3TLUA

The glic pentameric ligand-gated ion channel loop2-24' oxidized mutant in a locally-closed conformation (lc1 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPCTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tluA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tluA01
3WTJA 5BW2A 4TWDA 2XQ6A 4X5TA 1I9BA 3TLWA 3JAFA 4TWHA 4UXUA 3C84A 2XZ6A 2XQ8A 4QH5A 3U8JA 3RQWA 3SQ6A 2WNCA 3UUBA 3ZDGA 3UQ7A 2ZJUA 4QAAA 5SYOA 5CO5A 4UM3A 4ALXA 4HFDA 4QABA 3RI5A 2XQAA 2MAWA 5HCJA 5CFBA 4ZR6A 5HEHA 3RQUA 4AFTA 1OEDE 5AFMA 3IGQA 3JAEA 4PIRA 3EAMA 4TWFA 3WIPA 5AFHA 2BG9B 2XQ5A 2XQ9A 3SQ9A 4TNVA 4Z91A 2BYRA 2YMEA 4NZBA 2BYSA 4UM1A 1UX2A 2XNTA 2KSRA 3P4WA 4A98A 2BJ0A 3TLTA 2PH9A 2W8GA 5KZUA 3ZKRA 5AFNA 2XQ4A 5LXBA 4XK9A 3P50A 2WN9A 2WZYA 5HEOA 5L4HA 4HFIA 4A97A 3PEOA 4AFHA 3RIFA 5HEUA 2QC1B 2M6BA 4ZZCA 2WNLA 4IREA 3U8LA 3WTHA 2BG9C 2Y56A 4UM3S 2LM2A 5HCMA 5J0ZA 2XYSA 2BG9A 5J5HA 2ZJVA 4AFGA 5L4EA 4WV9A 5J5IA 3EI0A 3U8NA 4ZK4A 5FJVA 5AINA 4UM3P 4HFCA 4LMLA 2XZ5A 5IUXA 5L47A 2YOEA 4F8HA 4B5DA 5KE4A 3TLSA 4QACA 4ZJSA 3TLUA 2Y58A 3TLVA 4BFQA 2BYNA 4ZJTA 3U8MA 4TNWA 4ILCA 3WTOA 5JMEA 5J5FA 4HFEA 5LG3A 2PGZA 3T4MA 2BR8A 4D01A 3UU3A 4BQTA 2BG9E 4ILBA 3C79A 3WTNA 4HFHA 2Y7YA 4DBMA 2XQ3A 4IL4A 1UW6A 2X00D 2XYTA 5HEJA 3PMZA 5J5GA 5AFLA 1OEDB 4ZRUA 2XQ7A 3WTLA 5BRXA 2VL0A 2W8FA 3EHZA 4Z90A 2XNVA 2LKHA 2C9TA 4COFA 4HQPA 5TVCA 2WNJA 2M6IA 4HFBA 4ILAA 3U8KA 3RHWA 4EZ1A 2BR7A 4UY2A 3WTKA 5HEGA 3UU8A 5BP0A 4LMKA 4ZK1A 2LKGA 2YN6A 3SIOA 2X00A 4QH4A 4LMJA 3WTIA 3UQ4A 4QH1A 4ZZBA 3GUAA 2BYQA 3WTMA 3JADA 4FRRA 4NPPA 5AFMB 3UU5A 5AFJA 1OEDC 3SH1A 2Y57A 2BYPA 3ZDHA 3RIAA 1UV6A 2LLYA 2YKSA 3LSVA 2XNUA 2YMDA 2Y54A 5AFKA 3UU6A 1OEDA 4XHEA 2UZ6A 4IL9A 3UU4A
chains in the Genus database with same CATH superfamily
4ASKA 2L8KA 4QKNA 3LG7A 4ZI2C 4UF0A 1E7PA 2HH7A 2A72A 1AJ3A 2N2NA 2N1GA 3UUXB 4IDPA 3ZEFB 5HEHA 4XZCA 5FVLA 1NEKA 2XQ5A 4DV3T 5JDNA 4MHCA 2XZEA 4U33A 3LK2B 1Y64B 1YKHB 3MZKB 2PH9A 4PJJA 4ZOLE 3OVUA 4P1NA 1XNQT 5DJQC 2DNXA 2CE7A 4KI0F 4X66T 2LM2A 1HR0T 3RYFE 3ZMUB 3EI0A 2ACZA 2IC6A 3U3IA 2YK0A 5IUXA 1O3XA 5L3EB 5TAOA 2JMHA 4UEMA 2WMOA 3T4MA 4X62T 2LSKA 3C79A 2CBJA 5AQKB 5BRXA 3KV4A 5EK4A 3AAAB 4YSYA 1Z0PA 1T8BA 4ILAA 2BR7A 4UF0B 1MMGA 5HEGA 3UU8A 3RGLA 1WFDA 5AQGB 1SA0E 4U72A 3LSVA 2LOPA 3VHLA 2LRLA 4AXPA 3SOLA 3N5LA 4ZEYA 4AKHA 1JNZA 1M62A 1VCSA 3VR8A 4GYSA 3ZDGA 3UQ7A 2NTYA 2CXFA 4DR6T 4EEBA 1MNDA 3LK42 5LHIB 2PTFA 2YDQA 1XDPA 3OTOT 2BJ0A 4HE8A 2X67A 1HG2A 2WNLA 2E5LT 3GN5A 1WR0A 5DQWA 1L0VA 2XYSA 2PBIA 2X9YA 2NW7A 4I4TE 2H88A 5L3DB 2CLYB 1X9BA 2K3WA 3ANWA 4X64T 3EDVA 2MOZA 3ZN1B 2PGZA 2CWOA 3MK7C 3N9LA 1LVKA 4DBMA 3VKHA 3KDSE 3PMZA 3RIUC 3WTLA 2ES0A 4NUVA 2NTXA 4HFBA 4U74A 2WWVA 4O4HE 2W4XA 1D1AA 4QH1A 3D0TA 4TN7B 1MNEA 4FRRA 4CXXA 4ZI3C 3ZDHA 1MMNA 4YT0A 4ZXLA 3N2GE 3UU4A 2LM9A 4U2YA 3ONXA 1XNRT 2AXDS 2FUPA 2JPFA 3PU8A 3RQWA 2E9XB 1T72A 2VL8A 1US7B 4DR7T 5AQSB 5HCJA 4PFPA 3GN5B 4AQFC 5IWAT 1J1JA 4I43B 2YMEA 2BYSA 4ERRA 2K24A 2BBHA 5CJ5A 3L8RA 4A98A 3ANWB 2V7IA 4YHJA 3TLTA 3RLFF 2IC9A 5L4HA 2EHOA 2QC1B 4DV4T 2NP9A 3NBXX 1LVFA 1QUUA 5LHGB 5F8PA 3P4RA 5JDFA 3CMLA 5FP3A 2CPTA 2PG8A 4F8HA 4QACA 4KP3C 4IE5A 5JDHA 2D2SA 2W66A 4P0AA 2JQKA 3KV6A 4LFCT 4KUMB 4IL4A 2Y48B 5BMVE 5E0OA 1CUNA 2ACXA 4YJ3E 5LA6E 2CLYC 2RPAA 1FEWA 1UX5A 3WTKA 4OX9T 4E7ZA 4CN6A 4KHPT 4JI2T 5CA1E 3PUSA 2XNUA 3PDYA 3TKLB 2ZLYA 1I9BA 3A8YC 3C64A 3H3AA 3NKZA 3TLWA 3VKGA 2W62A 2HHHT 2UU9T 3KBUA 2OV9A 1YQ4A 1WRDA 4WZXA 2EHOB 5L3GB 4HWCA 4LFBT 3O1HA 2DLRA 5LJMA 5HAXA 1E2AA 4UM1A 4LF9T 4DV1T 5AFUL 1UUSA 5JDGA 1I94T 3QK6A 2E9XC 4IDZA 3QOFA 1KNZA 3NZQA 2WZYA 2WP9A 2DWKA 3KV9A 3K3NA 2VWAA 2A2FX 3RRWA 3H37A 4O4IE 5FMNA 4JEUB 5JTGA 4CI3B 3C98B 3BQLA 5L4EA 4UVCB 3KFWX 3U8NA 4UELA 4WNKA 2UXXB 3AE3A 2XAFB 5LP6E 4BFQA 4ZJTA 4TNWA 1BR0A 3PURA 2J1DG 3RYCE 2QA7A 3AEAA 3ZJ2A 3SS1A 2JQHA 3C4WA 4CI1B 3AECA 3PUXF 2M6IA 5H6QB 1XDOA 1D0ZA 2CXDA 1ZV4X 4JI5T 5LGUB 4DV2T 2LJLA 4JEHB 2X9WA 5HWXA 3UU5A 5LXBA 3RIAA 2BDEA 4XBFB 2XQ6A 3T8OA 2KLQA 3ZN0B 4PFOA 4NXNT 3PUAA 3N9PA 3RI5A 4ZR6A 4H63H 1LKXA 3I0QA 1R8IA 4GYRA 5L3CB 4YLHA 4JLEA 4MBQA 3F31A 4AKIA 3V5SA 3CX6B 2V5DA 4JYAT 2KNDA 1HCIA 4DMWA 2X9HA 4P0BA 2XASB 2VVNA 4YTNA 5LYJE 2EHOC 3PEOA 1YKEB 3UULA 2IIUA 4TV8E 4QXCB 2Y56A 2V6XA 2ZJVA 1W9RA 3P4SA 3FBZA 5J5IA 2D0TA 2ODVA 4NXMT 3S4UA 5FVKA 4U3CA 3EVYA 3AE8A 5AQRB 2CMRA 4NIQA 3AE1A 3ZMVB 5A1LA 3FZKB 4EAHA 4DUZT 3AEGA 4HQPA 1HS7A 2WB5A 3P4PA 3ZCIA 5FYMA 3B57A 2C0SA 3UFEA 3DTOA 2W61A 3ZC1A 3ZPOA 2LLYA 3CK6A 4PK4A 2WDQA 3VU7H 1SHZC 4C90A 5L2LA 3P8CD 2UZ6A 2KMFA 5BW2A 4TWDA 2LT3A 3AXJA 4DR1T 3JAFA 4ANJA 4QABA 3AEFA 2XQAA 3ZC0A 3BQIA 3OJAA 2VKJA 3WI3A 2JMKA 1OWAA 4TNVA 2WBLA 3UUMA 2NWBA 2LSJA 1B7TA 3SFDA 1ZOYA 2XAQB 4MFRA 2FBWA 3ZYLA 3AE7A 2I59A 3QB5A 3MJXA 5J5HA 3JCFA 4KX6A 2MTQA 3RRCA 4CN1A 4IE6A 3VRAA 1D1BA 4X65T 4IIJE 1S35A 3EABA 2E2AA 2HPLA 2CEAA 1FIOA 4LFAT 2Y7YA 1UX4A 4GK5E 2C5KT 4Z90A 1UCUA 5TVCA 2YU1A 3AXJB 1VCTA 4H9PC 2CXLA 3NVOA 2BKOA 2YN6A 3SIOA 5KMGP 3VR9A 2LSYA 4P09A 3I9WA 2QYWA 2WQYA 4NPPA 4CXWA 1NWMX 2QGSA 4EIWA 3J9X1 1QSDA 2XQYA 4QXBB 2XAGB 5H6RB 3ZYMA 4YSZA 2J47A 5LXTE 3GA8A 5FL1A 5HXEA 1XMOT 2BBJA 4E7SA 3N2KE 2W2UA 1D0YA 1YQ3A 5KX5E 3OYZA 3PUQA 1HF8A 3MA9A 1HNZT 4X1KE 2XPKA 3KV5A 5AQFB 4AI6A 3Q9DA 3IEEA 2DI4A 1KEYA 3N2OA 4JI8T 4IE7A 2UXDT 5CGMA 3UT5E 2V8SV 5AINA 3AA0B 3RC8A 3O9XA 4ZI7E 2XZ5A 3FXEB 3FB2A 4YHHT 3DP7A 2BYNA 1BR4A 1FMVA 2M67A 3KVBA 2ZMAA 4IDOA 4DUYT 1UW6A 4U7YA 5L3BB 5AQHB 2VL0A 2BS2A 2CA5A 5AQJB 2FJEA 3KVAA 2KZ7B 4AQYT 3JADA 3HKEE 3IHRA 3L3PA 4WBOA 2WSSV 4ISTA 3UU6A 5HXCA 3ETUA 3RYIE 1CHUA 3AEDA 4ZHQE 4F6RC 1HG5A 2K9AA 4UM3A 2L9QA 2P9BA 4B3MT 1Y01A 4UXNB 3IGQA 2H7VC 4U7IA 2UXBT 3SQ9A 5LNKA 2BYRA 2IHR1 4Z91A 2J62A 4HTEA 2VKOA 5ABFA 2VKDA 4IT4A 4BJNA 2YU2A 3ZLIA 4A97A 2A9UA 4J2CA 1BR1A 4ZZCA 3EDUA 2DWGA 4H63V 3SRZA 1W0AA 4UM3P 1NENA 2XM2A 3L09A 4CI2B 3RX6A 2WS3A 4QXHB 3T1YT 1OXZA 2DL1A 4B3RT 2B1EA 4HFEA 2CWYA 4HEAA 4D01A 3UU3A 4BQTA 2X00D 2D9DA 2XQ7A 2ZM8A 2W8FA 3ZMTB 4WW0A 4UY2A 3ETVA 2CM0A 4ZZBA 4JBWF 3AE9A 1HFAA 2X0HA 5AQLB 4EYYR 2RA1A 1D1CA 2YKSA 2LRKA 2X9XA 5CB4E 5AQIB 4UV8B 4K0UA 4IL9A 5IYZE 1HTJF 2MBGA 5ABFB 4TWHA 4A5XA 1WCRA 2XZ6A 1WLXA 3MXZA 4OK0A 3IA3A 1EZ3A 1M7KA 3T1HT 3K1SA 4AKRB 3I9YA 3OPCA 4I0UA 4WYVA 4YFSA 2CBIA 3E22E 4TWFA 5AFHA 4EYUA 4LF4T 3PUWF 3PV0F 4QX8B 3HA4A 2JQ9A 3RYHE 1VRBA 5EK2A 5J2UE 1FJGT 3CQCB 2QRXA 1ZP0A 2XQ4A 2XY8B 2FJBA 2WN9A 4WBNE 3ZYKA 3O1IA 2XTLA 3AAEB 2BS4A 3KINB 4AFGA 2XAJB 2LSIA 1MIYA 4HFCA 1MIWA 1W0BA 2WDRA 2WMNA 4Q25A 4ILCA 5J5FA 4HN9A 4IDQA 3FZHB 1T98A 4DIDB 4JV5T 2UUCT 4DV5T 2LOSA 3ZMSB 4H9SE 4ZRUA 2OA5A 3Q5WA 1U4QA 3ZT7A 4CQIA 4EB6E 4COFA 3J7Yq 4X1YE 4MALA 5M4YA 1IBLT 4DV0T 1HX1B 3C4XA 5LMUT 1KFYA 2E9XD 3HKBE 2DHRA 2YMDA 2CHNA 2X0LB 3A5XA 1S94A 2I0MA 3AE5A 4DV7T 3G06A 1MMAA 4IGUA 3UUBA 3W15B 5CO5A 4ALXA 4HWHA 3CPZA 3CQGB 5CFBA 5DQVA 4PK5A 5ABGA 4TV9E 4EGWA 2OLTA 4O2BE 4YSXA 2XQ9A 2K48A 2NOXA 5LBMA 2A3DA 3AB3B 3JC6D 1UX2A 4CXYA 2V7JA 4OYKA 3NZPA 5AFNA 4KHZF 3GMIA 2N9DA 3MKDA 1ZKEA 4ILUA 3U8LA 3AEEA 3N9NA 4UV9B 4AIUA 2UXNB 4EZHA 3LBXA 1U5PA 2I6HA 4UIGA 2MPKA 4DVDA 2V7LA 5F3JA 4X1IE 1IAPA 3E0ZA 5HEJA 2C5JA 3HKCE 4H9OC 5AFLA 1YD8G 3FZFB 4G2AA 5LGNB 4DBQA 5ABEA 3SFEA 1HNWT 3E08A 4ZK1A 3RPUA 1YXRA 2LE8A 5HWYA 2Y57A 2XAHB 4PAGA 2BYPA 5AFKA 2XUEA 2BVMA 3F57A 4X20E 1J5ET 3NRXA 3WTJA 1IBKT 4JI6T 1UGOA 4UXUA 3SQ6A 4I55E 2NW9A 2Q9QD 3R6NA 5LMNT 4H9QC 3O1JA 4HFDA 2MAWA 5FKYA 3UFGA 3I0OA 4PIRA 2H89A 2CRBA 2E5VA 2KXPB 3LFMA 3R84B 2X68A 3ZMZB 4LF7T 4KBMB 2YEVC 2ZM2A 3C51A 2UUBT 2V7KA 3KBTA 5J2TE 3PE0A 2VASA 2IUBA 4GKJT 1VOMA 3CQXC 3IF8B 3FBLA 2BG9A 4DNDA 3RIUA 2JQQA 4AQGA 4IE0A 3RC3A 1IJ6A 4ZK4A 4LMLA 4DMVA 2BVLA 1Z8UA 4PK6A 4B5DA 4OYJA 3TLUA 2K5BB 5IHYA 2XSAA 2BR8A 1N33T 2D0UA 5LHHB 3PUGA 5J5GA 2GK9A 5FL0A 5BR8T 3Q5EA 2LSGA 3U8KA 4U31A 4BAYB 4C91A 4AISA 2ZM0A 2X00A 3C4ZA 4UVBB 3DJBA 3GUAA 4AKLA 4ZI2D 3FXDB 4B3TT 5AFJA 2XM1A 4AQFA 1UV6A 1OEDA 4PW8A 3OBVE 3U8JA 4HFVA 1N36T 4QAAA 5SYOA 3CX8B 4JI7T 4LF5T 2BZBA 5AQTB 4YXDA 2X0YA 1XMQT 5HXHA 4H9NC 2V6YA 2BG9B 3M3ZB 1N32T 1DU2A 2VQET 1KK7A 2C5IT 2DCFA 2KSRA 5AQMB 3ZT5A 3A7MA 3ABVA 1E1HB 3ZT6A 3P50A 5HEOA 4HFIA 5FNVE 3RIFA 3ZCJA 4YTMA 4FI5A 4PJMA 1UURA 1BR2A 1X79A 3FZLB 4ZS2A 1UK5A 2KINB 4WV9A 1G8XA 5C2TA 4HWDA 4M1PA 4IE4A 5EK3A 5JR9A 4JUYA 3TLSA 2Y58A 5JRCA 3U8MA 3K3QC 1J5WA 2XQ3A 4IHJE 1H7CA 2IMLA 2NR4A 1OEDB 2KWIB 2LKHA 3ONJA 2C9TA 2BS3A 4YJ2E 4YTPA 2ZM6T 3IBPA 1WYBA 4UR9A 4BJMA 4QH4A 4LMJA 3WTIA 5ABHA 3ZSSA 4DBRA 4CN4A 2V6YB 2F4VT 2V26A 3NWIA 1QLBA 3U78A 2WAUA 5C3JA 2W00A 4OHFA 4O2AE 3C84A 2XQ8A 3CWZB 2E9XA 2V7MA 4AKGA 5DABA 4TUYE 5HXSA 3RQUA 1IJ5A 5HYAA 2LEHA 3WIPA 5LCYA 4EXTA 4GK0E 1SE7A 3P4QA 2WZIA 4LF6T 1GQEA 3PUYF 2XNTA 5JR9B 2UUAT 1SUMB 3ZKRA 2W67A 5JRCB 5AQUB 2PJQA 3GWHA 5LGTB 2BG9C 5LBQB 4UVAB 3PUZF 4ADZA 2WY2A 3Q2MA 2Y6XA 5GONE 4JI4T 2YDRA 2BKPA 3NRYA 4EZ4A 2W0GA 3RF1A 5FY1A 3RH3A 5FXVA 5LG3A 2BG9E 1WYCA 1KNPA 2XNVA 1HX8A 2RP4A 4ZI3D 3WAKA 2FJAA 4CZZB 3FHNA 2WM9A 4TZ4C 3H3MA 1I6ZA 3QB5K 5AQVB 3B5MA 5FY0A 2W63A 1OEDC 3ONLC 3LDQB 2BKNA 3RKOA 3I1AA 4IDNA 2QVAA 5LB7B 4QH5A 1XZYA 3HI2A 3UTKA 2ZJUA 3HKDE 4B3ST 2WCAA 3F2EA 1OEDE 2Z6EA 3JAEA 3EAMA 5CA0E 2B76A 4PJNA 4B6XA 3O4XE 2H3RA 4GKKT 2H7OA 2Q9QA 2YDSA 4HGAA 4JI0T 3ZJ1A 3AEBA 4U2ZA 2D5UA 3HR0A 4AFHA 2ODUA 2M6BA 2MYSA 2X51A 2LHRA 5FY7A 3CKDA 5J0ZA 2JRKA 3ESLA 4DR2T 4DR3T 1N34T 5JR9C 3PJAJ 5KE4A 2VKHA 3TLVA 5L3FB 5LOVE 4L0RA 3WTNA 5J1GA 2XYTA 3N9QA 2WWUA 3AA7B 3BQKA 2VQFT 2FJDA 3FZMB 1V9DA 2LKGA 2PFVA 4PJLA 3AE6A 1JNRA 1MIVA 4O4LE 5HXRA 4ISSA 2XHEB 1MMDA 3WAJA 2VK9A 5ETWA 3Q5XA 2IAKA 2Y54A 2YINA 3X1DA 1YW0A 1KF6A 4XHEA 2WU2A 2Q9QB 3AE2A 4X5TA 4LF8T 3MACA 5KDMC 3AVRA 3LJCA 3AA1B 2V5CA 5FXZA 3PU3A 5AQNB 1HNXT 5JVDE 4H9RC 1IBMT 4I50E 3P7IA 2J4GA 2G0UA 4AFTA 5EZYE 1KNRA 4KMCA 4MLKA 2HN1A 5F5WA 5AQOB 4HWIB 2R6GF 3P4WA 4HWFA 2W8GA 4DO0A 4QWNB 4XK9A 1ZHCA 5JDLA 4K0KT 4N78D 3JC6C 4IREA 3WTHA 4XAXB 3V5UA 4DR4T 2VVSA 3AAIA 4UM3S 5HCMA 5C8YE 2VB6A 2HN2A 3PTRB 3OYXA 2V1DB 3HL6A 3AA6B 3ZSTA 2JJ9A 2JIWA 4G63A 4ZJSA 4PNIA 3QC9A 2WDVA 4NUUA 3WTOA 5JMEA 3CVRA 1XWMA 4TX5A 4EEDA 4HFHA 2IDOB 1IZNB 1LRZA 1ZEEA 3BK9A 4O4JE 4BA9A 4L9IA 3CIRA 3RKGA 3RHWA 2XSBA 5JH7E 2KWHA 5BP0A 5JDQA 4JI1T 3QNUA 2VURA 4L5GA 4YY3T 5LG4A 2WU5A 2Y8DA 4GOUA 1W09A 2CCQA 3UQ4A 3WTMA 2BYQA 4A56A 1WR6A 4V1Av 3B13A 1NAFA 3AE4A 1D0XA 3CX7B 4Z8XA 2WNCA 2NW8A 3EUHA 3M65A 1G73A 3PJAA 1FMWA 2SPCA 5AFMA 4HKAA 2EHOD 4GIWA 4EV6A 4NZBA 5AQQB 2Q9QC 2CHOA 3K8PC 3AVSA 2XJ7A 4EOZB 3N9OA 3L39A 5JREA 5KXJA 2KT9A 5KZUA 3Q5DA 2HPJA 2LHNA 4FJOA 4OFZA 5HEUA 3C50A 5FXWA 5ADXL 3PUVF 5AQPB 3VRBA 4DV6T 4ZS3A 2AE9A 1T7SA 5FJVA 5JDMA 5JQGE 5L47A 2YOEA 3LBXB 3SWHA 2X66A 4ILBA 3EHZA 3K3OA 2IW5B 2WNJA 4QX7B 4EZ1A 2UXCT 4QHOA 4LMKA 2WZHA 5LJNA 3OKQA 2E8IA 4O8SA 5FXXA 4DR5T 2L3LA 3UUNA 5AFMB 3SH1A 3N9MA 3LK3B 3QUJA 4JI3T
chains in the Genus database with same CATH topology
3WTJA 5BW2A 4TWDA 2XQ6A 4X5TA 1I9BA 3TLWA 3JAFA 4TWHA 4UXUA 3C84A 2XZ6A 2XQ8A 4QH5A 3U8JA 3RQWA 3SQ6A 2WNCA 3UUBA 3ZDGA 3UQ7A 2ZJUA 4QAAA 5SYOA 5CO5A 4UM3A 4ALXA 4HFDA 4QABA 3RI5A 2XQAA 2MAWA 5HCJA 5CFBA 4ZR6A 5HEHA 3RQUA 4AFTA 1OEDE 5AFMA 3IGQA 3JAEA 4PIRA 3EAMA 4TWFA 3WIPA 5AFHA 2BG9B 2XQ5A 2XQ9A 3SQ9A 4TNVA 4Z91A 2BYRA 2YMEA 4NZBA 2BYSA 4UM1A 1UX2A 2XNTA 2KSRA 3P4WA 4A98A 2BJ0A 3TLTA 2PH9A 2W8GA 5KZUA 3ZKRA 5AFNA 2XQ4A 5LXBA 4XK9A 3P50A 2WN9A 2WZYA 5HEOA 5L4HA 4HFIA 4A97A 3PEOA 4AFHA 3RIFA 5HEUA 2QC1B 2M6BA 4ZZCA 2WNLA 4IREA 3U8LA 3WTHA 2BG9C 2Y56A 4UM3S 2LM2A 5HCMA 5J0ZA 2XYSA 2BG9A 5J5HA 2ZJVA 4AFGA 5L4EA 4WV9A 5J5IA 3EI0A 3U8NA 4ZK4A 5FJVA 5AINA 4UM3P 4HFCA 4LMLA 2XZ5A 5IUXA 5L47A 2YOEA 4F8HA 4B5DA 5KE4A 3TLSA 4QACA 4ZJSA 3TLUA 2Y58A 3TLVA 4BFQA 2BYNA 4ZJTA 3U8MA 4TNWA 4ILCA 3WTOA 5JMEA 5J5FA 4HFEA 5LG3A 2PGZA 3T4MA 2BR8A 4D01A 3UU3A 4BQTA 2BG9E 4ILBA 3C79A 3WTNA 4HFHA 2Y7YA 4DBMA 2XQ3A 4IL4A 1UW6A 2X00D 2XYTA 5HEJA 3PMZA 5J5GA 5AFLA 1OEDB 4ZRUA 2XQ7A 3WTLA 5BRXA 2VL0A 2W8FA 3EHZA 4Z90A 2XNVA 2LKHA 2C9TA 4COFA 4HQPA 5TVCA 2WNJA 2M6IA 4HFBA 4ILAA 3U8KA 3RHWA 4EZ1A 2BR7A 4UY2A 3WTKA 5HEGA 3UU8A 5BP0A 4LMKA 4ZK1A 2LKGA 2YN6A 3SIOA 2X00A 4QH4A 4LMJA 3WTIA 3UQ4A 4QH1A 4ZZBA 3GUAA 2BYQA 3WTMA 3JADA 4FRRA 4NPPA 5AFMB 3UU5A 5AFJA 1OEDC 3SH1A 2Y57A 2BYPA 3ZDHA 3RIAA 1UV6A 2LLYA 2YKSA 3LSVA 2XNUA 2YMDA 2Y54A 5AFKA 3UU6A 1OEDA 4XHEA 2UZ6A 4IL9A 3UU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTJ A;  5BW2 A;  4TWD A;  2XQ6 A;  4X5T A;  1I9B A;  3TLW A;  3JAF A;  4TWH A;  4UXU A;  3C84 A;  2XZ6 A;  2XQ8 A;  4QH5 A;  3U8J A;  3RQW A;  3SQ6 A;  2WNC A;  3UUB A;  3ZDG A;  3UQ7 A;  2ZJU A;  4QAA A;  5SYO A;  5CO5 A;  4UM3 A;  4ALX A;  4HFD A;  4QAB A;  3RI5 A;  2XQA A;  2MAW A;  5HCJ A;  5CFB A;  4ZR6 A;  5HEH A;  3RQU A;  4AFT A;  1OED E;  5AFM A;  3IGQ A;  3JAE A;  4PIR A;  3EAM A;  4TWF A;  3WIP A;  5AFH A;  2BG9 B;  2XQ5 A;  2XQ9 A;  3SQ9 A;  4TNV A;  4Z91 A;  2BYR A;  2YME A;  4NZB A;  2BYS A;  4UM1 A;  1UX2 A;  2XNT A;  2KSR A;  3P4W A;  4A98 A;  2BJ0 A;  3TLT A;  2PH9 A;  2W8G A;  5KZU A;  3ZKR A;  5AFN A;  2XQ4 A;  5LXB A;  4XK9 A;  3P50 A;  2WN9 A;  2WZY A;  5HEO A;  5L4H A;  4HFI A;  4A97 A;  3PEO A;  4AFH A;  3RIF A;  5HEU A;  2QC1 B;  2M6B A;  4ZZC A;  2WNL A;  4IRE A;  3U8L A;  3WTH A;  2BG9 C;  2Y56 A;  4UM3 S;  2LM2 A;  5HCM A;  5J0Z A;  2XYS A;  2BG9 A;  5J5H A;  2ZJV A;  4AFG A;  5L4E A;  4WV9 A;  5J5I A;  3EI0 A;  3U8N A;  4ZK4 A;  5FJV A;  5AIN A;  4UM3 P;  4HFC A;  4LML A;  2XZ5 A;  5IUX A;  5L47 A;  2YOE A;  4F8H A;  4B5D A;  5KE4 A;  3TLS A;  4QAC A;  4ZJS A;  3TLU A;  2Y58 A;  3TLV A;  4BFQ A;  2BYN A;  4ZJT A;  3U8M A;  4TNW A;  4ILC A;  3WTO A;  5JME A;  5J5F A;  4HFE A;  5LG3 A;  2PGZ A;  3T4M A;  2BR8 A;  4D01 A;  3UU3 A;  4BQT A;  2BG9 E;  4ILB A;  3C79 A;  3WTN A;  4HFH A;  2Y7Y A;  4DBM A;  2XQ3 A;  4IL4 A;  1UW6 A;  2X00 D;  2XYT A;  5HEJ A;  3PMZ A;  5J5G A;  5AFL A;  1OED B;  4ZRU A;  2XQ7 A;  3WTL A;  5BRX A;  2VL0 A;  2W8F A;  3EHZ A;  4Z90 A;  2XNV A;  2LKH A;  2C9T A;  4COF A;  4HQP A;  5TVC A;  2WNJ A;  2M6I A;  4HFB A;  4ILA A;  3U8K A;  3RHW A;  4EZ1 A;  2BR7 A;  4UY2 A;  3WTK A;  5HEG A;  3UU8 A;  5BP0 A;  4LMK A;  4ZK1 A;  2LKG A;  2YN6 A;  3SIO A;  2X00 A;  4QH4 A;  4LMJ A;  3WTI A;  3UQ4 A;  4QH1 A;  4ZZB A;  3GUA A;  2BYQ A;  3WTM A;  3JAD A;  4FRR A;  4NPP A;  5AFM B;  3UU5 A;  5AFJ A;  1OED C;  3SH1 A;  2Y57 A;  2BYP A;  3ZDH A;  3RIA A;  1UV6 A;  2LLY A;  2YKS A;  3LSV A;  2XNU A;  2YMD A;  2Y54 A;  5AFK A;  3UU6 A;  1OED A;  4XHE A;  2UZ6 A;  4IL9 A;  3UU4 A; 
#chains in the Genus database with same CATH topology
 4ASK A;  2L8K A;  4QKN A;  3LG7 A;  4ZI2 C;  4UF0 A;  1E7P A;  2HH7 A;  2A72 A;  1AJ3 A;  2N2N A;  2N1G A;  3UUX B;  4IDP A;  3ZEF B;  5HEH A;  4XZC A;  5FVL A;  1NEK A;  2XQ5 A;  4DV3 T;  5JDN A;  4MHC A;  2XZE A;  4U33 A;  3LK2 B;  1Y64 B;  1YKH B;  3MZK B;  2PH9 A;  4PJJ A;  4ZOL E;  3OVU A;  4P1N A;  1XNQ T;  5DJQ C;  2DNX A;  2CE7 A;  4KI0 F;  4X66 T;  2LM2 A;  1HR0 T;  3RYF E;  3ZMU B;  3EI0 A;  2ACZ A;  2IC6 A;  3U3I A;  2YK0 A;  5IUX A;  1O3X A;  5L3E B;  5TAO A;  2JMH A;  4UEM A;  2WMO A;  3T4M A;  4X62 T;  2LSK A;  3C79 A;  2CBJ A;  5AQK B;  5BRX A;  3KV4 A;  5EK4 A;  3AAA B;  4YSY A;  1Z0P A;  1T8B A;  4ILA A;  2BR7 A;  4UF0 B;  1MMG A;  5HEG A;  3UU8 A;  3RGL A;  1WFD A;  5AQG B;  1SA0 E;  4U72 A;  3LSV A;  2LOP A;  3VHL A;  2LRL A;  4AXP A;  3SOL A;  3N5L A;  4ZEY A;  4AKH A;  1JNZ A;  1M62 A;  1VCS A;  3VR8 A;  4GYS A;  3ZDG A;  3UQ7 A;  2NTY A;  2CXF A;  4DR6 T;  4EEB A;  1MND A;  3LK4 2;  5LHI B;  2PTF A;  2YDQ A;  1XDP A;  3OTO T;  2BJ0 A;  4HE8 A;  2X67 A;  1HG2 A;  2WNL A;  2E5L T;  3GN5 A;  1WR0 A;  5DQW A;  1L0V A;  2XYS A;  2PBI A;  2X9Y A;  2NW7 A;  4I4T E;  2H88 A;  5L3D B;  2CLY B;  1X9B A;  2K3W A;  3ANW A;  4X64 T;  3EDV A;  2MOZ A;  3ZN1 B;  2PGZ A;  2CWO A;  3MK7 C;  3N9L A;  1LVK A;  4DBM A;  3VKH A;  3KDS E;  3PMZ A;  3RIU C;  3WTL A;  2ES0 A;  4NUV A;  2NTX A;  4HFB A;  4U74 A;  2WWV A;  4O4H E;  2W4X A;  1D1A A;  4QH1 A;  3D0T A;  4TN7 B;  1MNE A;  4FRR A;  4CXX A;  4ZI3 C;  3ZDH A;  1MMN A;  4YT0 A;  4ZXL A;  3N2G E;  3UU4 A;  2LM9 A;  4U2Y A;  3ONX A;  1XNR T;  2AXD S;  2FUP A;  2JPF A;  3PU8 A;  3RQW A;  2E9X B;  1T72 A;  2VL8 A;  1US7 B;  4DR7 T;  5AQS B;  5HCJ A;  4PFP A;  3GN5 B;  4AQF C;  5IWA T;  1J1J A;  4I43 B;  2YME A;  2BYS A;  4ERR A;  2K24 A;  2BBH A;  5CJ5 A;  3L8R A;  4A98 A;  3ANW B;  2V7I A;  4YHJ A;  3TLT A;  3RLF F;  2IC9 A;  5L4H A;  2EHO A;  2QC1 B;  4DV4 T;  2NP9 A;  3NBX X;  1LVF A;  1QUU A;  5LHG B;  5F8P A;  3P4R A;  5JDF A;  3CML A;  5FP3 A;  2CPT A;  2PG8 A;  4F8H A;  4QAC A;  4KP3 C;  4IE5 A;  5JDH A;  2D2S A;  2W66 A;  4P0A A;  2JQK A;  3KV6 A;  4LFC T;  4KUM B;  4IL4 A;  2Y48 B;  5BMV E;  5E0O A;  1CUN A;  2ACX A;  4YJ3 E;  5LA6 E;  2CLY C;  2RPA A;  1FEW A;  1UX5 A;  3WTK A;  4OX9 T;  4E7Z A;  4CN6 A;  4KHP T;  4JI2 T;  5CA1 E;  3PUS A;  2XNU A;  3PDY A;  3TKL B;  2ZLY A;  1I9B A;  3A8Y C;  3C64 A;  3H3A A;  3NKZ A;  3TLW A;  3VKG A;  2W62 A;  2HHH T;  2UU9 T;  3KBU A;  2OV9 A;  1YQ4 A;  1WRD A;  4WZX A;  2EHO B;  5L3G B;  4HWC A;  4LFB T;  3O1H A;  2DLR A;  5LJM A;  5HAX A;  1E2A A;  4UM1 A;  4LF9 T;  4DV1 T;  5AFU L;  1UUS A;  5JDG A;  1I94 T;  3QK6 A;  2E9X C;  4IDZ A;  3QOF A;  1KNZ A;  3NZQ A;  2WZY A;  2WP9 A;  2DWK A;  3KV9 A;  3K3N A;  2VWA A;  2A2F X;  3RRW A;  3H37 A;  4O4I E;  5FMN A;  4JEU B;  5JTG A;  4CI3 B;  3C98 B;  3BQL A;  5L4E A;  4UVC B;  3KFW X;  3U8N A;  4UEL A;  4WNK A;  2UXX B;  3AE3 A;  2XAF B;  5LP6 E;  4BFQ A;  4ZJT A;  4TNW A;  1BR0 A;  3PUR A;  2J1D G;  3RYC E;  2QA7 A;  3AEA A;  3ZJ2 A;  3SS1 A;  2JQH A;  3C4W A;  4CI1 B;  3AEC A;  3PUX F;  2M6I A;  5H6Q B;  1XDO A;  1D0Z A;  2CXD A;  1ZV4 X;  4JI5 T;  5LGU B;  4DV2 T;  2LJL A;  4JEH B;  2X9W A;  5HWX A;  3UU5 A;  5LXB A;  3RIA A;  2BDE A;  4XBF B;  2XQ6 A;  3T8O A;  2KLQ A;  3ZN0 B;  4PFO A;  4NXN T;  3PUA A;  3N9P A;  3RI5 A;  4ZR6 A;  4H63 H;  1LKX A;  3I0Q A;  1R8I A;  4GYR A;  5L3C B;  4YLH A;  4JLE A;  4MBQ A;  3F31 A;  4AKI A;  3V5S A;  3CX6 B;  2V5D A;  4JYA T;  2KND A;  1HCI A;  4DMW A;  2X9H A;  4P0B A;  2XAS B;  2VVN A;  4YTN A;  5LYJ E;  2EHO C;  3PEO A;  1YKE B;  3UUL A;  2IIU A;  4TV8 E;  4QXC B;  2Y56 A;  2V6X A;  2ZJV A;  1W9R A;  3P4S A;  3FBZ A;  5J5I A;  2D0T A;  2ODV A;  4NXM T;  3S4U A;  5FVK A;  4U3C A;  3EVY A;  3AE8 A;  5AQR B;  2CMR A;  4NIQ A;  3AE1 A;  3ZMV B;  5A1L A;  3FZK B;  4EAH A;  4DUZ T;  3AEG A;  4HQP A;  1HS7 A;  2WB5 A;  3P4P A;  3ZCI A;  5FYM A;  3B57 A;  2C0S A;  3UFE A;  3DTO A;  2W61 A;  3ZC1 A;  3ZPO A;  2LLY A;  3CK6 A;  4PK4 A;  2WDQ A;  3VU7 H;  1SHZ C;  4C90 A;  5L2L A;  3P8C D;  2UZ6 A;  2KMF A;  5BW2 A;  4TWD A;  2LT3 A;  3AXJ A;  4DR1 T;  3JAF A;  4ANJ A;  4QAB A;  3AEF A;  2XQA A;  3ZC0 A;  3BQI A;  3OJA A;  2VKJ A;  3WI3 A;  2JMK A;  1OWA A;  4TNV A;  2WBL A;  3UUM A;  2NWB A;  2LSJ A;  1B7T A;  3SFD A;  1ZOY A;  2XAQ B;  4MFR A;  2FBW A;  3ZYL A;  3AE7 A;  2I59 A;  3QB5 A;  3MJX A;  5J5H A;  3JCF A;  4KX6 A;  2MTQ A;  3RRC A;  4CN1 A;  4IE6 A;  3VRA A;  1D1B A;  4X65 T;  4IIJ E;  1S35 A;  3EAB A;  2E2A A;  2HPL A;  2CEA A;  1FIO A;  4LFA T;  2Y7Y A;  1UX4 A;  4GK5 E;  2C5K T;  4Z90 A;  1UCU A;  5TVC A;  2YU1 A;  3AXJ B;  1VCT A;  4H9P C;  2CXL A;  3NVO A;  2BKO A;  2YN6 A;  3SIO A;  5KMG P;  3VR9 A;  2LSY A;  4P09 A;  3I9W A;  2QYW A;  2WQY A;  4NPP A;  4CXW A;  1NWM X;  2QGS A;  4EIW A;  3J9X 1;  1QSD A;  2XQY A;  4QXB B;  2XAG B;  5H6R B;  3ZYM A;  4YSZ A;  2J47 A;  5LXT E;  3GA8 A;  5FL1 A;  5HXE A;  1XMO T;  2BBJ A;  4E7S A;  3N2K E;  2W2U A;  1D0Y A;  1YQ3 A;  5KX5 E;  3OYZ A;  3PUQ A;  1HF8 A;  3MA9 A;  1HNZ T;  4X1K E;  2XPK A;  3KV5 A;  5AQF B;  4AI6 A;  3Q9D A;  3IEE A;  2DI4 A;  1KEY A;  3N2O A;  4JI8 T;  4IE7 A;  2UXD T;  5CGM A;  3UT5 E;  2V8S V;  5AIN A;  3AA0 B;  3RC8 A;  3O9X A;  4ZI7 E;  2XZ5 A;  3FXE B;  3FB2 A;  4YHH T;  3DP7 A;  2BYN A;  1BR4 A;  1FMV A;  2M67 A;  3KVB A;  2ZMA A;  4IDO A;  4DUY T;  1UW6 A;  4U7Y A;  5L3B B;  5AQH B;  2VL0 A;  2BS2 A;  2CA5 A;  5AQJ B;  2FJE A;  3KVA A;  2KZ7 B;  4AQY T;  3JAD A;  3HKE E;  3IHR A;  3L3P A;  4WBO A;  2WSS V;  4IST A;  3UU6 A;  5HXC A;  3ETU A;  3RYI E;  1CHU A;  3AED A;  4ZHQ E;  4F6R C;  1HG5 A;  2K9A A;  4UM3 A;  2L9Q A;  2P9B A;  4B3M T;  1Y01 A;  4UXN B;  3IGQ A;  2H7V C;  4U7I A;  2UXB T;  3SQ9 A;  5LNK A;  2BYR A;  2IHR 1;  4Z91 A;  2J62 A;  4HTE A;  2VKO A;  5ABF A;  2VKD A;  4IT4 A;  4BJN A;  2YU2 A;  3ZLI A;  4A97 A;  2A9U A;  4J2C A;  1BR1 A;  4ZZC A;  3EDU A;  2DWG A;  4H63 V;  3SRZ A;  1W0A A;  4UM3 P;  1NEN A;  2XM2 A;  3L09 A;  4CI2 B;  3RX6 A;  2WS3 A;  4QXH B;  3T1Y T;  1OXZ A;  2DL1 A;  4B3R T;  2B1E A;  4HFE A;  2CWY A;  4HEA A;  4D01 A;  3UU3 A;  4BQT A;  2X00 D;  2D9D A;  2XQ7 A;  2ZM8 A;  2W8F A;  3ZMT B;  4WW0 A;  4UY2 A;  3ETV A;  2CM0 A;  4ZZB A;  4JBW F;  3AE9 A;  1HFA A;  2X0H A;  5AQL B;  4EYY R;  2RA1 A;  1D1C A;  2YKS A;  2LRK A;  2X9X A;  5CB4 E;  5AQI B;  4UV8 B;  4K0U A;  4IL9 A;  5IYZ E;  1HTJ F;  2MBG A;  5ABF B;  4TWH A;  4A5X A;  1WCR A;  2XZ6 A;  1WLX A;  3MXZ A;  4OK0 A;  3IA3 A;  1EZ3 A;  1M7K A;  3T1H T;  3K1S A;  4AKR B;  3I9Y A;  3OPC A;  4I0U A;  4WYV A;  4YFS A;  2CBI A;  3E22 E;  4TWF A;  5AFH A;  4EYU A;  4LF4 T;  3PUW F;  3PV0 F;  4QX8 B;  3HA4 A;  2JQ9 A;  3RYH E;  1VRB A;  5EK2 A;  5J2U E;  1FJG T;  3CQC B;  2QRX A;  1ZP0 A;  2XQ4 A;  2XY8 B;  2FJB A;  2WN9 A;  4WBN E;  3ZYK A;  3O1I A;  2XTL A;  3AAE B;  2BS4 A;  3KIN B;  4AFG A;  2XAJ B;  2LSI A;  1MIY A;  4HFC A;  1MIW A;  1W0B A;  2WDR A;  2WMN A;  4Q25 A;  4ILC A;  5J5F A;  4HN9 A;  4IDQ A;  3FZH B;  1T98 A;  4DID B;  4JV5 T;  2UUC T;  4DV5 T;  2LOS A;  3ZMS B;  4H9S E;  4ZRU A;  2OA5 A;  3Q5W A;  1U4Q A;  3ZT7 A;  4CQI A;  4EB6 E;  4COF A;  3J7Y q;  4X1Y E;  4MAL A;  5M4Y A;  1IBL T;  4DV0 T;  1HX1 B;  3C4X A;  5LMU T;  1KFY A;  2E9X D;  3HKB E;  2DHR A;  2YMD A;  2CHN A;  2X0L B;  3A5X A;  1S94 A;  2I0M A;  3AE5 A;  4DV7 T;  3G06 A;  1MMA A;  4IGU A;  3UUB A;  3W15 B;  5CO5 A;  4ALX A;  4HWH A;  3CPZ A;  3CQG B;  5CFB A;  5DQV A;  4PK5 A;  5ABG A;  4TV9 E;  4EGW A;  2OLT A;  4O2B E;  4YSX A;  2XQ9 A;  2K48 A;  2NOX A;  5LBM A;  2A3D A;  3AB3 B;  3JC6 D;  1UX2 A;  4CXY A;  2V7J A;  4OYK A;  3NZP A;  5AFN A;  4KHZ F;  3GMI A;  2N9D A;  3MKD A;  1ZKE A;  4ILU A;  3U8L A;  3AEE A;  3N9N A;  4UV9 B;  4AIU A;  2UXN B;  4EZH A;  3LBX A;  1U5P A;  2I6H A;  4UIG A;  2MPK A;  4DVD A;  2V7L A;  5F3J A;  4X1I E;  1IAP A;  3E0Z A;  5HEJ A;  2C5J A;  3HKC E;  4H9O C;  5AFL A;  1YD8 G;  3FZF B;  4G2A A;  5LGN B;  4DBQ A;  5ABE A;  3SFE A;  1HNW T;  3E08 A;  4ZK1 A;  3RPU A;  1YXR A;  2LE8 A;  5HWY A;  2Y57 A;  2XAH B;  4PAG A;  2BYP A;  5AFK A;  2XUE A;  2BVM A;  3F57 A;  4X20 E;  1J5E T;  3NRX A;  3WTJ A;  1IBK T;  4JI6 T;  1UGO A;  4UXU A;  3SQ6 A;  4I55 E;  2NW9 A;  2Q9Q D;  3R6N A;  5LMN T;  4H9Q C;  3O1J A;  4HFD A;  2MAW A;  5FKY A;  3UFG A;  3I0O A;  4PIR A;  2H89 A;  2CRB A;  2E5V A;  2KXP B;  3LFM A;  3R84 B;  2X68 A;  3ZMZ B;  4LF7 T;  4KBM B;  2YEV C;  2ZM2 A;  3C51 A;  2UUB T;  2V7K A;  3KBT A;  5J2T E;  3PE0 A;  2VAS A;  2IUB A;  4GKJ T;  1VOM A;  3CQX C;  3IF8 B;  3FBL A;  2BG9 A;  4DND A;  3RIU A;  2JQQ A;  4AQG A;  4IE0 A;  3RC3 A;  1IJ6 A;  4ZK4 A;  4LML A;  4DMV A;  2BVL A;  1Z8U A;  4PK6 A;  4B5D A;  4OYJ A;  3TLU A;  2K5B B;  5IHY A;  2XSA A;  2BR8 A;  1N33 T;  2D0U A;  5LHH B;  3PUG A;  5J5G A;  2GK9 A;  5FL0 A;  5BR8 T;  3Q5E A;  2LSG A;  3U8K A;  4U31 A;  4BAY B;  4C91 A;  4AIS A;  2ZM0 A;  2X00 A;  3C4Z A;  4UVB B;  3DJB A;  3GUA A;  4AKL A;  4ZI2 D;  3FXD B;  4B3T T;  5AFJ A;  2XM1 A;  4AQF A;  1UV6 A;  1OED A;  4PW8 A;  3OBV E;  3U8J A;  4HFV A;  1N36 T;  4QAA A;  5SYO A;  3CX8 B;  4JI7 T;  4LF5 T;  2BZB A;  5AQT B;  4YXD A;  2X0Y A;  1XMQ T;  5HXH A;  4H9N C;  2V6Y A;  2BG9 B;  3M3Z B;  1N32 T;  1DU2 A;  2VQE T;  1KK7 A;  2C5I T;  2DCF A;  2KSR A;  5AQM B;  3ZT5 A;  3A7M A;  3ABV A;  1E1H B;  3ZT6 A;  3P50 A;  5HEO A;  4HFI A;  5FNV E;  3RIF A;  3ZCJ A;  4YTM A;  4FI5 A;  4PJM A;  1UUR A;  1BR2 A;  1X79 A;  3FZL B;  4ZS2 A;  1UK5 A;  2KIN B;  4WV9 A;  1G8X A;  5C2T A;  4HWD A;  4M1P A;  4IE4 A;  5EK3 A;  5JR9 A;  4JUY A;  3TLS A;  2Y58 A;  5JRC A;  3U8M A;  3K3Q C;  1J5W A;  2XQ3 A;  4IHJ E;  1H7C A;  2IML A;  2NR4 A;  1OED B;  2KWI B;  2LKH A;  3ONJ A;  2C9T A;  2BS3 A;  4YJ2 E;  4YTP A;  2ZM6 T;  3IBP A;  1WYB A;  4UR9 A;  4BJM A;  4QH4 A;  4LMJ A;  3WTI A;  5ABH A;  3ZSS A;  4DBR A;  4CN4 A;  2V6Y B;  2F4V T;  2V26 A;  3NWI A;  1QLB A;  3U78 A;  2WAU A;  5C3J A;  2W00 A;  4OHF A;  4O2A E;  3C84 A;  2XQ8 A;  3CWZ B;  2E9X A;  2V7M A;  4AKG A;  5DAB A;  4TUY E;  5HXS A;  3RQU A;  1IJ5 A;  5HYA A;  2LEH A;  3WIP A;  5LCY A;  4EXT A;  4GK0 E;  1SE7 A;  3P4Q A;  2WZI A;  4LF6 T;  1GQE A;  3PUY F;  2XNT A;  5JR9 B;  2UUA T;  1SUM B;  3ZKR A;  2W67 A;  5JRC B;  5AQU B;  2PJQ A;  3GWH A;  5LGT B;  2BG9 C;  5LBQ B;  4UVA B;  3PUZ F;  4ADZ A;  2WY2 A;  3Q2M A;  2Y6X A;  5GON E;  4JI4 T;  2YDR A;  2BKP A;  3NRY A;  4EZ4 A;  2W0G A;  3RF1 A;  5FY1 A;  3RH3 A;  5FXV A;  5LG3 A;  2BG9 E;  1WYC A;  1KNP A;  2XNV A;  1HX8 A;  2RP4 A;  4ZI3 D;  3WAK A;  2FJA A;  4CZZ B;  3FHN A;  2WM9 A;  4TZ4 C;  3H3M A;  1I6Z A;  3QB5 K;  5AQV B;  3B5M A;  5FY0 A;  2W63 A;  1OED C;  3ONL C;  3LDQ B;  2BKN A;  3RKO A;  3I1A A;  4IDN A;  2QVA A;  5LB7 B;  4QH5 A;  1XZY A;  3HI2 A;  3UTK A;  2ZJU A;  3HKD E;  4B3S T;  2WCA A;  3F2E A;  1OED E;  2Z6E A;  3JAE A;  3EAM A;  5CA0 E;  2B76 A;  4PJN A;  4B6X A;  3O4X E;  2H3R A;  4GKK T;  2H7O A;  2Q9Q A;  2YDS A;  4HGA A;  4JI0 T;  3ZJ1 A;  3AEB A;  4U2Z A;  2D5U A;  3HR0 A;  4AFH A;  2ODU A;  2M6B A;  2MYS A;  2X51 A;  2LHR A;  5FY7 A;  3CKD A;  5J0Z A;  2JRK A;  3ESL A;  4DR2 T;  4DR3 T;  1N34 T;  5JR9 C;  3PJA J;  5KE4 A;  2VKH A;  3TLV A;  5L3F B;  5LOV E;  4L0R A;  3WTN A;  5J1G A;  2XYT A;  3N9Q A;  2WWU A;  3AA7 B;  3BQK A;  2VQF T;  2FJD A;  3FZM B;  1V9D A;  2LKG A;  2PFV A;  4PJL A;  3AE6 A;  1JNR A;  1MIV A;  4O4L E;  5HXR A;  4ISS A;  2XHE B;  1MMD A;  3WAJ A;  2VK9 A;  5ETW A;  3Q5X A;  2IAK A;  2Y54 A;  2YIN A;  3X1D A;  1YW0 A;  1KF6 A;  4XHE A;  2WU2 A;  2Q9Q B;  3AE2 A;  4X5T A;  4LF8 T;  3MAC A;  5KDM C;  3AVR A;  3LJC A;  3AA1 B;  2V5C A;  5FXZ A;  3PU3 A;  5AQN B;  1HNX T;  5JVD E;  4H9R C;  1IBM T;  4I50 E;  3P7I A;  2J4G A;  2G0U A;  4AFT A;  5EZY E;  1KNR A;  4KMC A;  4MLK A;  2HN1 A;  5F5W A;  5AQO B;  4HWI B;  2R6G F;  3P4W A;  4HWF A;  2W8G A;  4DO0 A;  4QWN B;  4XK9 A;  1ZHC A;  5JDL A;  4K0K T;  4N78 D;  3JC6 C;  4IRE A;  3WTH A;  4XAX B;  3V5U A;  4DR4 T;  2VVS A;  3AAI A;  4UM3 S;  5HCM A;  5C8Y E;  2VB6 A;  2HN2 A;  3PTR B;  3OYX A;  2V1D B;  3HL6 A;  3AA6 B;  3ZST A;  2JJ9 A;  2JIW A;  4G63 A;  4ZJS A;  4PNI A;  3QC9 A;  2WDV A;  4NUU A;  3WTO A;  5JME A;  3CVR A;  1XWM A;  4TX5 A;  4EED A;  4HFH A;  2IDO B;  1IZN B;  1LRZ A;  1ZEE A;  3BK9 A;  4O4J E;  4BA9 A;  4L9I A;  3CIR A;  3RKG A;  3RHW A;  2XSB A;  5JH7 E;  2KWH A;  5BP0 A;  5JDQ A;  4JI1 T;  3QNU A;  2VUR A;  4L5G A;  4YY3 T;  5LG4 A;  2WU5 A;  2Y8D A;  4GOU A;  1W09 A;  2CCQ A;  3UQ4 A;  3WTM A;  2BYQ A;  4A56 A;  1WR6 A;  4V1A v;  3B13 A;  1NAF A;  3AE4 A;  1D0X A;  3CX7 B;  4Z8X A;  2WNC A;  2NW8 A;  3EUH A;  3M65 A;  1G73 A;  3PJA A;  1FMW A;  2SPC A;  5AFM A;  4HKA A;  2EHO D;  4GIW A;  4EV6 A;  4NZB A;  5AQQ B;  2Q9Q C;  2CHO A;  3K8P C;  3AVS A;  2XJ7 A;  4EOZ B;  3N9O A;  3L39 A;  5JRE A;  5KXJ A;  2KT9 A;  5KZU A;  3Q5D A;  2HPJ A;  2LHN A;  4FJO A;  4OFZ A;  5HEU A;  3C50 A;  5FXW A;  5ADX L;  3PUV F;  5AQP B;  3VRB A;  4DV6 T;  4ZS3 A;  2AE9 A;  1T7S A;  5FJV A;  5JDM A;  5JQG E;  5L47 A;  2YOE A;  3LBX B;  3SWH A;  2X66 A;  4ILB A;  3EHZ A;  3K3O A;  2IW5 B;  2WNJ A;  4QX7 B;  4EZ1 A;  2UXC T;  4QHO A;  4LMK A;  2WZH A;  5LJN A;  3OKQ A;  2E8I A;  4O8S A;  5FXX A;  4DR5 T;  2L3L A;  3UUN A;  5AFM B;  3SH1 A;  3N9M A;  3LK3 B;  3QUJ A;  4JI3 T; 
#chains in the Genus database with same CATH homology
 3WTJ A;  5BW2 A;  4TWD A;  2XQ6 A;  4X5T A;  1I9B A;  3TLW A;  3JAF A;  4TWH A;  4UXU A;  3C84 A;  2XZ6 A;  2XQ8 A;  4QH5 A;  3U8J A;  3RQW A;  3SQ6 A;  2WNC A;  3UUB A;  3ZDG A;  3UQ7 A;  2ZJU A;  4QAA A;  5SYO A;  5CO5 A;  4UM3 A;  4ALX A;  4HFD A;  4QAB A;  3RI5 A;  2XQA A;  2MAW A;  5HCJ A;  5CFB A;  4ZR6 A;  5HEH A;  3RQU A;  4AFT A;  1OED E;  5AFM A;  3IGQ A;  3JAE A;  4PIR A;  3EAM A;  4TWF A;  3WIP A;  5AFH A;  2BG9 B;  2XQ5 A;  2XQ9 A;  3SQ9 A;  4TNV A;  4Z91 A;  2BYR A;  2YME A;  4NZB A;  2BYS A;  4UM1 A;  1UX2 A;  2XNT A;  2KSR A;  3P4W A;  4A98 A;  2BJ0 A;  3TLT A;  2PH9 A;  2W8G A;  5KZU A;  3ZKR A;  5AFN A;  2XQ4 A;  5LXB A;  4XK9 A;  3P50 A;  2WN9 A;  2WZY A;  5HEO A;  5L4H A;  4HFI A;  4A97 A;  3PEO A;  4AFH A;  3RIF A;  5HEU A;  2QC1 B;  2M6B A;  4ZZC A;  2WNL A;  4IRE A;  3U8L A;  3WTH A;  2BG9 C;  2Y56 A;  4UM3 S;  2LM2 A;  5HCM A;  5J0Z A;  2XYS A;  2BG9 A;  5J5H A;  2ZJV A;  4AFG A;  5L4E A;  4WV9 A;  5J5I A;  3EI0 A;  3U8N A;  4ZK4 A;  5FJV A;  5AIN A;  4UM3 P;  4HFC A;  4LML A;  2XZ5 A;  5IUX A;  5L47 A;  2YOE A;  4F8H A;  4B5D A;  5KE4 A;  3TLS A;  4QAC A;  4ZJS A;  3TLU A;  2Y58 A;  3TLV A;  4BFQ A;  2BYN A;  4ZJT A;  3U8M A;  4TNW A;  4ILC A;  3WTO A;  5JME A;  5J5F A;  4HFE A;  5LG3 A;  2PGZ A;  3T4M A;  2BR8 A;  4D01 A;  3UU3 A;  4BQT A;  2BG9 E;  4ILB A;  3C79 A;  3WTN A;  4HFH A;  2Y7Y A;  4DBM A;  2XQ3 A;  4IL4 A;  1UW6 A;  2X00 D;  2XYT A;  5HEJ A;  3PMZ A;  5J5G A;  5AFL A;  1OED B;  4ZRU A;  2XQ7 A;  3WTL A;  5BRX A;  2VL0 A;  2W8F A;  3EHZ A;  4Z90 A;  2XNV A;  2LKH A;  2C9T A;  4COF A;  4HQP A;  5TVC A;  2WNJ A;  2M6I A;  4HFB A;  4ILA A;  3U8K A;  3RHW A;  4EZ1 A;  2BR7 A;  4UY2 A;  3WTK A;  5HEG A;  3UU8 A;  5BP0 A;  4LMK A;  4ZK1 A;  2LKG A;  2YN6 A;  3SIO A;  2X00 A;  4QH4 A;  4LMJ A;  3WTI A;  3UQ4 A;  4QH1 A;  4ZZB A;  3GUA A;  2BYQ A;  3WTM A;  3JAD A;  4FRR A;  4NPP A;  5AFM B;  3UU5 A;  5AFJ A;  1OED C;  3SH1 A;  2Y57 A;  2BYP A;  3ZDH A;  3RIA A;  1UV6 A;  2LLY A;  2YKS A;  3LSV A;  2XNU A;  2YMD A;  2Y54 A;  5AFK A;  3UU6 A;  1OED A;  4XHE A;  2UZ6 A;  4IL9 A;  3UU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...