3TLUA

The glic pentameric ligand-gated ion channel loop2-24' oxidized mutant in a locally-closed conformation (lc1 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPCTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tluA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tluA01
5HEUA 3PMZA 5AINA 3UU6A 4LMKA 5L47A 4AFTA 3RQUA 5KE4A 1OEDB 3WTKA 5AFNA 4TNVA 3TLUA 2PGZA 2XNVA 3UU3A 3ZKRA 3ZDHA 4TWFA 2ZJUA 2YMEA 4WV9A 4TWHA 2XQ8A 3WTMA 4ILBA 4TWDA 3IGQA 5BRXA 2BG9B 5J5HA 2XQ5A 4DBMA 4UM3A 3RHWA 5J5IA 3RIFA 4QABA 4COFA 3P4WA 2BYNA 3GUAA 3U8JA 3UUBA 2BR7A 5KZUA 2BG9A 4QH4A 2X00A 4PIRA 2WZYA 2XZ5A 3WTNA 3SH1A 3UQ4A 2XQ6A 4Z91A 2VL0A 4F8HA 5LG3A 3UU5A 3SIOA 4X5TA 1OEDE 1UX2A 5J5GA 3C84A 5BP0A 2QC1B 1I9BA 4FRRA 4ZZBA 5LXBA 2M6IA 3U8KA 5AFKA 2BYRA 2YMDA 5JMEA 4XHEA 2XZ6A 2BG9C 3P50A 3WTJA 4QH1A 4QH5A 2W8FA 3TLSA 2XNTA 4ZJTA 3WTOA 4UM1A 2XQ3A 4D01A 5J5FA 3WIPA 2XQ4A 4ZK1A 3RIAA 5HEOA 3WTHA 3ZDGA 1UV6A 2PH9A 5CFBA 5L4HA 2BYQA 2XNUA 3JADA 4IL4A 4IREA 4HQPA 4A98A 4TNWA 2KSRA 4EZ1A 4UXUA 4ZR6A 5FJVA 5HEHA 4IL9A 2WN9A 4HFHA 5IUXA 4HFDA 3JAFA 2WNJA 2Y7YA 4BQTA 2XQAA 2W8GA 3C79A 3EAMA 4LMLA 2X00D 5AFLA 4AFGA 5TVCA 3EI0A 2LM2A 4UM3P 3SQ6A 3WTIA 3UQ7A 2BG9E 2C9TA 3U8NA 2XYTA 2Y57A 2BYSA 4ALXA 2M6BA 3RI5A 4LMJA 3PEOA 5SYOA 4ILAA 3JAEA 2LKGA 2LLYA 4HFIA 4QAAA 4QACA 4UM3S 4A97A 5AFJA 2LKHA 2UZ6A 2Y54A 5AFMB 5J0ZA 5HEGA 4NZBA 4HFEA 2Y58A 4B5DA 2WNLA 4HFCA 2BR8A 3WTLA 5BW2A 5HCMA 5AFMA 2XQ9A 3LSVA 5HEJA 2BJ0A 3TLTA 2XYSA 2ZJVA 3UU4A 3T4MA 2Y56A 3RQWA 4XK9A 4BFQA 1OEDA 2XQ7A 4NPPA 5CO5A 3SQ9A 5HCJA 3U8LA 3TLWA 2BYPA 4Z90A 4ZK4A 2WNCA 4ILCA 5AFHA 3U8MA 4UY2A 2MAWA 3UU8A 4ZZCA 2YKSA 3TLVA 2YOEA 4ZRUA 4ZJSA 5L4EA 1OEDC 4AFHA 1UW6A 4HFBA 2YN6A 3EHZA
chains in the Genus database with same CATH superfamily
2KT9A 4LMKA 4XBFB 2ODUA 2LHNA 3UU3A 4H63V 3UFEA 4FJOA 4QWNB 2X00A 5A1LA 1IZNB 2LT3A 4FRRA 2ODVA 3K8PC 1WYBA 5J5FA 2UXDT 3IA3A 3GN5A 4PK5A 3KVBA 2XNUA 3F57A 3RH3A 3VU7H 2YK0A 2E9XA 2KSRA 5LG4A 3PUZF 4AQFC 2YU2A 2W2UA 3DTOA 1WR0A 5F5WA 3SS1A 3N9QA 2XAJB 5L3DB 1FEWA 4DV5T 2C9TA 2NTYA 2Y57A 2BYSA 3AECA 3RI5A 3JAEA 3P4SA 2XSAA 1ZEEA 4X20E 2CA5A 2UUAT 1JNRA 1YKEB 2JJ9A 4PNIA 5L3FB 2XQ9A 3AA6B 5HEJA 1R8IA 1XWMA 3ZYKA 2XPKA 4A5XA 2WQYA 4ILCA 5JVDE 2DWKA 2HN2A 4I43B 5L4EA 3H37A 4KHPT 2V1DB 3UU6A 4IIJE 3IEEA 2PGZA 1IJ6A 1EZ3A 4TWDA 1IBMT 2XQ5A 5LBMA 5JDHA 2BYNA 4H63H 4Z8XA 2VURA 1NWMX 4MFRA 4ZZBA 2M6IA 5HWXA 4C90A 2BYRA 2YMDA 1ZKEA 5JMEA 4PJJA 3N2OA 1FMWA 4IE7A 3WAKA 2I59A 1LVFA 3X1DA 1J5WA 4LFCT 4HQPA 1XNQT 5KMGP 4NXMT 2L8KA 3CX6B 4HFDA 4B3ST 3OPCA 5JRCA 5ABGA 1US7B 1HNZT 5LGTB 1AJ3A 4DV7T 5JDFA 3LK3B 5ABFB 2KZ7B 3N5LA 3KV4A 2W66A 4CQIA 2XUEA 5FYMA 4IHJE 1WFDA 3V5UA 3KBTA 4HN9A 2D0UA 3TLTA 4H9NC 4CN1A 3ANWA 2LOSA 5TAOA 1BR4A 5AQMB 2WNCA 2XAGB 2WP9A 3ESLA 2PTFA 2PFVA 4MHCA 2J47A 1GQEA 2BS2A 2MYSA 4H9QC 4KBMB 4HFVA 4YLHA 3FBZA 3ZDHA 2ZJUA 4EEDA 4YSYA 4JI5T 3RKOA 3QK6A 2HH7A 3GUAA 2BR7A 2WMOA 4PIRA 3JCFA 5LG3A 4GYRA 2XJ7A 3O1HA 4DR6T 3HKCE 3AXJB 2LSKA 4YHJA 3UUMA 2W4XA 5AQHB 3WTOA 4EXTA 5KDMC 3AE6A 5AQTB 2KWIB 3ZT7A 2ACXA 4EAHA 3RIAA 5HEOA 4CXWA 3ZDGA 5FXVA 4YTMA 2VASA 4UF0B 2NP9A 3I0QA 1HFAA 2WU5A 2CHOA 5HXRA 2WSSV 2X0YA 3A8YC 4ZI7E 2Y7YA 3C79A 2LM2A 3RGLA 4XAXB 3UQ7A 2BS4A 3PEOA 3ZN0B 2LKGA 4PJNA 3J7Yq 5JDMA 2XASB 1HF8A 1ZOYA 4H9SE 1MIVA 1LVKA 5DQVA 4QX7B 5LJNA 1HG5A 3HR0A 4PW8A 2LE8A 4LFBT 3CX8B 2N2NA 4X1IE 3N2GE 3TLWA 4JUYA 3LJCA 2XSBA 2P9BA 4UY2A 1D0YA 1OEDC 3K3OA 3CIRA 3UULA 2WU2A 2XAFB 2W67A 5J1GA 1KNRA 4UVCB 5HEUA 3UUNA 5L47A 2M67A 2BVLA 5F3JA 1O3XA 4ZI3D 4HKAA 4TWHA 4O2AE 3WTMA 4IDPA 4DBMA 4HWDA 4LF7T 3BQIA 1XDOA 3FZKB 3N9PA 3IBPA 2LEHA 3HKBE 3SH1A 2JMHA 2R6GF 3UU5A 5BP0A 1I9BA 2B1EA 3O1IA 2XQ3A 4DNDA 3B57A 4EZHA 1Z8UA 4I0UA 1W0BA 4TNWA 5FMNA 1NAFA 1M62A 1IJ5A 4LFAT 4WNKA 2D5UA 4HFHA 4MBQA 2W8GA 1QSDA 2CPTA 2YINA 2OA5A 1D1AA 2CCQA 2KINB 3KV9A 5AQNB 1MMGA 5AQVB 2LSIA 4HWHA 5AFUL 1W09A 5SYOA 2LLYA 4QACA 5AFJA 2LKHA 5AFMB 5HEGA 4L0RA 2E8IA 2MPKA 4JI4T 5AQSB 1I94T 2DCFA 5L3BB 2Y56A 2VKHA 3E08A 3M3ZB 4DMWA 4X1KE 1XDPA 4U2ZA 3RLFF 3MKDA 5AQUB 1UX4A 2JQ9A 2I6HA 3ZKRA 3KINB 3ZEFB 2Q9QA 5HXEA 2VKOA 4DUZT 4UR9A 4UM3A 4QABA 2PJQA 5CA0E 2C5KT 2BG9A 3ZN1B 5EK2A 4EZ4A 3NZQA 2WDRA 4YT0A 3AE7A 3OTOT 3ZPOA 2XZ6A 3ONJA 3TLSA 4BAYB 5EZYE 4B6XA 5LNKA 4WZXA 4WBNE 4H9OC 4UELA 4YTNA 4GYSA 2HPJA 3OVUA 2JIWA 5H6QB 2A9UA 2BBHA 2KMFA 4CZZB 5HXSA 5TVCA 1IBKT 4UM3P 1N34T 2W63A 5AQFB 3PDYA 3LBXA 5JDQA 3FZHB 4NXNT 4LMJA 4UIGA 2W00A 2D9DA 1BR2A 5AQPB 4YSZA 5IWAT 4L9IA 4YY3T 2IUBA 3PUGA 2WDQA 3RYFE 2LHRA 1UURA 2DNXA 4IDOA 4YFSA 1Z0PA 5HCMA 2C0SA 3RC3A 3ZCIA 2D2SA 3RKGA 4XK9A 5AQKB 2JQKA 3AA1B 2K48A 4X64T 1HR0T 4B3TT 2V7LA 3U8MA 2VKJA 3ZCJA 3ZMTB 3P4QA 3TLVA 2W61A 4ZRUA 1NEKA 2JMKA 4EYUA 4ZHQE 2H3RA 4P0BA 1OEDB 4TNVA 2A72A 3AEAA 3OYZA 3RF1A 4ISTA 5LYJE 2LSYA 1ZHCA 5J5HA 3R6NA 2E2AA 1T8BA 1HTJF 3L8RA 5L2LA 1YQ3A 4LF9T 2XQ6A 4GOUA 4F8HA 1N33T 2PBIA 4DR2T 3U8KA 3P50A 2ZM8A 3C4XA 4UV9B 1WRDA 4U7IA 4PAGA 3BK9A 4ASKA 4AQFA 2ZM2A 3AAAB 4IREA 3FZLB 5JDGA 4EYYR 2ZM6T 4KP3C 3ZC0A 3Q9DA 2X67A 4JBWF 1UK5A 2WWVA 3RYCE 3RIUC 3C50A 2I0MA 2DWGA 4ALXA 5FKYA 4TV9E 3VRAA 4PFPA 2BR8A 2FJEA 4ISSA 3N9OA 2BJ0A 4X1YE 4DV3T 3KBUA 5CO5A 3CPZA 4ZI3C 3MXZA 5FVLA 3TKLB 2V7JA 4IE5A 2BS3A 4U2YA 3Q2MA 2YEVC 5HWYA 1UX5A 2L3LA 1UGOA 1CUNA 5LMUT 5KE4A 5IHYA 3C51A 3MZKB 3QB5K 1YKHB 2V6XA 4ILBA 4J2CA 3AAEB 1XNRT 1VRBA 1M7KA 5H6RB 2B76A 3C4WA 3UQ4A 2VL0A 2CEAA 1B7TA 4JI6T 5LGUB 5CB4E 1D1CA 5FY7A 2QGSA 3FBLA 4UV8B 2XQ4A 3CQXC 3CX7B 2YU1A 3JADA 4DV6T 3PJAJ 5EK4A 5FJVA 3ZSTA 2VVSA 3FB2A 4O2BE 3ZYLA 4LMLA 5HXCA 4CI2B 4I50E 4YXDA 2AXDS 4AQGA 1KFYA 3V5SA 1NENA 1YD8G 4HFIA 2CXDA 4V1Av 2SPCA 4A56A 2IHR1 3VKGA 3ZC1A 3VRBA 2G0UA 5FXZA 5AQLB 2VVNA 2EHOB 3LK2B 1SE7A 3UU8A 4ZZCA 4JYAT 3N9MA 4ZJSA 3BQLA 4IDZA 4ZI2D 1T98A 2FJBA 5LBQB 4HTEA 4IT4A 2X68A 4OYKA 5JREA 2X9YA 5FL1A 3PUWF 2V26A 3AE3A 2JQHA 2JRKA 3LK42 5LXBA 5JDNA 2D0TA 3D0TA 4DR5T 2NTXA 3FXDB 2GK9A 5FL0A 2VQET 4QHOA 4AISA 1YXRA 1KNZA 1HNWT 4YSXA 5E0OA 4UXUA 2V6YB 1KEYA 5HEHA 4TUYE 4BA9A 3M65A 3I0OA 5LHIB 5HXHA 2J1DG 2WB5A 2J62A 3L09A 4PK6A 4UVAB 3RYIE 5LGNB 2QA7A 2IAKA 5AQOB 3MA9A 4UM3S 1U5PA 3CMLA 4EGWA 2UZ6A 5J0ZA 4EOZB 5JR9B 4JEHB 1G8XA 3AEGA 4I55E 4UEMA 5C2TA 3PV0F 5L3GB 1OEDA 4ANJA 3AEFA 3SQ9A 4NIQA 5CA1E 3PURA 4X66T 2X0HA 4AFHA 2LSGA 5LB7B 2BKNA 4HE8A 1Y01A 5IYZE 3ZMZB 4TWFA 2YMEA 3A5XA 3PUYF 1KK7A 3RHWA 2QRXA 3P4WA 1HS7A 5DJQC 4UXNB 3QB5A 4EIWA 3CQCB 3QNUA 4O8SA 1UX2A 3C84A 2IC9A 4WBOA 3PJAA 4P0AA 3GN5B 2XNTA 2ES0A 3GMIA 5FY1A 4O4JE 4EB6E 4D01A 3ABVA 2UXBT 2QVAA 4NUVA 5LA6E 5LJMA 2CM0A 2FBWA 3FHNA 3ZYMA 3SRZA 2VKDA 3OKQA 2Y6XA 5FXXA 3PU8A 2X00D 2CHNA 2CRBA 4U74A 2NWBA 3O4XE 4DBRA 3EUHA 3UTKA 4ZXLA 2DLRA 2NR4A 4XZCA 3OBVE 4F6RC 3UU4A 3T4MA 2IDOB 3U8LA 5AQJB 2DI4A 5AFHA 5KXJA 2KXPB 3ZJ1A 2WM9A 3CQGB 1SHZC 3QC9A 4U33A 2FJAA 2H7VC 4U31A 5LP6E 1YW0A 3RQUA 4DR1T 5F8PA 5LOVE 3OJAA 2XNVA 3P4RA 3RX6A 4AIUA 4U7YA 5BRXA 2N1GA 1QLBA 3PUVF 3UUBA 2JQQA 3E22E 2RPAA 1DU2A 1QUUA 4UVBB 4ERRA 4JLEA 5L4HA 2W62A 2HPLA 2BYQA 1IAPA 4O4HE 2CLYB 1D0XA 2DL1A 4OYJA 2UUCT 5DQWA 5M4YA 2BKPA 3ZLIA 1D1BA 3AEEA 1I6ZA 3EAMA 2K5BB 1N36T 3SOLA 4GIWA 3NWIA 1MIYA 2KLQA 3UUXB 4K0KT 5ABHA 2E5LT 5ABFA 2XY8B 4YHHT 2VWAA 4OHFA 5ADXL 3CK6A 3AAIA 4IE4A 2WMNA 3AE8A 3ANWB 5BW2A 2Z6EA 4ZI2C 5L3EB 3L39A 3IF8B 2CE7A 3ETVA 3NVOA 2A3DA 2BYPA 4Z90A 2V8SV 4EV6A 4OX9T 2MAWA 3T1HT 2YOEA 5LMNT 2LM9A 3WTKA 2EHOC 5DABA 4KUMB 2X66A 1XZYA 2OLTA 4LF8T 3I9YA 2UXXB 3P7IA 4C91A 5J5IA 3HKEE 3ETUA 1SA0E 1S35A 4WYVA 4AKRB 2V6YA 5CGMA 3U3IA 5HYAA 2NOXA 4BJMA 1KF6A 3EABA 3VR9A 5FP3A 3AXJA 3PUQA 4JI1T 5KX5E 3AB3B 2KWHA 4TV8E 2UXCT 1FMVA 3OYXA 3SWHA 4UF0A 4K0UA 3RIUA 1X9BA 2WNJA 5JDLA 3EI0A 5C8YE 3WTIA 1CHUA 2C5IT 3A7MA 3E0ZA 2M6BA 3AVSA 2Y48B 2NW9A 4CI3B 3P4PA 4LF5T 3HA4A 4AKLA 3B13A 4NZBA 4YTPA 2XHEB 3QOFA 3PE0A 5AQIB 4GKJT 2XYSA 4CXXA 2CMRA 3RQWA 2H88A 2JPFA 4BFQA 3ZMSB 5HCJA 4GK5E 5BR8T 3ZT5A 3CWZB 4TN7B 5JR9C 1ZP0A 5HAXA 3O9XA 3H3AA 3K3QC 5AINA 2NW8A 3I1AA 4I4TE 2LJLA 1MNEA 4H9RC 1JNZA 3U78A 2MBGA 3NZPA 4YJ3E 3Q5EA 2ACZA 4COFA 3AE1A 1VOMA 3H3MA 4ZOLE 4G63A 2UU9T 5LXTE 4X5TA 3ONLC 2QC1B 3ONXA 1KNPA 3LDQB 2X51A 3FXEB 3RRCA 3WTHA 2PH9A 2H7OA 3UT5E 5BMVE 4ZS3A 5IUXA 3JAFA 3N2KE 2LRLA 2K3WA 4OK0A 3RPUA 2XQAA 2XTLA 2LOPA 3F2EA 4ZS2A 2E9XC 1MNDA 2WDVA 5LHHB 2BG9E 2X9WA 3BQKA 4DMVA 3CVRA 1HG2A 4O4IE 2N9DA 1OXZA 3GA8A 5FXWA 4QAAA 3RC8A 1U4QA 4ILUA 4AKHA 2Y54A 3NKZA 4MLKA 4HFCA 5AFMA 4DR7T 5FY0A 4FI5A 2ZJVA 2Y8DA 4L5GA 5FVKA 5C3JA 3AE9A 1MMAA 2X0LB 2XAHB 3AA0B 2BKOA 2HN1A 2YKSA 2VK9A 2E5VA 2Q9QB 3KV5A 2A2FX 1WLXA 2BG9B 4PFOA 3RIFA 1HX8A 3PU3A 1V9DA 1X79A 3LFMA 4QKNA 3C64A 4PJMA 3SIOA 4DV1T 1VCTA 5J2UE 3R84B 4DR4T 1J1JA 2K9AA 4E7SA 4CN4A 2V7IA 2WS3A 4ZK1A 1E1HB 2DHRA 5CFBA 2Q9QD 4ZR6A 3W15B 3HKDE 3JC6D 2LSJA 1W0AA 2EHOD 2C5JA 2BZBA 3LBXB 2YDQA 3O1JA 3NRXA 4AKGA 2XYTA 1ZV4X 4PK4A 4GKKT 3EVYA 1UCUA 2CLYC 3WI3A 2L9QA 5L3CB 5JH7E 4ILAA 2XAQB 4B3RT 5AQQB 5GONE 3RYHE 4DV4T 1W9RA 1T7SA 3C98B 1H7CA 2IIUA 3AE5A 4CXYA 4IE0A 3AVRA 2XQ7A 1UUSA 4DO0A 4M1PA 4ZK4A 3FZFB 3PTRB 3AE2A 3MJXA 3VHLA 3PUAA 1UW6A 4HFBA 2YN6A 3I9WA 4X62T 3PMZA 4AFTA 3NRYA 3J9X1 4KHZF 5JTGA 1WR6A 2WCAA 4N78D 1IBLT 2QYWA 1BR1A 3RRWA 4YJ2E 4JI7T 3EDVA 2KNDA 2CXFA 4QH4A 1G73A 1S94A 2UUBT 3WTNA 4KMCA 4Z91A 1FJGT 4BJNA 2IMLA 4U3CA 4UM1A 5AQGB 1T72A 4IDQA 1MMNA 4AXPA 1Y64B 3SFEA 4A98A 2CXLA 5JQGE 2V5DA 2FJDA 4DUYT 2XZEA 4IL9A 1HNXT 3T8OA 3L3PA 1MMDA 2WZHA 4JEUB 2NW7A 2WWUA 4PJLA 3SQ6A 3T1YT 4JI2T 1FIOA 3VR8A 2YDSA 4Q25A 4MALA 2E9XB 3CKDA 1BR0A 3ZJ2A 2WZIA 3K3NA 3NBXX 1HX1B 2J4GA 3P8CD 4QXHB 5ABEA 4X65T 4WW0A 3UFGA 2CBIA 3EHZA 2XM2A 4P09A 2AE9A 3KVAA 5J2TE 4AI6A 4HEAA 3AEDA 4DV2T 2E9XD 5AFNA 2ZLYA 3PUSA 4QXCB 4WV9A 2XQ8A 4DR3T 1HCIA 3IGQA 4H9PC 4HWFA 4HGAA 2CBJA 3S4UA 3U8JA 3B5MA 2CWYA 2WZYA 2RA1A 4QX8B 2IW5B 2ZM0A 4HWCA 5AFKA 1LKXA 3ZMVB 2WAUA 2W8FA 4ZJTA 4IE6A 4QXBB 2BDEA 2VL8A 4AKIA 1E7PA 3Q5WA 1UV6A 2FUPA 4DVDA 1N32T 5CJ5A 4P1NA 1OWAA 4JI0T 3Q5DA 3DJBA 2WN9A 2X9HA 3Q5XA 5EK3A 3MK7C 3ZT6A 5AFLA 3HI2A 4KX6A 2X9XA 4CN6A 1WYCA 1WCRA 3U8NA 4EEBA 4DV0T 4ZEYA 4A97A 5JRCB 4DIDB 4B5DA 2WNLA 1J5ET 1YQ4A 4KI0F 2HHHT 4TX5A 3WTLA 2IC6A 3VKHA 2WBLA 1MIWA 3DP7A 3HL6A 4NPPA 1D0ZA 4O4LE 2YDRA 1SUMB 4ADZA 4B3MT 2VQFT 2EHOA 5ETWA 3G06A 3LG7A 3PUXF 2MTQA 2LRKA 2V5CA 4IDNA 2XQYA 4GK0E 3TLUA 4JV5T 4CI1B 3AE4A 1XMQT 3F31A 4NUUA 3AA7B 2VB6A 1XMOT 1LRZA 5KZUA 2RP4A 2UXNB 2CWOA 2Q9QC 2XZ5A 4TZ4C 1OEDE 5J5GA 3MACA 3JC6C 3K1SA 4AQYT 4XHEA 2BG9C 3WTJA 4QH1A 4QH5A 2ZMAA 4IGUA 1L0VA 4G2AA 3WIPA 3ZSSA 1VCSA 3QUJA 4IL4A 2W0GA 2BBJA 4EZ1A 2BVMA 3WAJA 4LF4T 3KV6A 3KFWX 5LCYA 4BQTA 2WY2A 3N9NA 2XM1A 4AFGA 2V7KA 4JI3T 5FNVE 2F4VT 2MOZA 2PG8A 2OV9A 4OFZA 4JI8T 4LF6T 3AEBA 3C4ZA 4HWIB 3EDUA 2K24A 4HFEA 2Y58A 5AQRB 3IHRA 3FZMB 1E2AA 3ZMUB 3LSVA 3SFDA 5JR9A 3KDSE 5LHGB 4E7ZA 2V7MA 3GWHA 3N9LA 2H89A 4U72A 4DBQA
chains in the Genus database with same CATH topology
5HEUA 3PMZA 5AINA 3UU6A 4LMKA 5L47A 4AFTA 3RQUA 5KE4A 1OEDB 3WTKA 5AFNA 4TNVA 3TLUA 2PGZA 2XNVA 3UU3A 3ZKRA 3ZDHA 4TWFA 2ZJUA 2YMEA 4WV9A 4TWHA 2XQ8A 3WTMA 4ILBA 4TWDA 3IGQA 5BRXA 2BG9B 5J5HA 2XQ5A 4DBMA 4UM3A 3RHWA 5J5IA 3RIFA 4QABA 4COFA 3P4WA 2BYNA 3GUAA 3U8JA 3UUBA 2BR7A 5KZUA 2BG9A 4QH4A 2X00A 4PIRA 2WZYA 2XZ5A 3WTNA 3SH1A 3UQ4A 2XQ6A 4Z91A 2VL0A 4F8HA 5LG3A 3UU5A 3SIOA 4X5TA 1OEDE 1UX2A 5J5GA 3C84A 5BP0A 2QC1B 1I9BA 4FRRA 4ZZBA 5LXBA 2M6IA 3U8KA 5AFKA 2BYRA 2YMDA 5JMEA 4XHEA 2XZ6A 2BG9C 3P50A 3WTJA 4QH1A 4QH5A 2W8FA 3TLSA 2XNTA 4ZJTA 3WTOA 4UM1A 2XQ3A 4D01A 5J5FA 3WIPA 2XQ4A 4ZK1A 3RIAA 5HEOA 3WTHA 3ZDGA 1UV6A 2PH9A 5CFBA 5L4HA 2BYQA 2XNUA 3JADA 4IL4A 4IREA 4HQPA 4A98A 4TNWA 2KSRA 4EZ1A 4UXUA 4ZR6A 5FJVA 5HEHA 4IL9A 2WN9A 4HFHA 5IUXA 4HFDA 3JAFA 2WNJA 2Y7YA 4BQTA 2XQAA 2W8GA 3C79A 3EAMA 4LMLA 2X00D 5AFLA 4AFGA 5TVCA 3EI0A 2LM2A 4UM3P 3SQ6A 3WTIA 3UQ7A 2BG9E 2C9TA 3U8NA 2XYTA 2Y57A 2BYSA 4ALXA 2M6BA 3RI5A 4LMJA 3PEOA 5SYOA 4ILAA 3JAEA 2LKGA 2LLYA 4HFIA 4QAAA 4QACA 4UM3S 4A97A 5AFJA 2LKHA 2UZ6A 2Y54A 5AFMB 5J0ZA 5HEGA 4NZBA 4HFEA 2Y58A 4B5DA 2WNLA 4HFCA 2BR8A 3WTLA 5BW2A 5HCMA 5AFMA 2XQ9A 3LSVA 5HEJA 2BJ0A 3TLTA 2XYSA 2ZJVA 3UU4A 3T4MA 2Y56A 3RQWA 4XK9A 4BFQA 1OEDA 2XQ7A 4NPPA 5CO5A 3SQ9A 5HCJA 3U8LA 3TLWA 2BYPA 4Z90A 4ZK4A 2WNCA 4ILCA 5AFHA 3U8MA 4UY2A 2MAWA 3UU8A 4ZZCA 2YKSA 3TLVA 2YOEA 4ZRUA 4ZJSA 5L4EA 1OEDC 4AFHA 1UW6A 4HFBA 2YN6A 3EHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEU A;  3PMZ A;  5AIN A;  3UU6 A;  4LMK A;  5L47 A;  4AFT A;  3RQU A;  5KE4 A;  1OED B;  3WTK A;  5AFN A;  4TNV A;  3TLU A;  2PGZ A;  2XNV A;  3UU3 A;  3ZKR A;  3ZDH A;  4TWF A;  2ZJU A;  2YME A;  4WV9 A;  4TWH A;  2XQ8 A;  3WTM A;  4ILB A;  4TWD A;  3IGQ A;  5BRX A;  2BG9 B;  5J5H A;  2XQ5 A;  4DBM A;  4UM3 A;  3RHW A;  5J5I A;  3RIF A;  4QAB A;  4COF A;  3P4W A;  2BYN A;  3GUA A;  3U8J A;  3UUB A;  2BR7 A;  5KZU A;  2BG9 A;  4QH4 A;  2X00 A;  4PIR A;  2WZY A;  2XZ5 A;  3WTN A;  3SH1 A;  3UQ4 A;  2XQ6 A;  4Z91 A;  2VL0 A;  4F8H A;  5LG3 A;  3UU5 A;  3SIO A;  4X5T A;  1OED E;  1UX2 A;  5J5G A;  3C84 A;  5BP0 A;  2QC1 B;  1I9B A;  4FRR A;  4ZZB A;  5LXB A;  2M6I A;  3U8K A;  5AFK A;  2BYR A;  2YMD A;  5JME A;  4XHE A;  2XZ6 A;  2BG9 C;  3P50 A;  3WTJ A;  4QH1 A;  4QH5 A;  2W8F A;  3TLS A;  2XNT A;  4ZJT A;  3WTO A;  4UM1 A;  2XQ3 A;  4D01 A;  5J5F A;  3WIP A;  2XQ4 A;  4ZK1 A;  3RIA A;  5HEO A;  3WTH A;  3ZDG A;  1UV6 A;  2PH9 A;  5CFB A;  5L4H A;  2BYQ A;  2XNU A;  3JAD A;  4IL4 A;  4IRE A;  4HQP A;  4A98 A;  4TNW A;  2KSR A;  4EZ1 A;  4UXU A;  4ZR6 A;  5FJV A;  5HEH A;  4IL9 A;  2WN9 A;  4HFH A;  5IUX A;  4HFD A;  3JAF A;  2WNJ A;  2Y7Y A;  4BQT A;  2XQA A;  2W8G A;  3C79 A;  3EAM A;  4LML A;  2X00 D;  5AFL A;  4AFG A;  5TVC A;  3EI0 A;  2LM2 A;  4UM3 P;  3SQ6 A;  3WTI A;  3UQ7 A;  2BG9 E;  2C9T A;  3U8N A;  2XYT A;  2Y57 A;  2BYS A;  4ALX A;  2M6B A;  3RI5 A;  4LMJ A;  3PEO A;  5SYO A;  4ILA A;  3JAE A;  2LKG A;  2LLY A;  4HFI A;  4QAA A;  4QAC A;  4UM3 S;  4A97 A;  5AFJ A;  2LKH A;  2UZ6 A;  2Y54 A;  5AFM B;  5J0Z A;  5HEG A;  4NZB A;  4HFE A;  2Y58 A;  4B5D A;  2WNL A;  4HFC A;  2BR8 A;  3WTL A;  5BW2 A;  5HCM A;  5AFM A;  2XQ9 A;  3LSV A;  5HEJ A;  2BJ0 A;  3TLT A;  2XYS A;  2ZJV A;  3UU4 A;  3T4M A;  2Y56 A;  3RQW A;  4XK9 A;  4BFQ A;  1OED A;  2XQ7 A;  4NPP A;  5CO5 A;  3SQ9 A;  5HCJ A;  3U8L A;  3TLW A;  2BYP A;  4Z90 A;  4ZK4 A;  2WNC A;  4ILC A;  5AFH A;  3U8M A;  4UY2 A;  2MAW A;  3UU8 A;  4ZZC A;  2YKS A;  3TLV A;  2YOE A;  4ZRU A;  4ZJS A;  5L4E A;  1OED C;  4AFH A;  1UW6 A;  4HFB A;  2YN6 A;  3EHZ A; 
#chains in the Genus database with same CATH topology
 2KT9 A;  4LMK A;  4XBF B;  2ODU A;  2LHN A;  3UU3 A;  4H63 V;  3UFE A;  4FJO A;  4QWN B;  2X00 A;  5A1L A;  1IZN B;  2LT3 A;  4FRR A;  2ODV A;  3K8P C;  1WYB A;  5J5F A;  2UXD T;  3IA3 A;  3GN5 A;  4PK5 A;  3KVB A;  2XNU A;  3F57 A;  3RH3 A;  3VU7 H;  2YK0 A;  2E9X A;  2KSR A;  5LG4 A;  3PUZ F;  4AQF C;  2YU2 A;  2W2U A;  3DTO A;  1WR0 A;  5F5W A;  3SS1 A;  3N9Q A;  2XAJ B;  5L3D B;  1FEW A;  4DV5 T;  2C9T A;  2NTY A;  2Y57 A;  2BYS A;  3AEC A;  3RI5 A;  3JAE A;  3P4S A;  2XSA A;  1ZEE A;  4X20 E;  2CA5 A;  2UUA T;  1JNR A;  1YKE B;  2JJ9 A;  4PNI A;  5L3F B;  2XQ9 A;  3AA6 B;  5HEJ A;  1R8I A;  1XWM A;  3ZYK A;  2XPK A;  4A5X A;  2WQY A;  4ILC A;  5JVD E;  2DWK A;  2HN2 A;  4I43 B;  5L4E A;  3H37 A;  4KHP T;  2V1D B;  3UU6 A;  4IIJ E;  3IEE A;  2PGZ A;  1IJ6 A;  1EZ3 A;  4TWD A;  1IBM T;  2XQ5 A;  5LBM A;  5JDH A;  2BYN A;  4H63 H;  4Z8X A;  2VUR A;  1NWM X;  4MFR A;  4ZZB A;  2M6I A;  5HWX A;  4C90 A;  2BYR A;  2YMD A;  1ZKE A;  5JME A;  4PJJ A;  3N2O A;  1FMW A;  4IE7 A;  3WAK A;  2I59 A;  1LVF A;  3X1D A;  1J5W A;  4LFC T;  4HQP A;  1XNQ T;  5KMG P;  4NXM T;  2L8K A;  3CX6 B;  4HFD A;  4B3S T;  3OPC A;  5JRC A;  5ABG A;  1US7 B;  1HNZ T;  5LGT B;  1AJ3 A;  4DV7 T;  5JDF A;  3LK3 B;  5ABF B;  2KZ7 B;  3N5L A;  3KV4 A;  2W66 A;  4CQI A;  2XUE A;  5FYM A;  4IHJ E;  1WFD A;  3V5U A;  3KBT A;  4HN9 A;  2D0U A;  3TLT A;  4H9N C;  4CN1 A;  3ANW A;  2LOS A;  5TAO A;  1BR4 A;  5AQM B;  2WNC A;  2XAG B;  2WP9 A;  3ESL A;  2PTF A;  2PFV A;  4MHC A;  2J47 A;  1GQE A;  2BS2 A;  2MYS A;  4H9Q C;  4KBM B;  4HFV A;  4YLH A;  3FBZ A;  3ZDH A;  2ZJU A;  4EED A;  4YSY A;  4JI5 T;  3RKO A;  3QK6 A;  2HH7 A;  3GUA A;  2BR7 A;  2WMO A;  4PIR A;  3JCF A;  5LG3 A;  4GYR A;  2XJ7 A;  3O1H A;  4DR6 T;  3HKC E;  3AXJ B;  2LSK A;  4YHJ A;  3UUM A;  2W4X A;  5AQH B;  3WTO A;  4EXT A;  5KDM C;  3AE6 A;  5AQT B;  2KWI B;  3ZT7 A;  2ACX A;  4EAH A;  3RIA A;  5HEO A;  4CXW A;  3ZDG A;  5FXV A;  4YTM A;  2VAS A;  4UF0 B;  2NP9 A;  3I0Q A;  1HFA A;  2WU5 A;  2CHO A;  5HXR A;  2WSS V;  2X0Y A;  3A8Y C;  4ZI7 E;  2Y7Y A;  3C79 A;  2LM2 A;  3RGL A;  4XAX B;  3UQ7 A;  2BS4 A;  3PEO A;  3ZN0 B;  2LKG A;  4PJN A;  3J7Y q;  5JDM A;  2XAS B;  1HF8 A;  1ZOY A;  4H9S E;  1MIV A;  1LVK A;  5DQV A;  4QX7 B;  5LJN A;  1HG5 A;  3HR0 A;  4PW8 A;  2LE8 A;  4LFB T;  3CX8 B;  2N2N A;  4X1I E;  3N2G E;  3TLW A;  4JUY A;  3LJC A;  2XSB A;  2P9B A;  4UY2 A;  1D0Y A;  1OED C;  3K3O A;  3CIR A;  3UUL A;  2WU2 A;  2XAF B;  2W67 A;  5J1G A;  1KNR A;  4UVC B;  5HEU A;  3UUN A;  5L47 A;  2M67 A;  2BVL A;  5F3J A;  1O3X A;  4ZI3 D;  4HKA A;  4TWH A;  4O2A E;  3WTM A;  4IDP A;  4DBM A;  4HWD A;  4LF7 T;  3BQI A;  1XDO A;  3FZK B;  3N9P A;  3IBP A;  2LEH A;  3HKB E;  3SH1 A;  2JMH A;  2R6G F;  3UU5 A;  5BP0 A;  1I9B A;  2B1E A;  3O1I A;  2XQ3 A;  4DND A;  3B57 A;  4EZH A;  1Z8U A;  4I0U A;  1W0B A;  4TNW A;  5FMN A;  1NAF A;  1M62 A;  1IJ5 A;  4LFA T;  4WNK A;  2D5U A;  4HFH A;  4MBQ A;  2W8G A;  1QSD A;  2CPT A;  2YIN A;  2OA5 A;  1D1A A;  2CCQ A;  2KIN B;  3KV9 A;  5AQN B;  1MMG A;  5AQV B;  2LSI A;  4HWH A;  5AFU L;  1W09 A;  5SYO A;  2LLY A;  4QAC A;  5AFJ A;  2LKH A;  5AFM B;  5HEG A;  4L0R A;  2E8I A;  2MPK A;  4JI4 T;  5AQS B;  1I94 T;  2DCF A;  5L3B B;  2Y56 A;  2VKH A;  3E08 A;  3M3Z B;  4DMW A;  4X1K E;  1XDP A;  4U2Z A;  3RLF F;  3MKD A;  5AQU B;  1UX4 A;  2JQ9 A;  2I6H A;  3ZKR A;  3KIN B;  3ZEF B;  2Q9Q A;  5HXE A;  2VKO A;  4DUZ T;  4UR9 A;  4UM3 A;  4QAB A;  2PJQ A;  5CA0 E;  2C5K T;  2BG9 A;  3ZN1 B;  5EK2 A;  4EZ4 A;  3NZQ A;  2WDR A;  4YT0 A;  3AE7 A;  3OTO T;  3ZPO A;  2XZ6 A;  3ONJ A;  3TLS A;  4BAY B;  5EZY E;  4B6X A;  5LNK A;  4WZX A;  4WBN E;  4H9O C;  4UEL A;  4YTN A;  4GYS A;  2HPJ A;  3OVU A;  2JIW A;  5H6Q B;  2A9U A;  2BBH A;  2KMF A;  4CZZ B;  5HXS A;  5TVC A;  1IBK T;  4UM3 P;  1N34 T;  2W63 A;  5AQF B;  3PDY A;  3LBX A;  5JDQ A;  3FZH B;  4NXN T;  4LMJ A;  4UIG A;  2W00 A;  2D9D A;  1BR2 A;  5AQP B;  4YSZ A;  5IWA T;  4L9I A;  4YY3 T;  2IUB A;  3PUG A;  2WDQ A;  3RYF E;  2LHR A;  1UUR A;  2DNX A;  4IDO A;  4YFS A;  1Z0P A;  5HCM A;  2C0S A;  3RC3 A;  3ZCI A;  2D2S A;  3RKG A;  4XK9 A;  5AQK B;  2JQK A;  3AA1 B;  2K48 A;  4X64 T;  1HR0 T;  4B3T T;  2V7L A;  3U8M A;  2VKJ A;  3ZCJ A;  3ZMT B;  3P4Q A;  3TLV A;  2W61 A;  4ZRU A;  1NEK A;  2JMK A;  4EYU A;  4ZHQ E;  2H3R A;  4P0B A;  1OED B;  4TNV A;  2A72 A;  3AEA A;  3OYZ A;  3RF1 A;  4IST A;  5LYJ E;  2LSY A;  1ZHC A;  5J5H A;  3R6N A;  2E2A A;  1T8B A;  1HTJ F;  3L8R A;  5L2L A;  1YQ3 A;  4LF9 T;  2XQ6 A;  4GOU A;  4F8H A;  1N33 T;  2PBI A;  4DR2 T;  3U8K A;  3P50 A;  2ZM8 A;  3C4X A;  4UV9 B;  1WRD A;  4U7I A;  4PAG A;  3BK9 A;  4ASK A;  4AQF A;  2ZM2 A;  3AAA B;  4IRE A;  3FZL B;  5JDG A;  4EYY R;  2ZM6 T;  4KP3 C;  3ZC0 A;  3Q9D A;  2X67 A;  4JBW F;  1UK5 A;  2WWV A;  3RYC E;  3RIU C;  3C50 A;  2I0M A;  2DWG A;  4ALX A;  5FKY A;  4TV9 E;  3VRA A;  4PFP A;  2BR8 A;  2FJE A;  4ISS A;  3N9O A;  2BJ0 A;  4X1Y E;  4DV3 T;  3KBU A;  5CO5 A;  3CPZ A;  4ZI3 C;  3MXZ A;  5FVL A;  3TKL B;  2V7J A;  4IE5 A;  2BS3 A;  4U2Y A;  3Q2M A;  2YEV C;  5HWY A;  1UX5 A;  2L3L A;  1UGO A;  1CUN A;  5LMU T;  5KE4 A;  5IHY A;  3C51 A;  3MZK B;  3QB5 K;  1YKH B;  2V6X A;  4ILB A;  4J2C A;  3AAE B;  1XNR T;  1VRB A;  1M7K A;  5H6R B;  2B76 A;  3C4W A;  3UQ4 A;  2VL0 A;  2CEA A;  1B7T A;  4JI6 T;  5LGU B;  5CB4 E;  1D1C A;  5FY7 A;  2QGS A;  3FBL A;  4UV8 B;  2XQ4 A;  3CQX C;  3CX7 B;  2YU1 A;  3JAD A;  4DV6 T;  3PJA J;  5EK4 A;  5FJV A;  3ZST A;  2VVS A;  3FB2 A;  4O2B E;  3ZYL A;  4LML A;  5HXC A;  4CI2 B;  4I50 E;  4YXD A;  2AXD S;  4AQG A;  1KFY A;  3V5S A;  1NEN A;  1YD8 G;  4HFI A;  2CXD A;  4V1A v;  2SPC A;  4A56 A;  2IHR 1;  3VKG A;  3ZC1 A;  3VRB A;  2G0U A;  5FXZ A;  5AQL B;  2VVN A;  2EHO B;  3LK2 B;  1SE7 A;  3UU8 A;  4ZZC A;  4JYA T;  3N9M A;  4ZJS A;  3BQL A;  4IDZ A;  4ZI2 D;  1T98 A;  2FJB A;  5LBQ B;  4HTE A;  4IT4 A;  2X68 A;  4OYK A;  5JRE A;  2X9Y A;  5FL1 A;  3PUW F;  2V26 A;  3AE3 A;  2JQH A;  2JRK A;  3LK4 2;  5LXB A;  5JDN A;  2D0T A;  3D0T A;  4DR5 T;  2NTX A;  3FXD B;  2GK9 A;  5FL0 A;  2VQE T;  4QHO A;  4AIS A;  1YXR A;  1KNZ A;  1HNW T;  4YSX A;  5E0O A;  4UXU A;  2V6Y B;  1KEY A;  5HEH A;  4TUY E;  4BA9 A;  3M65 A;  3I0O A;  5LHI B;  5HXH A;  2J1D G;  2WB5 A;  2J62 A;  3L09 A;  4PK6 A;  4UVA B;  3RYI E;  5LGN B;  2QA7 A;  2IAK A;  5AQO B;  3MA9 A;  4UM3 S;  1U5P A;  3CML A;  4EGW A;  2UZ6 A;  5J0Z A;  4EOZ B;  5JR9 B;  4JEH B;  1G8X A;  3AEG A;  4I55 E;  4UEM A;  5C2T A;  3PV0 F;  5L3G B;  1OED A;  4ANJ A;  3AEF A;  3SQ9 A;  4NIQ A;  5CA1 E;  3PUR A;  4X66 T;  2X0H A;  4AFH A;  2LSG A;  5LB7 B;  2BKN A;  4HE8 A;  1Y01 A;  5IYZ E;  3ZMZ B;  4TWF A;  2YME A;  3A5X A;  3PUY F;  1KK7 A;  3RHW A;  2QRX A;  3P4W A;  1HS7 A;  5DJQ C;  4UXN B;  3QB5 A;  4EIW A;  3CQC B;  3QNU A;  4O8S A;  1UX2 A;  3C84 A;  2IC9 A;  4WBO A;  3PJA A;  4P0A A;  3GN5 B;  2XNT A;  2ES0 A;  3GMI A;  5FY1 A;  4O4J E;  4EB6 E;  4D01 A;  3ABV A;  2UXB T;  2QVA A;  4NUV A;  5LA6 E;  5LJM A;  2CM0 A;  2FBW A;  3FHN A;  3ZYM A;  3SRZ A;  2VKD A;  3OKQ A;  2Y6X A;  5FXX A;  3PU8 A;  2X00 D;  2CHN A;  2CRB A;  4U74 A;  2NWB A;  3O4X E;  4DBR A;  3EUH A;  3UTK A;  4ZXL A;  2DLR A;  2NR4 A;  4XZC A;  3OBV E;  4F6R C;  3UU4 A;  3T4M A;  2IDO B;  3U8L A;  5AQJ B;  2DI4 A;  5AFH A;  5KXJ A;  2KXP B;  3ZJ1 A;  2WM9 A;  3CQG B;  1SHZ C;  3QC9 A;  4U33 A;  2FJA A;  2H7V C;  4U31 A;  5LP6 E;  1YW0 A;  3RQU A;  4DR1 T;  5F8P A;  5LOV E;  3OJA A;  2XNV A;  3P4R A;  3RX6 A;  4AIU A;  4U7Y A;  5BRX A;  2N1G A;  1QLB A;  3PUV F;  3UUB A;  2JQQ A;  3E22 E;  2RPA A;  1DU2 A;  1QUU A;  4UVB B;  4ERR A;  4JLE A;  5L4H A;  2W62 A;  2HPL A;  2BYQ A;  1IAP A;  4O4H E;  2CLY B;  1D0X A;  2DL1 A;  4OYJ A;  2UUC T;  5DQW A;  5M4Y A;  2BKP A;  3ZLI A;  1D1B A;  3AEE A;  1I6Z A;  3EAM A;  2K5B B;  1N36 T;  3SOL A;  4GIW A;  3NWI A;  1MIY A;  2KLQ A;  3UUX B;  4K0K T;  5ABH A;  2E5L T;  5ABF A;  2XY8 B;  4YHH T;  2VWA A;  4OHF A;  5ADX L;  3CK6 A;  3AAI A;  4IE4 A;  2WMN A;  3AE8 A;  3ANW B;  5BW2 A;  2Z6E A;  4ZI2 C;  5L3E B;  3L39 A;  3IF8 B;  2CE7 A;  3ETV A;  3NVO A;  2A3D A;  2BYP A;  4Z90 A;  2V8S V;  4EV6 A;  4OX9 T;  2MAW A;  3T1H T;  2YOE A;  5LMN T;  2LM9 A;  3WTK A;  2EHO C;  5DAB A;  4KUM B;  2X66 A;  1XZY A;  2OLT A;  4LF8 T;  3I9Y A;  2UXX B;  3P7I A;  4C91 A;  5J5I A;  3HKE E;  3ETU A;  1SA0 E;  1S35 A;  4WYV A;  4AKR B;  2V6Y A;  5CGM A;  3U3I A;  5HYA A;  2NOX A;  4BJM A;  1KF6 A;  3EAB A;  3VR9 A;  5FP3 A;  3AXJ A;  3PUQ A;  4JI1 T;  5KX5 E;  3AB3 B;  2KWH A;  4TV8 E;  2UXC T;  1FMV A;  3OYX A;  3SWH A;  4UF0 A;  4K0U A;  3RIU A;  1X9B A;  2WNJ A;  5JDL A;  3EI0 A;  5C8Y E;  3WTI A;  1CHU A;  2C5I T;  3A7M A;  3E0Z A;  2M6B A;  3AVS A;  2Y48 B;  2NW9 A;  4CI3 B;  3P4P A;  4LF5 T;  3HA4 A;  4AKL A;  3B13 A;  4NZB A;  4YTP A;  2XHE B;  3QOF A;  3PE0 A;  5AQI B;  4GKJ T;  2XYS A;  4CXX A;  2CMR A;  3RQW A;  2H88 A;  2JPF A;  4BFQ A;  3ZMS B;  5HCJ A;  4GK5 E;  5BR8 T;  3ZT5 A;  3CWZ B;  4TN7 B;  5JR9 C;  1ZP0 A;  5HAX A;  3O9X A;  3H3A A;  3K3Q C;  5AIN A;  2NW8 A;  3I1A A;  4I4T E;  2LJL A;  1MNE A;  4H9R C;  1JNZ A;  3U78 A;  2MBG A;  3NZP A;  4YJ3 E;  3Q5E A;  2ACZ A;  4COF A;  3AE1 A;  1VOM A;  3H3M A;  4ZOL E;  4G63 A;  2UU9 T;  5LXT E;  4X5T A;  3ONL C;  2QC1 B;  3ONX A;  1KNP A;  3LDQ B;  2X51 A;  3FXE B;  3RRC A;  3WTH A;  2PH9 A;  2H7O A;  3UT5 E;  5BMV E;  4ZS3 A;  5IUX A;  3JAF A;  3N2K E;  2LRL A;  2K3W A;  4OK0 A;  3RPU A;  2XQA A;  2XTL A;  2LOP A;  3F2E A;  4ZS2 A;  2E9X C;  1MND A;  2WDV A;  5LHH B;  2BG9 E;  2X9W A;  3BQK A;  4DMV A;  3CVR A;  1HG2 A;  4O4I E;  2N9D A;  1OXZ A;  3GA8 A;  5FXW A;  4QAA A;  3RC8 A;  1U4Q A;  4ILU A;  4AKH A;  2Y54 A;  3NKZ A;  4MLK A;  4HFC A;  5AFM A;  4DR7 T;  5FY0 A;  4FI5 A;  2ZJV A;  2Y8D A;  4L5G A;  5FVK A;  5C3J A;  3AE9 A;  1MMA A;  2X0L B;  2XAH B;  3AA0 B;  2BKO A;  2HN1 A;  2YKS A;  2VK9 A;  2E5V A;  2Q9Q B;  3KV5 A;  2A2F X;  1WLX A;  2BG9 B;  4PFO A;  3RIF A;  1HX8 A;  3PU3 A;  1V9D A;  1X79 A;  3LFM A;  4QKN A;  3C64 A;  4PJM A;  3SIO A;  4DV1 T;  1VCT A;  5J2U E;  3R84 B;  4DR4 T;  1J1J A;  2K9A A;  4E7S A;  4CN4 A;  2V7I A;  2WS3 A;  4ZK1 A;  1E1H B;  2DHR A;  5CFB A;  2Q9Q D;  4ZR6 A;  3W15 B;  3HKD E;  3JC6 D;  2LSJ A;  1W0A A;  2EHO D;  2C5J A;  2BZB A;  3LBX B;  2YDQ A;  3O1J A;  3NRX A;  4AKG A;  2XYT A;  1ZV4 X;  4PK4 A;  4GKK T;  3EVY A;  1UCU A;  2CLY C;  3WI3 A;  2L9Q A;  5L3C B;  5JH7 E;  4ILA A;  2XAQ B;  4B3R T;  5AQQ B;  5GON E;  3RYH E;  4DV4 T;  1W9R A;  1T7S A;  3C98 B;  1H7C A;  2IIU A;  3AE5 A;  4CXY A;  4IE0 A;  3AVR A;  2XQ7 A;  1UUS A;  4DO0 A;  4M1P A;  4ZK4 A;  3FZF B;  3PTR B;  3AE2 A;  3MJX A;  3VHL A;  3PUA A;  1UW6 A;  4HFB A;  2YN6 A;  3I9W A;  4X62 T;  3PMZ A;  4AFT A;  3NRY A;  3J9X 1;  4KHZ F;  5JTG A;  1WR6 A;  2WCA A;  4N78 D;  1IBL T;  2QYW A;  1BR1 A;  3RRW A;  4YJ2 E;  4JI7 T;  3EDV A;  2KND A;  2CXF A;  4QH4 A;  1G73 A;  1S94 A;  2UUB T;  3WTN A;  4KMC A;  4Z91 A;  1FJG T;  4BJN A;  2IML A;  4U3C A;  4UM1 A;  5AQG B;  1T72 A;  4IDQ A;  1MMN A;  4AXP A;  1Y64 B;  3SFE A;  4A98 A;  2CXL A;  5JQG E;  2V5D A;  2FJD A;  4DUY T;  2XZE A;  4IL9 A;  1HNX T;  3T8O A;  3L3P A;  1MMD A;  2WZH A;  4JEU B;  2NW7 A;  2WWU A;  4PJL A;  3SQ6 A;  3T1Y T;  4JI2 T;  1FIO A;  3VR8 A;  2YDS A;  4Q25 A;  4MAL A;  2E9X B;  3CKD A;  1BR0 A;  3ZJ2 A;  2WZI A;  3K3N A;  3NBX X;  1HX1 B;  2J4G A;  3P8C D;  4QXH B;  5ABE A;  4X65 T;  4WW0 A;  3UFG A;  2CBI A;  3EHZ A;  2XM2 A;  4P09 A;  2AE9 A;  3KVA A;  5J2T E;  4AI6 A;  4HEA A;  3AED A;  4DV2 T;  2E9X D;  5AFN A;  2ZLY A;  3PUS A;  4QXC B;  4WV9 A;  2XQ8 A;  4DR3 T;  1HCI A;  3IGQ A;  4H9P C;  4HWF A;  4HGA A;  2CBJ A;  3S4U A;  3U8J A;  3B5M A;  2CWY A;  2WZY A;  2RA1 A;  4QX8 B;  2IW5 B;  2ZM0 A;  4HWC A;  5AFK A;  1LKX A;  3ZMV B;  2WAU A;  2W8F A;  4ZJT A;  4IE6 A;  4QXB B;  2BDE A;  2VL8 A;  4AKI A;  1E7P A;  3Q5W A;  1UV6 A;  2FUP A;  4DVD A;  1N32 T;  5CJ5 A;  4P1N A;  1OWA A;  4JI0 T;  3Q5D A;  3DJB A;  2WN9 A;  2X9H A;  3Q5X A;  5EK3 A;  3MK7 C;  3ZT6 A;  5AFL A;  3HI2 A;  4KX6 A;  2X9X A;  4CN6 A;  1WYC A;  1WCR A;  3U8N A;  4EEB A;  4DV0 T;  4ZEY A;  4A97 A;  5JRC B;  4DID B;  4B5D A;  2WNL A;  1J5E T;  1YQ4 A;  4KI0 F;  2HHH T;  4TX5 A;  3WTL A;  2IC6 A;  3VKH A;  2WBL A;  1MIW A;  3DP7 A;  3HL6 A;  4NPP A;  1D0Z A;  4O4L E;  2YDR A;  1SUM B;  4ADZ A;  4B3M T;  2VQF T;  2EHO A;  5ETW A;  3G06 A;  3LG7 A;  3PUX F;  2MTQ A;  2LRK A;  2V5C A;  4IDN A;  2XQY A;  4GK0 E;  3TLU A;  4JV5 T;  4CI1 B;  3AE4 A;  1XMQ T;  3F31 A;  4NUU A;  3AA7 B;  2VB6 A;  1XMO T;  1LRZ A;  5KZU A;  2RP4 A;  2UXN B;  2CWO A;  2Q9Q C;  2XZ5 A;  4TZ4 C;  1OED E;  5J5G A;  3MAC A;  3JC6 C;  3K1S A;  4AQY T;  4XHE A;  2BG9 C;  3WTJ A;  4QH1 A;  4QH5 A;  2ZMA A;  4IGU A;  1L0V A;  4G2A A;  3WIP A;  3ZSS A;  1VCS A;  3QUJ A;  4IL4 A;  2W0G A;  2BBJ A;  4EZ1 A;  2BVM A;  3WAJ A;  4LF4 T;  3KV6 A;  3KFW X;  5LCY A;  4BQT A;  2WY2 A;  3N9N A;  2XM1 A;  4AFG A;  2V7K A;  4JI3 T;  5FNV E;  2F4V T;  2MOZ A;  2PG8 A;  2OV9 A;  4OFZ A;  4JI8 T;  4LF6 T;  3AEB A;  3C4Z A;  4HWI B;  3EDU A;  2K24 A;  4HFE A;  2Y58 A;  5AQR B;  3IHR A;  3FZM B;  1E2A A;  3ZMU B;  3LSV A;  3SFD A;  5JR9 A;  3KDS E;  5LHG B;  4E7Z A;  2V7M A;  3GWH A;  3N9L A;  2H89 A;  4U72 A;  4DBQ A; 
#chains in the Genus database with same CATH homology
 5HEU A;  3PMZ A;  5AIN A;  3UU6 A;  4LMK A;  5L47 A;  4AFT A;  3RQU A;  5KE4 A;  1OED B;  3WTK A;  5AFN A;  4TNV A;  3TLU A;  2PGZ A;  2XNV A;  3UU3 A;  3ZKR A;  3ZDH A;  4TWF A;  2ZJU A;  2YME A;  4WV9 A;  4TWH A;  2XQ8 A;  3WTM A;  4ILB A;  4TWD A;  3IGQ A;  5BRX A;  2BG9 B;  5J5H A;  2XQ5 A;  4DBM A;  4UM3 A;  3RHW A;  5J5I A;  3RIF A;  4QAB A;  4COF A;  3P4W A;  2BYN A;  3GUA A;  3U8J A;  3UUB A;  2BR7 A;  5KZU A;  2BG9 A;  4QH4 A;  2X00 A;  4PIR A;  2WZY A;  2XZ5 A;  3WTN A;  3SH1 A;  3UQ4 A;  2XQ6 A;  4Z91 A;  2VL0 A;  4F8H A;  5LG3 A;  3UU5 A;  3SIO A;  4X5T A;  1OED E;  1UX2 A;  5J5G A;  3C84 A;  5BP0 A;  2QC1 B;  1I9B A;  4FRR A;  4ZZB A;  5LXB A;  2M6I A;  3U8K A;  5AFK A;  2BYR A;  2YMD A;  5JME A;  4XHE A;  2XZ6 A;  2BG9 C;  3P50 A;  3WTJ A;  4QH1 A;  4QH5 A;  2W8F A;  3TLS A;  2XNT A;  4ZJT A;  3WTO A;  4UM1 A;  2XQ3 A;  4D01 A;  5J5F A;  3WIP A;  2XQ4 A;  4ZK1 A;  3RIA A;  5HEO A;  3WTH A;  3ZDG A;  1UV6 A;  2PH9 A;  5CFB A;  5L4H A;  2BYQ A;  2XNU A;  3JAD A;  4IL4 A;  4IRE A;  4HQP A;  4A98 A;  4TNW A;  2KSR A;  4EZ1 A;  4UXU A;  4ZR6 A;  5FJV A;  5HEH A;  4IL9 A;  2WN9 A;  4HFH A;  5IUX A;  4HFD A;  3JAF A;  2WNJ A;  2Y7Y A;  4BQT A;  2XQA A;  2W8G A;  3C79 A;  3EAM A;  4LML A;  2X00 D;  5AFL A;  4AFG A;  5TVC A;  3EI0 A;  2LM2 A;  4UM3 P;  3SQ6 A;  3WTI A;  3UQ7 A;  2BG9 E;  2C9T A;  3U8N A;  2XYT A;  2Y57 A;  2BYS A;  4ALX A;  2M6B A;  3RI5 A;  4LMJ A;  3PEO A;  5SYO A;  4ILA A;  3JAE A;  2LKG A;  2LLY A;  4HFI A;  4QAA A;  4QAC A;  4UM3 S;  4A97 A;  5AFJ A;  2LKH A;  2UZ6 A;  2Y54 A;  5AFM B;  5J0Z A;  5HEG A;  4NZB A;  4HFE A;  2Y58 A;  4B5D A;  2WNL A;  4HFC A;  2BR8 A;  3WTL A;  5BW2 A;  5HCM A;  5AFM A;  2XQ9 A;  3LSV A;  5HEJ A;  2BJ0 A;  3TLT A;  2XYS A;  2ZJV A;  3UU4 A;  3T4M A;  2Y56 A;  3RQW A;  4XK9 A;  4BFQ A;  1OED A;  2XQ7 A;  4NPP A;  5CO5 A;  3SQ9 A;  5HCJ A;  3U8L A;  3TLW A;  2BYP A;  4Z90 A;  4ZK4 A;  2WNC A;  4ILC A;  5AFH A;  3U8M A;  4UY2 A;  2MAW A;  3UU8 A;  4ZZC A;  2YKS A;  3TLV A;  2YOE A;  4ZRU A;  4ZJS A;  5L4E A;  1OED C;  4AFH A;  1UW6 A;  4HFB A;  2YN6 A;  3EHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...