2C9TA

Crystal structure of acetylcholine binding protein (achbp) from aplysia californica in complex with alpha-conotoxin imi
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor/toxin
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural Determinants of Selective {Alpha}-Conotoxin Binding to a Nicotinic Acetylcholine Receptor Homolog Achbp.
pubmed doi rcsb
total genus 49
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2c9tA00
2BG9A 3RIAA 4F8HA 4X5TA 4ZZCA 5J0ZA 4PIRA 4UM3P 5TVCA 4A97A 5L47A 2XZ6A 2XNTA 5LG3A 4Z90A 5HEHA 4ZJSA 2QC1B 5AFNA 1I9BA 5BW2A 4ZK4A 2XZ5A 3RQWA 2XNVA 5HEUA 4D01A 3P4WA 4QH4A 5BP0A 5AFLA 5FJVA 4ZR6A 2XQ7A 2Y57A 2XQ9A 2YMEA 3WTJA 2BR7A 3WTHA 2XYSA 3EHZA 4ZK1A 3SQ6A 2BYPA 5AFMB 3JAEA 5AINA 2XNUA 3RHWA 3TLVA 3C79A 2WN9A 4QABA 4QAAA 2Y58A 3U8NA 3SQ9A 4A98A 4BFQA 2BJ0A 2X00A 4HFBA 2C9TA 4HFIA 4IREA 3ZKRA 4QACA 3IGQA 2XQ6A 3RQUA 4AFGA 4ALXA 3SH1A 2BR8A 4ZRUA 3U8MA 3TLWA 4QH1A 4TWDA 4XK9A 3WTIA 2XQ4A 2Y54A 3GUAA 2Y56A 4UM3A 2YN6A 2Y7YA 3TLUA 4LMJA 4AFTA 4LMKA 4HFEA 3UU3A 4B5DA 2BYQA 3WTLA 5KE4A 4AFHA 3U8JA 3EI0A 3U8KA 3UQ7A 4XHEA 4FRRA 3TLTA 2PGZA 2WNJA 5CFBA 4TWHA 5J5IA 3WTOA 4HFDA 4TNWA 4COFA 4LMLA 4DBMA 2XQ5A 1UW6A 4HFHA 5J5GA 5KZUA 5L4EA 5JMEA 5AFMA 3UUBA 5HEOA 5L4HA 4BQTA 5AFKA 2YMDA 5J5FA 3ZDGA 3PMZA 4TNVA 5HEJA 3SIOA 5HCMA 5CO5A 2WNCA 5SYOA 2YKSA 1UV6A 3WTMA 2VL0A 2W8FA 4ILCA 2BYRA 4Z91A 2ZJVA 4UXUA 5IUXA 2XYTA 2BG9E 2XQAA 4WV9A 2BG9B 2WNLA 5AFHA 4NZBA 3PEOA 5BRXA 2XQ3A 2BYNA 3JADA 4IL9A 4IL4A 5AFJA 3UU5A 2UZ6A 4NPPA 2W8GA 2BG9C 3P50A 3JAFA 3WTKA 3WIPA 2BYSA 3C84A 4HQPA 4HFCA 5J5HA 5HEGA 2WZYA 3U8LA 3UU4A 3ZDHA 2XQ8A 1UX2A 5LXBA 3TLSA 2YOEA 4EZ1A 2X00D 3EAMA 3UU6A 2ZJUA 4ZZBA 3UQ4A 4TWFA 2PH9A 3LSVA 4UY2A 5HCJA 3UU8A 4UM3S 4ILBA 4ILAA 4UM1A 3RI5A 3WTNA 4QH5A 3T4MA 3RIFA 4ZJTA
chains in the Genus database with same CATH superfamily
2BG9A 3RIAA 4F8HA 4X5TA 4ZZCA 5J0ZA 4PIRA 4UM3P 5TVCA 4A97A 5L47A 2XZ6A 2XNTA 5LG3A 4Z90A 5HEHA 4ZJSA 2QC1B 5AFNA 1I9BA 5BW2A 4ZK4A 2XZ5A 3RQWA 2XNVA 5HEUA 4D01A 3P4WA 4QH4A 5BP0A 5AFLA 5FJVA 4ZR6A 2XQ7A 2Y57A 2XQ9A 2YMEA 3WTJA 2BR7A 3WTHA 2XYSA 3EHZA 4ZK1A 3SQ6A 2BYPA 5AFMB 3JAEA 5AINA 2XNUA 3RHWA 3TLVA 3C79A 2WN9A 4QABA 4QAAA 2Y58A 3U8NA 3SQ9A 4A98A 4BFQA 2BJ0A 2X00A 4HFBA 2C9TA 4HFIA 4IREA 3ZKRA 4QACA 3IGQA 2XQ6A 3RQUA 4AFGA 4ALXA 3SH1A 2BR8A 4ZRUA 3U8MA 3TLWA 4QH1A 4TWDA 4XK9A 3WTIA 2XQ4A 2Y54A 3GUAA 2Y56A 4UM3A 2YN6A 2Y7YA 3TLUA 4LMJA 4AFTA 4LMKA 4HFEA 3UU3A 4B5DA 2BYQA 3WTLA 5KE4A 4AFHA 3U8JA 3EI0A 3U8KA 3UQ7A 4XHEA 4FRRA 3TLTA 2PGZA 2WNJA 5CFBA 4TWHA 5J5IA 3WTOA 4HFDA 4TNWA 4COFA 4LMLA 4DBMA 2XQ5A 1UW6A 4HFHA 5J5GA 5KZUA 5L4EA 5JMEA 5AFMA 3UUBA 5HEOA 5L4HA 4BQTA 5AFKA 2YMDA 5J5FA 3ZDGA 3PMZA 4TNVA 5HEJA 3SIOA 5HCMA 5CO5A 2WNCA 5SYOA 2YKSA 1UV6A 3WTMA 2VL0A 2W8FA 4ILCA 2BYRA 4Z91A 2ZJVA 4UXUA 5IUXA 2XYTA 2BG9E 2XQAA 4WV9A 2BG9B 2WNLA 5AFHA 4NZBA 3PEOA 5BRXA 2XQ3A 2BYNA 3JADA 4IL9A 4IL4A 5AFJA 3UU5A 2UZ6A 4NPPA 2W8GA 2BG9C 3P50A 3JAFA 3WTKA 3WIPA 2BYSA 3C84A 4HQPA 4HFCA 5J5HA 5HEGA 2WZYA 3U8LA 3UU4A 3ZDHA 2XQ8A 1UX2A 5LXBA 3TLSA 2YOEA 4EZ1A 2X00D 3EAMA 3UU6A 2ZJUA 4ZZBA 3UQ4A 4TWFA 2PH9A 3LSVA 4UY2A 5HCJA 3UU8A 4UM3S 4ILBA 4ILAA 4UM1A 3RI5A 3WTNA 4QH5A 3T4MA 3RIFA 4ZJTA
chains in the Genus database with same CATH topology
2BG9A 3RIAA 4F8HA 4X5TA 4ZZCA 5J0ZA 4PIRA 4UM3P 5TVCA 4A97A 5L47A 2XZ6A 2XNTA 5LG3A 4Z90A 5HEHA 4ZJSA 2QC1B 5AFNA 1I9BA 5BW2A 4ZK4A 2XZ5A 3RQWA 2XNVA 5HEUA 4D01A 3P4WA 4QH4A 5BP0A 5AFLA 5FJVA 4ZR6A 2XQ7A 2Y57A 2XQ9A 2YMEA 3WTJA 2BR7A 3WTHA 2XYSA 3EHZA 4ZK1A 3SQ6A 2BYPA 5AFMB 3JAEA 5AINA 2XNUA 3RHWA 3TLVA 3C79A 2WN9A 4QABA 4QAAA 2Y58A 3U8NA 3SQ9A 4A98A 4BFQA 2BJ0A 2X00A 4HFBA 2C9TA 4HFIA 4IREA 3ZKRA 4QACA 3IGQA 2XQ6A 3RQUA 4AFGA 4ALXA 3SH1A 2BR8A 4ZRUA 3U8MA 3TLWA 4QH1A 4TWDA 4XK9A 3WTIA 2XQ4A 2Y54A 3GUAA 2Y56A 4UM3A 2YN6A 2Y7YA 3TLUA 4LMJA 4AFTA 4LMKA 4HFEA 3UU3A 4B5DA 2BYQA 3WTLA 5KE4A 4AFHA 3U8JA 3EI0A 3U8KA 3UQ7A 4XHEA 4FRRA 3TLTA 2PGZA 2WNJA 5CFBA 4TWHA 5J5IA 3WTOA 4HFDA 4TNWA 4COFA 4LMLA 4DBMA 2XQ5A 1UW6A 4HFHA 5J5GA 5KZUA 5L4EA 5JMEA 5AFMA 3UUBA 5HEOA 5L4HA 4BQTA 5AFKA 2YMDA 5J5FA 3ZDGA 3PMZA 4TNVA 5HEJA 3SIOA 5HCMA 5CO5A 2WNCA 5SYOA 2YKSA 1UV6A 3WTMA 2VL0A 2W8FA 4ILCA 2BYRA 4Z91A 2ZJVA 4UXUA 5IUXA 2XYTA 2BG9E 2XQAA 4WV9A 2BG9B 2WNLA 5AFHA 4NZBA 3PEOA 5BRXA 2XQ3A 2BYNA 3JADA 4IL9A 4IL4A 5AFJA 3UU5A 2UZ6A 4NPPA 2W8GA 2BG9C 3P50A 3JAFA 3WTKA 3WIPA 2BYSA 3C84A 4HQPA 4HFCA 5J5HA 5HEGA 2WZYA 3U8LA 3UU4A 3ZDHA 2XQ8A 1UX2A 5LXBA 3TLSA 2YOEA 4EZ1A 2X00D 3EAMA 3UU6A 2ZJUA 4ZZBA 3UQ4A 4TWFA 2PH9A 3LSVA 4UY2A 5HCJA 3UU8A 4UM3S 4ILBA 4ILAA 4UM1A 3RI5A 3WTNA 4QH5A 3T4MA 3RIFA 4ZJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BG9 A;  3RIA A;  4F8H A;  4X5T A;  4ZZC A;  5J0Z A;  4PIR A;  4UM3 P;  5TVC A;  4A97 A;  5L47 A;  2XZ6 A;  2XNT A;  5LG3 A;  4Z90 A;  5HEH A;  4ZJS A;  2QC1 B;  5AFN A;  1I9B A;  5BW2 A;  4ZK4 A;  2XZ5 A;  3RQW A;  2XNV A;  5HEU A;  4D01 A;  3P4W A;  4QH4 A;  5BP0 A;  5AFL A;  5FJV A;  4ZR6 A;  2XQ7 A;  2Y57 A;  2XQ9 A;  2YME A;  3WTJ A;  2BR7 A;  3WTH A;  2XYS A;  3EHZ A;  4ZK1 A;  3SQ6 A;  2BYP A;  5AFM B;  3JAE A;  5AIN A;  2XNU A;  3RHW A;  3TLV A;  3C79 A;  2WN9 A;  4QAB A;  4QAA A;  2Y58 A;  3U8N A;  3SQ9 A;  4A98 A;  4BFQ A;  2BJ0 A;  2X00 A;  4HFB A;  2C9T A;  4HFI A;  4IRE A;  3ZKR A;  4QAC A;  3IGQ A;  2XQ6 A;  3RQU A;  4AFG A;  4ALX A;  3SH1 A;  2BR8 A;  4ZRU A;  3U8M A;  3TLW A;  4QH1 A;  4TWD A;  4XK9 A;  3WTI A;  2XQ4 A;  2Y54 A;  3GUA A;  2Y56 A;  4UM3 A;  2YN6 A;  2Y7Y A;  3TLU A;  4LMJ A;  4AFT A;  4LMK A;  4HFE A;  3UU3 A;  4B5D A;  2BYQ A;  3WTL A;  5KE4 A;  4AFH A;  3U8J A;  3EI0 A;  3U8K A;  3UQ7 A;  4XHE A;  4FRR A;  3TLT A;  2PGZ A;  2WNJ A;  5CFB A;  4TWH A;  5J5I A;  3WTO A;  4HFD A;  4TNW A;  4COF A;  4LML A;  4DBM A;  2XQ5 A;  1UW6 A;  4HFH A;  5J5G A;  5KZU A;  5L4E A;  5JME A;  5AFM A;  3UUB A;  5HEO A;  5L4H A;  4BQT A;  5AFK A;  2YMD A;  5J5F A;  3ZDG A;  3PMZ A;  4TNV A;  5HEJ A;  3SIO A;  5HCM A;  5CO5 A;  2WNC A;  5SYO A;  2YKS A;  1UV6 A;  3WTM A;  2VL0 A;  2W8F A;  4ILC A;  2BYR A;  4Z91 A;  2ZJV A;  4UXU A;  5IUX A;  2XYT A;  2BG9 E;  2XQA A;  4WV9 A;  2BG9 B;  2WNL A;  5AFH A;  4NZB A;  3PEO A;  5BRX A;  2XQ3 A;  2BYN A;  3JAD A;  4IL9 A;  4IL4 A;  5AFJ A;  3UU5 A;  2UZ6 A;  4NPP A;  2W8G A;  2BG9 C;  3P50 A;  3JAF A;  3WTK A;  3WIP A;  2BYS A;  3C84 A;  4HQP A;  4HFC A;  5J5H A;  5HEG A;  2WZY A;  3U8L A;  3UU4 A;  3ZDH A;  2XQ8 A;  1UX2 A;  5LXB A;  3TLS A;  2YOE A;  4EZ1 A;  2X00 D;  3EAM A;  3UU6 A;  2ZJU A;  4ZZB A;  3UQ4 A;  4TWF A;  2PH9 A;  3LSV A;  4UY2 A;  5HCJ A;  3UU8 A;  4UM3 S;  4ILB A;  4ILA A;  4UM1 A;  3RI5 A;  3WTN A;  4QH5 A;  3T4M A;  3RIF A;  4ZJT A; 
#chains in the Genus database with same CATH topology
 2BG9 A;  3RIA A;  4F8H A;  4X5T A;  4ZZC A;  5J0Z A;  4PIR A;  4UM3 P;  5TVC A;  4A97 A;  5L47 A;  2XZ6 A;  2XNT A;  5LG3 A;  4Z90 A;  5HEH A;  4ZJS A;  2QC1 B;  5AFN A;  1I9B A;  5BW2 A;  4ZK4 A;  2XZ5 A;  3RQW A;  2XNV A;  5HEU A;  4D01 A;  3P4W A;  4QH4 A;  5BP0 A;  5AFL A;  5FJV A;  4ZR6 A;  2XQ7 A;  2Y57 A;  2XQ9 A;  2YME A;  3WTJ A;  2BR7 A;  3WTH A;  2XYS A;  3EHZ A;  4ZK1 A;  3SQ6 A;  2BYP A;  5AFM B;  3JAE A;  5AIN A;  2XNU A;  3RHW A;  3TLV A;  3C79 A;  2WN9 A;  4QAB A;  4QAA A;  2Y58 A;  3U8N A;  3SQ9 A;  4A98 A;  4BFQ A;  2BJ0 A;  2X00 A;  4HFB A;  2C9T A;  4HFI A;  4IRE A;  3ZKR A;  4QAC A;  3IGQ A;  2XQ6 A;  3RQU A;  4AFG A;  4ALX A;  3SH1 A;  2BR8 A;  4ZRU A;  3U8M A;  3TLW A;  4QH1 A;  4TWD A;  4XK9 A;  3WTI A;  2XQ4 A;  2Y54 A;  3GUA A;  2Y56 A;  4UM3 A;  2YN6 A;  2Y7Y A;  3TLU A;  4LMJ A;  4AFT A;  4LMK A;  4HFE A;  3UU3 A;  4B5D A;  2BYQ A;  3WTL A;  5KE4 A;  4AFH A;  3U8J A;  3EI0 A;  3U8K A;  3UQ7 A;  4XHE A;  4FRR A;  3TLT A;  2PGZ A;  2WNJ A;  5CFB A;  4TWH A;  5J5I A;  3WTO A;  4HFD A;  4TNW A;  4COF A;  4LML A;  4DBM A;  2XQ5 A;  1UW6 A;  4HFH A;  5J5G A;  5KZU A;  5L4E A;  5JME A;  5AFM A;  3UUB A;  5HEO A;  5L4H A;  4BQT A;  5AFK A;  2YMD A;  5J5F A;  3ZDG A;  3PMZ A;  4TNV A;  5HEJ A;  3SIO A;  5HCM A;  5CO5 A;  2WNC A;  5SYO A;  2YKS A;  1UV6 A;  3WTM A;  2VL0 A;  2W8F A;  4ILC A;  2BYR A;  4Z91 A;  2ZJV A;  4UXU A;  5IUX A;  2XYT A;  2BG9 E;  2XQA A;  4WV9 A;  2BG9 B;  2WNL A;  5AFH A;  4NZB A;  3PEO A;  5BRX A;  2XQ3 A;  2BYN A;  3JAD A;  4IL9 A;  4IL4 A;  5AFJ A;  3UU5 A;  2UZ6 A;  4NPP A;  2W8G A;  2BG9 C;  3P50 A;  3JAF A;  3WTK A;  3WIP A;  2BYS A;  3C84 A;  4HQP A;  4HFC A;  5J5H A;  5HEG A;  2WZY A;  3U8L A;  3UU4 A;  3ZDH A;  2XQ8 A;  1UX2 A;  5LXB A;  3TLS A;  2YOE A;  4EZ1 A;  2X00 D;  3EAM A;  3UU6 A;  2ZJU A;  4ZZB A;  3UQ4 A;  4TWF A;  2PH9 A;  3LSV A;  4UY2 A;  5HCJ A;  3UU8 A;  4UM3 S;  4ILB A;  4ILA A;  4UM1 A;  3RI5 A;  3WTN A;  4QH5 A;  3T4M A;  3RIF A;  4ZJT A; 
#chains in the Genus database with same CATH homology
 2BG9 A;  3RIA A;  4F8H A;  4X5T A;  4ZZC A;  5J0Z A;  4PIR A;  4UM3 P;  5TVC A;  4A97 A;  5L47 A;  2XZ6 A;  2XNT A;  5LG3 A;  4Z90 A;  5HEH A;  4ZJS A;  2QC1 B;  5AFN A;  1I9B A;  5BW2 A;  4ZK4 A;  2XZ5 A;  3RQW A;  2XNV A;  5HEU A;  4D01 A;  3P4W A;  4QH4 A;  5BP0 A;  5AFL A;  5FJV A;  4ZR6 A;  2XQ7 A;  2Y57 A;  2XQ9 A;  2YME A;  3WTJ A;  2BR7 A;  3WTH A;  2XYS A;  3EHZ A;  4ZK1 A;  3SQ6 A;  2BYP A;  5AFM B;  3JAE A;  5AIN A;  2XNU A;  3RHW A;  3TLV A;  3C79 A;  2WN9 A;  4QAB A;  4QAA A;  2Y58 A;  3U8N A;  3SQ9 A;  4A98 A;  4BFQ A;  2BJ0 A;  2X00 A;  4HFB A;  2C9T A;  4HFI A;  4IRE A;  3ZKR A;  4QAC A;  3IGQ A;  2XQ6 A;  3RQU A;  4AFG A;  4ALX A;  3SH1 A;  2BR8 A;  4ZRU A;  3U8M A;  3TLW A;  4QH1 A;  4TWD A;  4XK9 A;  3WTI A;  2XQ4 A;  2Y54 A;  3GUA A;  2Y56 A;  4UM3 A;  2YN6 A;  2Y7Y A;  3TLU A;  4LMJ A;  4AFT A;  4LMK A;  4HFE A;  3UU3 A;  4B5D A;  2BYQ A;  3WTL A;  5KE4 A;  4AFH A;  3U8J A;  3EI0 A;  3U8K A;  3UQ7 A;  4XHE A;  4FRR A;  3TLT A;  2PGZ A;  2WNJ A;  5CFB A;  4TWH A;  5J5I A;  3WTO A;  4HFD A;  4TNW A;  4COF A;  4LML A;  4DBM A;  2XQ5 A;  1UW6 A;  4HFH A;  5J5G A;  5KZU A;  5L4E A;  5JME A;  5AFM A;  3UUB A;  5HEO A;  5L4H A;  4BQT A;  5AFK A;  2YMD A;  5J5F A;  3ZDG A;  3PMZ A;  4TNV A;  5HEJ A;  3SIO A;  5HCM A;  5CO5 A;  2WNC A;  5SYO A;  2YKS A;  1UV6 A;  3WTM A;  2VL0 A;  2W8F A;  4ILC A;  2BYR A;  4Z91 A;  2ZJV A;  4UXU A;  5IUX A;  2XYT A;  2BG9 E;  2XQA A;  4WV9 A;  2BG9 B;  2WNL A;  5AFH A;  4NZB A;  3PEO A;  5BRX A;  2XQ3 A;  2BYN A;  3JAD A;  4IL9 A;  4IL4 A;  5AFJ A;  3UU5 A;  2UZ6 A;  4NPP A;  2W8G A;  2BG9 C;  3P50 A;  3JAF A;  3WTK A;  3WIP A;  2BYS A;  3C84 A;  4HQP A;  4HFC A;  5J5H A;  5HEG A;  2WZY A;  3U8L A;  3UU4 A;  3ZDH A;  2XQ8 A;  1UX2 A;  5LXB A;  3TLS A;  2YOE A;  4EZ1 A;  2X00 D;  3EAM A;  3UU6 A;  2ZJU A;  4ZZB A;  3UQ4 A;  4TWF A;  2PH9 A;  3LSV A;  4UY2 A;  5HCJ A;  3UU8 A;  4UM3 S;  4ILB A;  4ILA A;  4UM1 A;  3RI5 A;  3WTN A;  4QH5 A;  3T4M A;  3RIF A;  4ZJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...