4COFA 2XQ5A 3TLVA 3RQUA 5J5GA 2X00A 4ZR6A 4EZ1A 4BFQA 3SQ9A 2Y56A 5AFMB 4ZRUA 3RQWA 1I9BA 5AFHA 4HFCA 4HFEA 1OEDC 5HEUA 3SH1A 5J5FA 3WTIA 4Z91A 2PH9A 2XQ7A 3WTHA 2W8FA 4F8HA 5AFNA 2LM2A 3RI5A 3RIAA 2LLYA 3U8NA 2XNTA 5JMEA 5IUXA 5BW2A 3EI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILC A;  2WNL A;  2XYT A;  4UM1 A;  4XK9 A;  5TVC A;  4ZK1 A;  2XNU A;  2WZY A;  4LMK A;  4ILB A;  3WTJ A;  4D01 A;  5J0Z A;  5LXB A;  4TWD A;  3UUB A;  1UW6 A;  3WTM A;  2XYS A;  4WV9 A;  4UM3 A;  2BR7 A;  3WTO A;  2Y7Y A;  4HFD A;  4QH1 A;  2QC1 B;  2Y54 A;  2YMD A;  5KZU A;  2M6B A;  2XQ8 A;  3SIO A;  4TNV A;  5J5H A;  3PMZ A;  4QAB A;  5KE4 A;  3EAM A;  2LKG A;  4LML A;  2BYR A;  2BR8 A;  2ZJU A;  2BG9 C;  5BP0 A;  3TLW A;  3UU6 A;  3JAD A;  3TLU A;  3P50 A;  2YOE A;  1OED B;  2Y58 A;  3U8L A;  4IL4 A;  1UV6 A;  3EHZ A;  4B5D A;  4UM3 S;  4ZZB A;  5J5I A;  4BQT A;  2XQA A;  2XQ4 A;  2X00 D;  2YME A;  4QH5 A;  4A97 A;  4HFH A;  2WNJ A;  2BYS A;  4QAA A;  4QAC A;  3ZDH A;  2KSR A;  1OED A;  4HFI A;  4IRE A;  3UU8 A;  1OED E;  5HEH A;  2BG9 A;  4HFB A;  5CO5 A;  2ZJV A;  3U8J A;  2BYP A;  3ZKR A;  3LSV A;  4AFT A;  5AFJ A;  4DBM A;  4NZB A;  5L4H A;  2C9T A;  5LG3 A;  3JAF A;  4QH4 A;  3UQ7 A;  5AIN A;  3WIP A;  3PEO A;  2PGZ A;  4UXU A;  3WTN A;  3U8K A;  2XZ6 A;  5AFL A;  3UU5 A;  2BYN A;  3JAE A;  4NPP A;  4ALX A;  4Z90 A;  2XQ9 A;  2BG9 B;  5SYO A;  4AFG A;  4TNW A;  3UU4 A;  4PIR A;  4HQP A;  3UU3 A;  3ZDG A;  4ILA A;  5HCJ A;  5AFK A;  4TWH A;  3T4M A;  2VL0 A;  5HEG A;  3C79 A;  2WN9 A;  5FJV A;  3SQ6 A;  2BJ0 A;  2W8G A;  4X5T A;  2WNC A;  4TWF A;  2XQ3 A;  3U8M A;  2MAW A;  5HEO A;  2XQ6 A;  3RHW A;  5HCM A;  5L4E A;  3TLT A;  4ZZC A;  2M6I A;  3TLS A;  4UY2 A;  4FRR A;  2Y57 A;  2BG9 E;  2YN6 A;  4A98 A;  5HEJ A;  5AFM A;  4ZJT A;  3P4W A;  4LMJ A;  3RIF A;  3WTL A;  4IL9 A;  3C84 A;  3GUA A;  4AFH A;  3WTK A;  2XZ5 A;  2YKS A;  1UX2 A;  5CFB A;  3UQ4 A;  3IGQ A;  5BRX A;  4ZJS A;  2XNV A;  4UM3 P;  5L47 A;  2BYQ A;  4XHE A;  4ZK4 A;  2UZ6 A;  2LKH A;  4COF A;  2XQ5 A;  3TLV A;  3RQU A;  5J5G A;  2X00 A;  4ZR6 A;  4EZ1 A;  4BFQ A;  3SQ9 A;  2Y56 A;  5AFM B;  4ZRU A;  3RQW A;  1I9B A;  5AFH A;  4HFC A;  4HFE A;  1OED C;  5HEU A;  3SH1 A;  5J5F A;  3WTI A;  4Z91 A;  2PH9 A;  2XQ7 A;  3WTH A;  2W8F A;  4F8H A;  5AFN A;  2LM2 A;  3RI5 A;  3RIA A;  2LLY A;  3U8N A;  2XNT A;  5JME A;  5IUX A;  5BW2 A;  3EI0 A; 
#chains in the Genus database with same CATH topology
 2WZH A;  3PJA A;  3G06 A;  4DMV A;  5LXB A;  2CHO A;  2H7V C;  3AA0 B;  1W0B A;  3KIN B;  2YDS A;  2HHH T;  2N9D A;  4QXC B;  4KHZ F;  1ZP0 A;  4OX9 T;  3VHL A;  1OXZ A;  1UV6 A;  2Q9Q D;  4B5D A;  3OPC A;  3ZYM A;  4KMC A;  5DJQ C;  3Q2M A;  2YME A;  5H6R B;  4JUY A;  2BKP A;  1HX1 B;  2YDR A;  1MND A;  5J2U E;  4X20 E;  4O4I E;  5FMN A;  4F6R C;  1T8B A;  2LJL A;  5HXC A;  2XTL A;  3N9L A;  5AIN A;  2PGZ A;  3OVU A;  5JRE A;  1OWA A;  3UTK A;  2BG9 B;  2LSJ A;  4YTN A;  4NIQ A;  1SHZ C;  2K3W A;  5FJV A;  3SQ6 A;  3U8M A;  2V7I A;  2MAW A;  2WY2 A;  2XQ6 A;  3RHW A;  5LGN B;  3ABV A;  1J5E T;  2AXD S;  2ZM8 A;  4CXW A;  1NEK A;  4EYY R;  3T8O A;  3HKB E;  3C4Z A;  2Q9Q A;  2WQY A;  2WSS V;  2JQH A;  2BS3 A;  2KWI B;  4U31 A;  4ZK4 A;  4GKK T;  3RQW A;  3RYC E;  3AEE A;  5J5F A;  5FXW A;  4XBF B;  1Y64 B;  3ANW A;  2J62 A;  2B1E A;  2XNU A;  1FMW A;  4WV9 A;  2WBL A;  4QHO A;  3AEF A;  4JEU B;  4OYK A;  2N1G A;  5LBM A;  2D2S A;  2PTF A;  4AKI A;  3PUV F;  4MFR A;  3EDU A;  4LFB T;  2Y48 B;  3BQL A;  3P50 A;  2F4V T;  3SS1 A;  5JTG A;  2UXX B;  3ZC1 A;  4BQT A;  3HKC E;  4U2Y A;  2LHN A;  2QYW A;  4K0K T;  2CWO A;  3RC3 A;  2V5D A;  4A97 A;  4TV9 E;  3RH3 A;  2VAS A;  2NOX A;  1OED E;  5ABE A;  2FJA A;  5CO5 A;  2X66 A;  2VQF T;  4QH4 A;  4QX7 B;  1UX5 A;  2ACX A;  5H6Q B;  1E2A A;  3T1Y T;  4JI4 T;  2BVM A;  3ZDG A;  4J2C A;  2I0M A;  4UIG A;  3AED A;  2E2A A;  1MNE A;  4X62 T;  5FY1 A;  5EK2 A;  3MZK B;  2YN6 A;  3UFE A;  3ZMU B;  2VKD A;  3L09 A;  3BQK A;  2V6Y B;  3KBU A;  1QSD A;  4IST A;  3I0O A;  3P4P A;  3K3N A;  3AAA B;  1B7T A;  2J1D G;  5ABG A;  3ZC0 A;  2XNT A;  2J4G A;  5FXZ A;  4ZXL A;  4LF9 T;  3A7M A;  2UUA T;  2Y8D A;  4QH1 A;  2M6B A;  5EK4 A;  4DO0 A;  3CX6 B;  5L3C B;  4LF5 T;  4DMW A;  2E8I A;  5L3D B;  4IE6 A;  4UEL A;  2FBW A;  4AXP A;  2ZM0 A;  4O2A E;  2CA5 A;  5AQU B;  3VRB A;  3VU7 H;  2H3R A;  2JPF A;  4OHF A;  5LA6 E;  1BR4 A;  4CXX A;  3KV5 A;  5BMV E;  3SFE A;  3AE3 A;  2CXD A;  3UFG A;  5FXX A;  3KVA A;  1MIY A;  4DR3 T;  3FZK B;  4EZH A;  2D0U A;  4DR7 T;  1UX4 A;  3O1I A;  5LG4 A;  4EEB A;  3HKE E;  5JDQ A;  3PUY F;  1J1J A;  2WCA A;  2BJ0 A;  3ZEF B;  4AQG A;  3AEC A;  2CXL A;  3I9Y A;  3LG7 A;  5HEJ A;  5AFM A;  2VL8 A;  5L3B B;  1HF8 A;  4IDP A;  2LOP A;  4UR9 A;  3WAJ A;  2YKS A;  2LSY A;  4H9Q C;  4U74 A;  4IT4 A;  4EOZ B;  1J5W A;  4DUY T;  1YW0 A;  2E9X D;  3EVY A;  2YIN A;  1KK7 A;  4F8H A;  3AE4 A;  2LLY A;  3AXJ A;  1D1B A;  3DJB A;  2JMH A;  5ETW A;  5GON E;  1MMA A;  4LMK A;  2OV9 A;  5AQO B;  5LHI B;  5AQF B;  4QXB B;  3GMI A;  1WR6 A;  2V26 A;  4JI3 T;  2WAU A;  2XAG B;  4GOU A;  5F5W A;  2BYR A;  2ZJU A;  4IL4 A;  1UK5 A;  2NR4 A;  2XJ7 A;  1GQE A;  4ZS3 A;  4PK5 A;  2GK9 A;  3QNU A;  2OA5 A;  2NW9 A;  4C91 A;  1D1A A;  2BVL A;  5HEH A;  2ZLY A;  2E9X A;  4NZB A;  4UVA B;  2IUB A;  1VCT A;  4AI6 A;  3R6N A;  4EGW A;  2CCQ A;  4U33 A;  2XQ9 A;  4KX6 A;  4A56 A;  1W0A A;  5HCJ A;  3PUQ A;  2WNC A;  4TN7 B;  4U7I A;  4AIS A;  4JLE A;  3BQI A;  5JR9 C;  4YSY A;  4DV4 T;  3O1J A;  2Y57 A;  3L8R A;  3N9M A;  4B3S T;  2PJQ A;  5JRC A;  5L3F B;  2W4X A;  3CX7 B;  3QK6 A;  5KXJ A;  2XM1 A;  3AA7 B;  3RC8 A;  1XDO A;  4UXN B;  1Z8U A;  4IE7 A;  2UXB T;  5AQN B;  4X66 T;  3AE2 A;  4DV7 T;  4XK9 A;  3I1A A;  4BJN A;  5FYM A;  5AQR B;  2X9X A;  2WS3 A;  4H9O C;  1N34 T;  4HFD A;  2Y54 A;  2AE9 A;  4JI8 T;  2ODU A;  2HPL A;  5J5H A;  3VRA A;  2LOS A;  3PUW F;  4PAG A;  4NUV A;  3I0Q A;  3EAB A;  2LRK A;  1N32 T;  1U5P A;  4EAH A;  1ZHC A;  1BR2 A;  5AQQ B;  4ZZB A;  1QUU A;  2X00 D;  4ILU A;  3C51 A;  4PFO A;  1SE7 A;  5C2T A;  2D0T A;  2WWV A;  2HH7 A;  1FEW A;  3U8J A;  2UXD T;  2VWA A;  1FMV A;  4M1P A;  2VKH A;  4O4J E;  3J9X 1;  3AA6 B;  2KIN B;  2KXP B;  3SRZ A;  1YKE B;  5CJ5 A;  4CZZ B;  4DV5 T;  2X51 A;  4CN6 A;  1NWM X;  4HQP A;  2CRB A;  3I9W A;  4LFC T;  3OTO T;  4AQY T;  3RYI E;  2A9U A;  2Q9Q B;  2QGS A;  4PJL A;  2P9B A;  3P4W A;  4DUZ T;  2WWU A;  4L9I A;  3LBX B;  4AKR B;  4DV0 T;  3ANW B;  1VRB A;  4U7Y A;  4ISS A;  2X00 A;  3R84 B;  2Y56 A;  4YT0 A;  1OED C;  3SH1 A;  4Z91 A;  2XQ7 A;  3WTH A;  4O4L E;  4QWN B;  3RF1 A;  3VKH A;  5DQW A;  2NW7 A;  4GK5 E;  2MYS A;  5TAO A;  3ZLI A;  2UXC T;  4E7S A;  5BR8 T;  1WFD A;  3RKG A;  4A5X A;  2ODV A;  1MMD A;  4U3C A;  1D0Y A;  5JDG A;  3KV9 A;  2LEH A;  1S35 A;  3A5X A;  3W15 B;  1IJ6 A;  2QA7 A;  3MXZ A;  3ONL C;  5BP0 A;  4UF0 A;  3ZCJ A;  3N2G E;  3HA4 A;  3PUG A;  4Q25 A;  1T98 A;  3PE0 A;  2MOZ A;  3UU8 A;  2ZMA A;  3ZPO A;  4EXT A;  5LJM A;  2WU5 A;  2LE8 A;  2X9W A;  5J2T E;  2BZB A;  4IDN A;  4GK0 E;  2VQE T;  4BA9 A;  4H63 V;  5JQG E;  4U72 A;  5AQJ B;  3PV0 F;  2K48 A;  2ZM2 A;  3UU3 A;  1H7C A;  3WAK A;  4YTM A;  4I0U A;  4WZX A;  2LSK A;  1HG2 A;  3ETV A;  4QXH B;  3KVB A;  1VCS A;  3B13 A;  4YHJ A;  3E0Z A;  3ZMZ B;  2I59 A;  4DV6 T;  3L3P A;  3QC9 A;  3RIF A;  1EZ3 A;  5CFB A;  4IE0 A;  4ZJS A;  5HXE A;  3C98 B;  2LRL A;  4ZR6 A;  2EHO B;  3K1S A;  4TZ4 C;  1VOM A;  3ETU A;  4HFC A;  3FZL B;  1M62 A;  3RIA A;  5KMG P;  5LXT E;  4I4T E;  2WNL A;  4LF7 T;  3CPZ A;  3WTJ A;  2MBG A;  3WTM A;  1UW6 A;  3IEE A;  3HI2 A;  4HE8 A;  5KZU A;  3FXD B;  4DR1 T;  5JDF A;  1KEY A;  5JR9 A;  2WMO A;  5DAB A;  2OLT A;  2XAF B;  3AE9 A;  3TLU A;  3AE6 A;  2E9X C;  3EHZ A;  4TUY E;  5AQM B;  4YLH A;  5CA1 E;  1KNR A;  4HFH A;  2YU1 A;  3ZMV B;  3CWZ B;  2VKO A;  3NRX A;  5ABF A;  2YU2 A;  3C4X A;  3N2K E;  5FP3 A;  3ZKR A;  4WBN E;  5AFJ A;  5LG3 A;  2JQ9 A;  3UUX B;  3U8K A;  3OYX A;  3Q5E A;  5LP6 E;  2BBH A;  4ZHQ E;  3C79 A;  3BK9 A;  2E5L T;  2WN9 A;  4X5T A;  1ZEE A;  3AAI A;  2M6I A;  2D9D A;  3VR8 A;  2XQY A;  2BG9 E;  3U78 A;  4KP3 C;  2XZE A;  2CLY C;  3ZT7 A;  3F2E A;  4IHJ E;  1HNW T;  5AQG B;  2DHR A;  1IBM T;  4UM3 P;  5AQL B;  2H89 A;  3TLV A;  2CWY A;  5IHY A;  4B3R T;  4P0B A;  4UVB B;  2VKJ A;  2UU9 T;  3KBT A;  3LJC A;  1I9B A;  2W00 A;  5AQT B;  2JRK A;  2VVN A;  3X1D A;  4HWH A;  2ZM6 T;  4CXY A;  3SWH A;  4JI7 T;  3ZT5 A;  2HN1 A;  3CQX C;  2N2N A;  3HL6 A;  4YJ2 E;  3TKL B;  5CB4 E;  4KUM B;  4H9R C;  3NBX X;  4PJJ A;  3SIO A;  3PU8 A;  3PUZ F;  2VUR A;  4LML A;  3ZYL A;  4HTE A;  2X0H A;  2CBI A;  3UUN A;  1WYB A;  4FJO A;  2BKN A;  4WNK A;  4N78 D;  2XQ4 A;  3ZJ2 A;  2E9X B;  1OED A;  2CE7 A;  3FHN A;  2BG9 A;  2KLQ A;  3CKD A;  3N2O A;  2ZJV A;  2I6H A;  5AFU L;  4X1Y E;  2XY8 B;  3RKO A;  4LF6 T;  1BR0 A;  5FKY A;  3JAF A;  3ZST A;  3PEO A;  5ADX L;  3JAE A;  2BS4 A;  4AFG A;  3N9P A;  2HPJ A;  2VVS A;  2RP4 A;  1HR0 T;  5JRC B;  2BBJ A;  3H37 A;  4UY2 A;  4FRR A;  5LMN T;  4ZJT A;  2H88 A;  2WP9 A;  3WTL A;  2R6G F;  4YHH T;  4JI0 T;  3GA8 A;  3E22 E;  1MMG A;  4PK4 A;  5EK3 A;  4XHE A;  4JYA T;  1G73 A;  4I43 B;  2A3D A;  4HFE A;  2C0S A;  1V9D A;  4QKN A;  2W61 A;  3QB5 K;  3RI5 A;  3AB3 B;  3PTR B;  4P0A A;  4ILC A;  3PUA A;  3WI3 A;  2XAJ B;  1YQ4 A;  2DLR A;  4WYV A;  4JI1 T;  3KDS E;  1I94 T;  3KV6 A;  4OYJ A;  4AIU A;  5LBQ B;  2X0Y A;  4IDQ A;  2UXN B;  4NUU A;  1HX8 A;  2E5V A;  4O8S A;  3FBZ A;  3CQC B;  2Y58 A;  5AQV B;  4DBR A;  3OBV E;  2XQA A;  4IDO A;  1ZKE A;  4QH5 A;  2UUB T;  4QAA A;  3C64 A;  4WBO A;  5DQV A;  3RGL A;  4ADZ A;  4PNI A;  5L3E B;  4CI1 B;  3ZMS B;  4NXM T;  3RYH E;  2DNX A;  4AQF A;  5F3J A;  5AFK A;  3CML A;  3QB5 A;  2YEV C;  5LHG B;  2V6Y A;  3AVS A;  5HAX A;  4EV6 A;  2JQQ A;  2CHN A;  3C84 A;  5JH7 E;  2MPK A;  4QX8 B;  3K8P C;  3N5L A;  4X1K E;  3UQ4 A;  3IGQ A;  5BRX A;  2V7M A;  3SQ9 A;  1I6Z A;  3RIU C;  3PUX F;  4WW0 A;  4Z8X A;  2D5U A;  4UEM A;  4HWI B;  3U8N A;  4DV1 T;  4UM1 A;  4DND A;  4ZK1 A;  4X1I E;  4D01 A;  5EZY E;  1SA0 E;  4V1A v;  3WTO A;  3K3O A;  2YMD A;  3CX8 B;  3IHR A;  4X64 T;  2KZ7 B;  5E0O A;  4XAX B;  2QVA A;  2CPT A;  2IHR 1;  1WYC A;  3B5M A;  4DR6 T;  1BR1 A;  1UCU A;  3F57 A;  3AAE B;  2H7O A;  2NP9 A;  4OK0 A;  5ABH A;  4ZEY A;  2VK9 A;  3S4U A;  1D0Z A;  2QRX A;  2PFV A;  2WB5 A;  1NEN A;  3V5S A;  2C9T A;  4L5G A;  2XZ6 A;  1IZN B;  4UV9 B;  2V8S V;  1D0X A;  4Z90 A;  2RPA A;  2W8G A;  4MLK A;  1HTJ F;  4TX5 A;  3TLT A;  4NXN T;  3ZJ1 A;  1LVK A;  2FJD A;  5L3G B;  2YDQ A;  1N33 T;  1U4Q A;  3SFD A;  2X0L B;  3PUS A;  4TV8 E;  1O3X A;  1UX2 A;  4GKJ T;  1HNZ T;  2W8F A;  1YKH B;  2X67 A;  2CXF A;  4PW8 A;  1HFA A;  2CMR A;  3AE7 A;  5AQI B;  5JR9 B;  2LSI A;  5JVD E;  4PJN A;  3PJA J;  4KI0 F;  5LHH B;  4E7Z A;  3KV4 A;  4HKA A;  2VB6 A;  5AQH B;  4LF4 T;  2J47 A;  3PMZ A;  3M3Z B;  5KE4 A;  3T1H T;  2BR8 A;  2BG9 C;  2YOE A;  4HN9 A;  4MAL A;  5ABF B;  1FIO A;  2V7K A;  4BAY B;  2Y6X A;  4H9N C;  2BYS A;  3AE1 A;  4QAC A;  5JDN A;  3IBP A;  1X79 A;  3FZM B;  1CUN A;  2X68 A;  4B3T T;  1MIW A;  2BYP A;  1MMN A;  4AFT A;  3RPU A;  2HN2 A;  4ZI7 E;  1LVF A;  2XAS B;  4AKL A;  5A1L A;  4UXU A;  3WTN A;  3GN5 A;  3ZN1 B;  2V1D B;  5IYZ E;  2BYN A;  3ZYK A;  1KF6 A;  2WU2 A;  4GYR A;  3NWI A;  3VKG A;  2VL0 A;  5KX5 E;  3IF8 B;  4KBM B;  1SUM B;  5C3J A;  5HXS A;  3JC6 D;  4I55 E;  4K0U A;  3LK3 B;  4YJ3 E;  2LHR A;  3TLS A;  1JNZ A;  3K3Q C;  2NTY A;  4XZC A;  3LDQ B;  4LMJ A;  4ANJ A;  1IAP A;  3N9O A;  4H63 H;  5LMU T;  5L47 A;  3O1H A;  2BYQ A;  3AEB A;  5JDL A;  2BKO A;  3LK4 2;  4COF A;  2XQ5 A;  3D0T A;  2IDO B;  2W0G A;  3WTI A;  5CA0 E;  2CBJ A;  4JBW F;  2WM9 A;  3FZF B;  4ZOL E;  2IAK A;  3EI0 A;  2XYT A;  4AKH A;  1QLB A;  4ILB A;  4LF8 T;  3FBL A;  1KNP A;  5F8P A;  2BR7 A;  1IBL T;  3FB2 A;  2IC9 A;  3LK2 B;  2W62 A;  4QAB A;  3AVR A;  3JAD A;  1OED B;  1W09 A;  3U8L A;  3NVO A;  3RYF E;  4FI5 A;  4KHP T;  3F31 A;  4AQF C;  3RIU A;  1FJG T;  2KSR A;  2XUE A;  5CGM A;  5L2L A;  4CI3 B;  4DBM A;  3Q5W A;  4MHC A;  3UQ7 A;  5M4Y A;  3CQG B;  3J7Y q;  5SYO A;  1HG5 A;  1WR0 A;  5HEG A;  5HXH A;  3SOL A;  3LBX A;  3PDY A;  2NTX A;  3JCF A;  2ACZ A;  5LOV E;  4EED A;  2K5B B;  3MJX A;  3QUJ A;  5AQK B;  3P4R A;  1E7P A;  1HCI A;  3N9N A;  4IL9 A;  1T7S A;  5FNV E;  3GUA A;  2L3L A;  2UZ6 A;  2LKH A;  3ZCI A;  5AFM B;  4PFP A;  2JJ9 A;  5AFH A;  3Q9D A;  3ZMT B;  2W63 A;  4B3M T;  5AFN A;  4ZI2 D;  4HGA A;  2IC6 A;  4B6X A;  2WDV A;  3AA1 B;  2FJE A;  3UUB A;  5FL0 A;  3ZN0 B;  2KWH A;  2QC1 B;  2JQK A;  5LCY A;  3AXJ B;  2W2U A;  4I50 E;  2JIW A;  1HS7 A;  2MTQ A;  1WLX A;  2EHO D;  5KDM C;  4YSZ A;  1YQ3 A;  3TLW A;  2Z6E A;  2IML A;  2KMF A;  4UM3 S;  2DWG A;  2RA1 A;  1XDP A;  3Q5X A;  4DR2 T;  3ZSS A;  4HWC A;  4MBQ A;  2LSG A;  3AE5 A;  4ZS2 A;  2XAH B;  3L39 A;  3OYZ A;  1W9R A;  2XAQ B;  2NWB A;  4PJM A;  5L4H A;  2WDR A;  1US7 B;  2XSA A;  5AFL A;  2FUP A;  1R8I A;  3LFM A;  2PBI A;  4TNW A;  5FL1 A;  3UU4 A;  2V7J A;  3RRC A;  4ILA A;  2BS2 A;  4DR5 T;  3UT5 E;  5HWX A;  2DWK A;  2XQ3 A;  5HEO A;  2L9Q A;  5L4E A;  3V5U A;  4ZZC A;  2WMN A;  2JMK A;  4DV2 T;  4ZI3 C;  2EHO A;  2KND A;  4IGU A;  5HWY A;  3OKQ A;  1ZV4 X;  4AFH A;  4EB6 E;  4GIW A;  1UUR A;  2DL1 A;  3P7I A;  4ZRU A;  4DR4 T;  3A8Y C;  5LGU B;  2XHE B;  2KT9 A;  3Q5D A;  5FY0 A;  4CQI A;  4TWD A;  4PK6 A;  4C90 A;  3P4Q A;  2CLY B;  3O9X A;  2XQ8 A;  2SPC A;  4TNV A;  3RLF F;  3HKD E;  3C50 A;  3N9Q A;  3UU6 A;  5JDM A;  3M65 A;  4JI5 T;  5FY7 A;  3EUH A;  4CN1 A;  2FJB A;  4JI6 T;  2WNJ A;  4HFI A;  3FZH B;  1L0V A;  1E1H B;  4YY3 T;  2XSB A;  4H9S E;  4JV5 T;  1IBK T;  3WIP A;  2K9A A;  3UU5 A;  4IE5 A;  4G2A A;  4PIR A;  2BDE A;  2XPK A;  4O2B E;  3ZT6 A;  1D1C A;  4L0R A;  2CM0 A;  4YFS A;  5HCM A;  3RX6 A;  4YXD A;  4A98 A;  3MKD A;  4P09 A;  3WTK A;  4HEA A;  1UGO A;  2X9H A;  3PU3 A;  2CEA A;  2UUC T;  2XNV A;  4X65 T;  3QOF A;  1ZOY A;  5LNK A;  3RQU A;  5J5G A;  3O4X E;  4BFQ A;  4DID B;  2LM9 A;  2W67 A;  4G63 A;  1MIV A;  2DI4 A;  2C5K T;  2M67 A;  4IE4 A;  4YTP A;  2W66 A;  1S94 A;  3NRY A;  5IUX A;  3JC6 C;  5BW2 A;  2PH9 A;  1M7K A;  4HFV A;  5TVC A;  2K24 A;  2DCF A;  4O4H E;  5J0Z A;  2Y7Y A;  4HWF A;  3IA3 A;  4EYU A;  4LFA T;  2XM2 A;  1XMO T;  3EAM A;  3MA9 A;  2LKG A;  3PUR A;  1HNX T;  5AQS B;  1Y01 A;  2A72 A;  3MK7 C;  1DU2 A;  4JEH B;  3ZDH A;  2Q9Q C;  4IIJ E;  4UF0 B;  4P1N A;  3GN5 B;  1JNR A;  4EIW A;  3DP7 A;  4ERR A;  4AKG A;  1AJ3 A;  3B57 A;  5LYJ E;  5HXR A;  4ASK A;  2PG8 A;  4DBQ A;  4NPP A;  4ALX A;  3P8C D;  4YSX A;  4TWH A;  3T4M A;  2C5I T;  4ZI3 D;  4EZ4 A;  3C4W A;  4DV3 T;  2NW8 A;  1Z0P A;  5LJN A;  2IIU A;  1XNR T;  4GYS A;  5LGT B;  5J1G A;  5IWA T;  2WZI A;  4EZ1 A;  1T72 A;  3AE8 A;  3ESL A;  3P4S A;  4DVD A;  1LRZ A;  2LM2 A;  5FXV A;  3DTO A;  2X9Y A;  3H3A A;  5JDH A;  5JME A;  2YK0 A;  3E08 A;  5LB7 B;  2WZY A;  4H9P C;  1YXR A;  3HR0 A;  4BJM A;  2XYS A;  4UM3 A;  4CN4 A;  3OJA A;  5C8Y E;  2V7L A;  1CHU A;  4U2Z A;  3FXE B;  3AEA A;  2G0U A;  3NZP A;  1WRD A;  2L8K A;  2ES0 A;  3UUM A;  5J5I A;  1X9B A;  4ZI2 C;  2A2F X;  3ONJ A;  1YD8 G;  3ONX A;  3CVR A;  3GWH A;  5AQP B;  3CIR A;  4IDZ A;  3MAC A;  4IRE A;  1G8X A;  1XNQ T;  4HFB A;  1IJ5 A;  3LSV A;  3RRW A;  2V6X A;  3NKZ A;  3H3M A;  2V5C A;  2EHO C;  5FVL A;  2B76 A;  4JI2 T;  4HWD A;  3NZQ A;  1KNZ A;  1LKX A;  4TWF A;  4CI2 B;  1KFY A;  5FVK A;  1UUS A;  1XMQ T;  1N36 T;  2LT3 A;  1XZY A;  3VR9 A;  1NAF A;  3AEG A;  2XZ5 A;  1XWM A;  2IW5 B;  2WDQ A;  3EDV A;  5HYA A;  3KFW X;  5HEU A;  4UVC B;  3UUL A;  3U3I A;  3CK6 A;  1WCR A;  4OFZ A;  2C5J A;  4UV8 B; 
#chains in the Genus database with same CATH homology
 4ILC A;  2WNL A;  2XYT A;  4UM1 A;  4XK9 A;  5TVC A;  4ZK1 A;  2XNU A;  2WZY A;  4LMK A;  4ILB A;  3WTJ A;  4D01 A;  5J0Z A;  5LXB A;  4TWD A;  3UUB A;  1UW6 A;  3WTM A;  2XYS A;  4WV9 A;  4UM3 A;  2BR7 A;  3WTO A;  2Y7Y A;  4HFD A;  4QH1 A;  2QC1 B;  2Y54 A;  2YMD A;  5KZU A;  2M6B A;  2XQ8 A;  3SIO A;  4TNV A;  5J5H A;  3PMZ A;  4QAB A;  5KE4 A;  3EAM A;  2LKG A;  4LML A;  2BYR A;  2BR8 A;  2ZJU A;  2BG9 C;  5BP0 A;  3TLW A;  3UU6 A;  3JAD A;  3TLU A;  3P50 A;  2YOE A;  1OED B;  2Y58 A;  3U8L A;  4IL4 A;  1UV6 A;  3EHZ A;  4B5D A;  4UM3 S;  4ZZB A;  5J5I A;  4BQT A;  2XQA A;  2XQ4 A;  2X00 D;  2YME A;  4QH5 A;  4A97 A;  4HFH A;  2WNJ A;  2BYS A;  4QAA A;  4QAC A;  3ZDH A;  2KSR A;  1OED A;  4HFI A;  4IRE A;  3UU8 A;  1OED E;  5HEH A;  2BG9 A;  4HFB A;  5CO5 A;  2ZJV A;  3U8J A;  2BYP A;  3ZKR A;  3LSV A;  4AFT A;  5AFJ A;  4DBM A;  4NZB A;  5L4H A;  2C9T A;  5LG3 A;  3JAF A;  4QH4 A;  3UQ7 A;  5AIN A;  3WIP A;  3PEO A;  2PGZ A;  4UXU A;  3WTN A;  3U8K A;  2XZ6 A;  5AFL A;  3UU5 A;  2BYN A;  3JAE A;  4NPP A;  4ALX A;  4Z90 A;  2XQ9 A;  2BG9 B;  5SYO A;  4AFG A;  4TNW A;  3UU4 A;  4PIR A;  4HQP A;  3UU3 A;  3ZDG A;  4ILA A;  5HCJ A;  5AFK A;  4TWH A;  3T4M A;  2VL0 A;  5HEG A;  3C79 A;  2WN9 A;  5FJV A;  3SQ6 A;  2BJ0 A;  2W8G A;  4X5T A;  2WNC A;  4TWF A;  2XQ3 A;  3U8M A;  2MAW A;  5HEO A;  2XQ6 A;  3RHW A;  5HCM A;  5L4E A;  3TLT A;  4ZZC A;  2M6I A;  3TLS A;  4UY2 A;  4FRR A;  2Y57 A;  2BG9 E;  2YN6 A;  4A98 A;  5HEJ A;  5AFM A;  4ZJT A;  3P4W A;  4LMJ A;  3RIF A;  3WTL A;  4IL9 A;  3C84 A;  3GUA A;  4AFH A;  3WTK A;  2XZ5 A;  2YKS A;  1UX2 A;  5CFB A;  3UQ4 A;  3IGQ A;  5BRX A;  4ZJS A;  2XNV A;  4UM3 P;  5L47 A;  2BYQ A;  4XHE A;  4ZK4 A;  2UZ6 A;  2LKH A;  4COF A;  2XQ5 A;  3TLV A;  3RQU A;  5J5G A;  2X00 A;  4ZR6 A;  4EZ1 A;  4BFQ A;  3SQ9 A;  2Y56 A;  5AFM B;  4ZRU A;  3RQW A;  1I9B A;  5AFH A;  4HFC A;  4HFE A;  1OED C;  5HEU A;  3SH1 A;  5J5F A;  3WTI A;  4Z91 A;  2PH9 A;  2XQ7 A;  3WTH A;  2W8F A;  4F8H A;  5AFN A;  2LM2 A;  3RI5 A;  3RIA A;  2LLY A;  3U8N A;  2XNT A;  5JME A;  5IUX A;  5BW2 A;  3EI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...