5AFMA

Alpha7-achbp in complex with lobeline and fragment 4
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
205
Chain Sequence
b'GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 43
structure length 205
sequence length 205
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afmA00
3P50A 4PIRA 3GUAA 5LG3A 4IL4A 5HCJA 3WTMA 2XNTA 2XYSA 2BYQA 2BYSA 3TLSA 2WNJA 3PMZA 4LMKA 4UM3S 2BG9A 2PGZA 3SIOA 2BJ0A 2BYNA 2WN9A 3JADA 3RQWA 5AFMA 4HFEA 4AFTA 2BR8A 4QH4A 3WTKA 2X00D 4Z90A 1UV6A 4ZJTA 2Y7YA 4ZZCA 2YMDA 2XNVA 3WTLA 3TLWA 2BG9E 5J5GA 2YKSA 5J0ZA 4QABA 5AFLA 3EAMA 4QH5A 5BP0A 5J5FA 3ZDHA 4Z91A 2XQAA 3WIPA 5CFBA 3UQ7A 3U8MA 5L47A 3UU5A 5AFMB 3WTJA 4HFBA 4TWHA 5IUXA 4HFIA 4QH1A 5JMEA 3U8NA 3RHWA 2UZ6A 3JAEA 5AINA 2Y54A 4TWFA 4HFCA 3U8KA 4XHEA 4COFA 2C9TA 5L4HA 2VL0A 1I9BA 1UW6A 4X5TA 5HEOA 2BR7A 4D01A 4LMLA 3JAFA 4UM3P 2XQ5A 2XQ4A 2ZJVA 4HFDA 1UX2A 5BRXA 3TLVA 4AFGA 3TLTA 4UM3A 2Y58A 4ILAA 2XZ5A 3U8LA 4ZZBA 2BG9C 5AFNA 3C79A 3C84A 3UU8A 3WTHA 5AFKA 3SH1A 3U8JA 2YN6A 3SQ9A 2XQ8A 2XQ6A 3PEOA 4TNVA 2XQ3A 3UUBA 4AFHA 2WNCA 4QACA 5TVCA 4UY2A 2XQ9A 4ZRUA 3WTIA 4F8HA 2BYPA 5L4EA 4A97A 3RIFA 4HQPA 2QC1B 2XNUA 2W8GA 3EHZA 4ZK4A 2PH9A 5BW2A 3RIAA 4BFQA 4QAAA 3RI5A 5HCMA 4NPPA 2WZYA 2XQ7A 5KE4A 5AFHA 2BYRA 4IL9A 4LMJA 3UU4A 4NZBA 2YMEA 3UQ4A 4HFHA 5SYOA 2YOEA 4ILCA 4B5DA 4ALXA 4BQTA 5HEJA 2X00A 2WNLA 4WV9A 5FJVA 5KZUA 4UM1A 5J5IA 2XYTA 2Y57A 2Y56A 4ZJSA 3UU6A 4A98A 3T4MA 5AFJA 5HEHA 4FRRA 4ZK1A 2W8FA 4XK9A 5HEGA 3ZKRA 3EI0A 5CO5A 3TLUA 3UU3A 4IREA 5J5HA 3WTNA 3LSVA 3IGQA 3WTOA 3ZDGA 2XZ6A 5HEUA 3P4WA 4EZ1A 4ZR6A 4TWDA 4UXUA 3SQ6A 5LXBA 2BG9B 4TNWA 3RQUA 4DBMA 4ILBA 2ZJUA
chains in the Genus database with same CATH superfamily
3P50A 4PIRA 3GUAA 5LG3A 4IL4A 5HCJA 3WTMA 2XNTA 2XYSA 2BYQA 2BYSA 3TLSA 2WNJA 3PMZA 4LMKA 4UM3S 2BG9A 2PGZA 3SIOA 2BJ0A 2BYNA 2WN9A 3JADA 3RQWA 5AFMA 4HFEA 4AFTA 2BR8A 4QH4A 3WTKA 2X00D 4Z90A 1UV6A 4ZJTA 2Y7YA 4ZZCA 2YMDA 2XNVA 3WTLA 3TLWA 2BG9E 5J5GA 2YKSA 5J0ZA 4QABA 5AFLA 3EAMA 4QH5A 5BP0A 5J5FA 3ZDHA 4Z91A 2XQAA 3WIPA 5CFBA 3UQ7A 3U8MA 5L47A 3UU5A 5AFMB 3WTJA 4HFBA 4TWHA 5IUXA 4HFIA 4QH1A 5JMEA 3U8NA 3RHWA 2UZ6A 3JAEA 5AINA 2Y54A 4TWFA 4HFCA 3U8KA 4XHEA 4COFA 2C9TA 5L4HA 2VL0A 1I9BA 1UW6A 4X5TA 5HEOA 2BR7A 4D01A 4LMLA 3JAFA 4UM3P 2XQ5A 2XQ4A 2ZJVA 4HFDA 1UX2A 5BRXA 3TLVA 4AFGA 3TLTA 4UM3A 2Y58A 4ILAA 2XZ5A 3U8LA 4ZZBA 2BG9C 5AFNA 3C79A 3C84A 3UU8A 3WTHA 5AFKA 3SH1A 3U8JA 2YN6A 3SQ9A 2XQ8A 2XQ6A 3PEOA 4TNVA 2XQ3A 3UUBA 4AFHA 2WNCA 4QACA 5TVCA 4UY2A 2XQ9A 4ZRUA 3WTIA 4F8HA 2BYPA 5L4EA 4A97A 3RIFA 4HQPA 2QC1B 2XNUA 2W8GA 3EHZA 4ZK4A 2PH9A 5BW2A 3RIAA 4BFQA 4QAAA 3RI5A 5HCMA 4NPPA 2WZYA 2XQ7A 5KE4A 5AFHA 2BYRA 4IL9A 4LMJA 3UU4A 4NZBA 2YMEA 3UQ4A 4HFHA 5SYOA 2YOEA 4ILCA 4B5DA 4ALXA 4BQTA 5HEJA 2X00A 2WNLA 4WV9A 5FJVA 5KZUA 4UM1A 5J5IA 2XYTA 2Y57A 2Y56A 4ZJSA 3UU6A 4A98A 3T4MA 5AFJA 5HEHA 4FRRA 4ZK1A 2W8FA 4XK9A 5HEGA 3ZKRA 3EI0A 5CO5A 3TLUA 3UU3A 4IREA 5J5HA 3WTNA 3LSVA 3IGQA 3WTOA 3ZDGA 2XZ6A 5HEUA 3P4WA 4EZ1A 4ZR6A 4TWDA 4UXUA 3SQ6A 5LXBA 2BG9B 4TNWA 3RQUA 4DBMA 4ILBA 2ZJUA
chains in the Genus database with same CATH topology
3P50A 4PIRA 3GUAA 5LG3A 4IL4A 5HCJA 3WTMA 2XNTA 2XYSA 2BYQA 2BYSA 3TLSA 2WNJA 3PMZA 4LMKA 4UM3S 2BG9A 2PGZA 3SIOA 2BJ0A 2BYNA 2WN9A 3JADA 3RQWA 5AFMA 4HFEA 4AFTA 2BR8A 4QH4A 3WTKA 2X00D 4Z90A 1UV6A 4ZJTA 2Y7YA 4ZZCA 2YMDA 2XNVA 3WTLA 3TLWA 2BG9E 5J5GA 2YKSA 5J0ZA 4QABA 5AFLA 3EAMA 4QH5A 5BP0A 5J5FA 3ZDHA 4Z91A 2XQAA 3WIPA 5CFBA 3UQ7A 3U8MA 5L47A 3UU5A 5AFMB 3WTJA 4HFBA 4TWHA 5IUXA 4HFIA 4QH1A 5JMEA 3U8NA 3RHWA 2UZ6A 3JAEA 5AINA 2Y54A 4TWFA 4HFCA 3U8KA 4XHEA 4COFA 2C9TA 5L4HA 2VL0A 1I9BA 1UW6A 4X5TA 5HEOA 2BR7A 4D01A 4LMLA 3JAFA 4UM3P 2XQ5A 2XQ4A 2ZJVA 4HFDA 1UX2A 5BRXA 3TLVA 4AFGA 3TLTA 4UM3A 2Y58A 4ILAA 2XZ5A 3U8LA 4ZZBA 2BG9C 5AFNA 3C79A 3C84A 3UU8A 3WTHA 5AFKA 3SH1A 3U8JA 2YN6A 3SQ9A 2XQ8A 2XQ6A 3PEOA 4TNVA 2XQ3A 3UUBA 4AFHA 2WNCA 4QACA 5TVCA 4UY2A 2XQ9A 4ZRUA 3WTIA 4F8HA 2BYPA 5L4EA 4A97A 3RIFA 4HQPA 2QC1B 2XNUA 2W8GA 3EHZA 4ZK4A 2PH9A 5BW2A 3RIAA 4BFQA 4QAAA 3RI5A 5HCMA 4NPPA 2WZYA 2XQ7A 5KE4A 5AFHA 2BYRA 4IL9A 4LMJA 3UU4A 4NZBA 2YMEA 3UQ4A 4HFHA 5SYOA 2YOEA 4ILCA 4B5DA 4ALXA 4BQTA 5HEJA 2X00A 2WNLA 4WV9A 5FJVA 5KZUA 4UM1A 5J5IA 2XYTA 2Y57A 2Y56A 4ZJSA 3UU6A 4A98A 3T4MA 5AFJA 5HEHA 4FRRA 4ZK1A 2W8FA 4XK9A 5HEGA 3ZKRA 3EI0A 5CO5A 3TLUA 3UU3A 4IREA 5J5HA 3WTNA 3LSVA 3IGQA 3WTOA 3ZDGA 2XZ6A 5HEUA 3P4WA 4EZ1A 4ZR6A 4TWDA 4UXUA 3SQ6A 5LXBA 2BG9B 4TNWA 3RQUA 4DBMA 4ILBA 2ZJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P50 A;  4PIR A;  3GUA A;  5LG3 A;  4IL4 A;  5HCJ A;  3WTM A;  2XNT A;  2XYS A;  2BYQ A;  2BYS A;  3TLS A;  2WNJ A;  3PMZ A;  4LMK A;  4UM3 S;  2BG9 A;  2PGZ A;  3SIO A;  2BJ0 A;  2BYN A;  2WN9 A;  3JAD A;  3RQW A;  5AFM A;  4HFE A;  4AFT A;  2BR8 A;  4QH4 A;  3WTK A;  2X00 D;  4Z90 A;  1UV6 A;  4ZJT A;  2Y7Y A;  4ZZC A;  2YMD A;  2XNV A;  3WTL A;  3TLW A;  2BG9 E;  5J5G A;  2YKS A;  5J0Z A;  4QAB A;  5AFL A;  3EAM A;  4QH5 A;  5BP0 A;  5J5F A;  3ZDH A;  4Z91 A;  2XQA A;  3WIP A;  5CFB A;  3UQ7 A;  3U8M A;  5L47 A;  3UU5 A;  5AFM B;  3WTJ A;  4HFB A;  4TWH A;  5IUX A;  4HFI A;  4QH1 A;  5JME A;  3U8N A;  3RHW A;  2UZ6 A;  3JAE A;  5AIN A;  2Y54 A;  4TWF A;  4HFC A;  3U8K A;  4XHE A;  4COF A;  2C9T A;  5L4H A;  2VL0 A;  1I9B A;  1UW6 A;  4X5T A;  5HEO A;  2BR7 A;  4D01 A;  4LML A;  3JAF A;  4UM3 P;  2XQ5 A;  2XQ4 A;  2ZJV A;  4HFD A;  1UX2 A;  5BRX A;  3TLV A;  4AFG A;  3TLT A;  4UM3 A;  2Y58 A;  4ILA A;  2XZ5 A;  3U8L A;  4ZZB A;  2BG9 C;  5AFN A;  3C79 A;  3C84 A;  3UU8 A;  3WTH A;  5AFK A;  3SH1 A;  3U8J A;  2YN6 A;  3SQ9 A;  2XQ8 A;  2XQ6 A;  3PEO A;  4TNV A;  2XQ3 A;  3UUB A;  4AFH A;  2WNC A;  4QAC A;  5TVC A;  4UY2 A;  2XQ9 A;  4ZRU A;  3WTI A;  4F8H A;  2BYP A;  5L4E A;  4A97 A;  3RIF A;  4HQP A;  2QC1 B;  2XNU A;  2W8G A;  3EHZ A;  4ZK4 A;  2PH9 A;  5BW2 A;  3RIA A;  4BFQ A;  4QAA A;  3RI5 A;  5HCM A;  4NPP A;  2WZY A;  2XQ7 A;  5KE4 A;  5AFH A;  2BYR A;  4IL9 A;  4LMJ A;  3UU4 A;  4NZB A;  2YME A;  3UQ4 A;  4HFH A;  5SYO A;  2YOE A;  4ILC A;  4B5D A;  4ALX A;  4BQT A;  5HEJ A;  2X00 A;  2WNL A;  4WV9 A;  5FJV A;  5KZU A;  4UM1 A;  5J5I A;  2XYT A;  2Y57 A;  2Y56 A;  4ZJS A;  3UU6 A;  4A98 A;  3T4M A;  5AFJ A;  5HEH A;  4FRR A;  4ZK1 A;  2W8F A;  4XK9 A;  5HEG A;  3ZKR A;  3EI0 A;  5CO5 A;  3TLU A;  3UU3 A;  4IRE A;  5J5H A;  3WTN A;  3LSV A;  3IGQ A;  3WTO A;  3ZDG A;  2XZ6 A;  5HEU A;  3P4W A;  4EZ1 A;  4ZR6 A;  4TWD A;  4UXU A;  3SQ6 A;  5LXB A;  2BG9 B;  4TNW A;  3RQU A;  4DBM A;  4ILB A;  2ZJU A; 
#chains in the Genus database with same CATH topology
 3P50 A;  4PIR A;  3GUA A;  5LG3 A;  4IL4 A;  5HCJ A;  3WTM A;  2XNT A;  2XYS A;  2BYQ A;  2BYS A;  3TLS A;  2WNJ A;  3PMZ A;  4LMK A;  4UM3 S;  2BG9 A;  2PGZ A;  3SIO A;  2BJ0 A;  2BYN A;  2WN9 A;  3JAD A;  3RQW A;  5AFM A;  4HFE A;  4AFT A;  2BR8 A;  4QH4 A;  3WTK A;  2X00 D;  4Z90 A;  1UV6 A;  4ZJT A;  2Y7Y A;  4ZZC A;  2YMD A;  2XNV A;  3WTL A;  3TLW A;  2BG9 E;  5J5G A;  2YKS A;  5J0Z A;  4QAB A;  5AFL A;  3EAM A;  4QH5 A;  5BP0 A;  5J5F A;  3ZDH A;  4Z91 A;  2XQA A;  3WIP A;  5CFB A;  3UQ7 A;  3U8M A;  5L47 A;  3UU5 A;  5AFM B;  3WTJ A;  4HFB A;  4TWH A;  5IUX A;  4HFI A;  4QH1 A;  5JME A;  3U8N A;  3RHW A;  2UZ6 A;  3JAE A;  5AIN A;  2Y54 A;  4TWF A;  4HFC A;  3U8K A;  4XHE A;  4COF A;  2C9T A;  5L4H A;  2VL0 A;  1I9B A;  1UW6 A;  4X5T A;  5HEO A;  2BR7 A;  4D01 A;  4LML A;  3JAF A;  4UM3 P;  2XQ5 A;  2XQ4 A;  2ZJV A;  4HFD A;  1UX2 A;  5BRX A;  3TLV A;  4AFG A;  3TLT A;  4UM3 A;  2Y58 A;  4ILA A;  2XZ5 A;  3U8L A;  4ZZB A;  2BG9 C;  5AFN A;  3C79 A;  3C84 A;  3UU8 A;  3WTH A;  5AFK A;  3SH1 A;  3U8J A;  2YN6 A;  3SQ9 A;  2XQ8 A;  2XQ6 A;  3PEO A;  4TNV A;  2XQ3 A;  3UUB A;  4AFH A;  2WNC A;  4QAC A;  5TVC A;  4UY2 A;  2XQ9 A;  4ZRU A;  3WTI A;  4F8H A;  2BYP A;  5L4E A;  4A97 A;  3RIF A;  4HQP A;  2QC1 B;  2XNU A;  2W8G A;  3EHZ A;  4ZK4 A;  2PH9 A;  5BW2 A;  3RIA A;  4BFQ A;  4QAA A;  3RI5 A;  5HCM A;  4NPP A;  2WZY A;  2XQ7 A;  5KE4 A;  5AFH A;  2BYR A;  4IL9 A;  4LMJ A;  3UU4 A;  4NZB A;  2YME A;  3UQ4 A;  4HFH A;  5SYO A;  2YOE A;  4ILC A;  4B5D A;  4ALX A;  4BQT A;  5HEJ A;  2X00 A;  2WNL A;  4WV9 A;  5FJV A;  5KZU A;  4UM1 A;  5J5I A;  2XYT A;  2Y57 A;  2Y56 A;  4ZJS A;  3UU6 A;  4A98 A;  3T4M A;  5AFJ A;  5HEH A;  4FRR A;  4ZK1 A;  2W8F A;  4XK9 A;  5HEG A;  3ZKR A;  3EI0 A;  5CO5 A;  3TLU A;  3UU3 A;  4IRE A;  5J5H A;  3WTN A;  3LSV A;  3IGQ A;  3WTO A;  3ZDG A;  2XZ6 A;  5HEU A;  3P4W A;  4EZ1 A;  4ZR6 A;  4TWD A;  4UXU A;  3SQ6 A;  5LXB A;  2BG9 B;  4TNW A;  3RQU A;  4DBM A;  4ILB A;  2ZJU A; 
#chains in the Genus database with same CATH homology
 3P50 A;  4PIR A;  3GUA A;  5LG3 A;  4IL4 A;  5HCJ A;  3WTM A;  2XNT A;  2XYS A;  2BYQ A;  2BYS A;  3TLS A;  2WNJ A;  3PMZ A;  4LMK A;  4UM3 S;  2BG9 A;  2PGZ A;  3SIO A;  2BJ0 A;  2BYN A;  2WN9 A;  3JAD A;  3RQW A;  5AFM A;  4HFE A;  4AFT A;  2BR8 A;  4QH4 A;  3WTK A;  2X00 D;  4Z90 A;  1UV6 A;  4ZJT A;  2Y7Y A;  4ZZC A;  2YMD A;  2XNV A;  3WTL A;  3TLW A;  2BG9 E;  5J5G A;  2YKS A;  5J0Z A;  4QAB A;  5AFL A;  3EAM A;  4QH5 A;  5BP0 A;  5J5F A;  3ZDH A;  4Z91 A;  2XQA A;  3WIP A;  5CFB A;  3UQ7 A;  3U8M A;  5L47 A;  3UU5 A;  5AFM B;  3WTJ A;  4HFB A;  4TWH A;  5IUX A;  4HFI A;  4QH1 A;  5JME A;  3U8N A;  3RHW A;  2UZ6 A;  3JAE A;  5AIN A;  2Y54 A;  4TWF A;  4HFC A;  3U8K A;  4XHE A;  4COF A;  2C9T A;  5L4H A;  2VL0 A;  1I9B A;  1UW6 A;  4X5T A;  5HEO A;  2BR7 A;  4D01 A;  4LML A;  3JAF A;  4UM3 P;  2XQ5 A;  2XQ4 A;  2ZJV A;  4HFD A;  1UX2 A;  5BRX A;  3TLV A;  4AFG A;  3TLT A;  4UM3 A;  2Y58 A;  4ILA A;  2XZ5 A;  3U8L A;  4ZZB A;  2BG9 C;  5AFN A;  3C79 A;  3C84 A;  3UU8 A;  3WTH A;  5AFK A;  3SH1 A;  3U8J A;  2YN6 A;  3SQ9 A;  2XQ8 A;  2XQ6 A;  3PEO A;  4TNV A;  2XQ3 A;  3UUB A;  4AFH A;  2WNC A;  4QAC A;  5TVC A;  4UY2 A;  2XQ9 A;  4ZRU A;  3WTI A;  4F8H A;  2BYP A;  5L4E A;  4A97 A;  3RIF A;  4HQP A;  2QC1 B;  2XNU A;  2W8G A;  3EHZ A;  4ZK4 A;  2PH9 A;  5BW2 A;  3RIA A;  4BFQ A;  4QAA A;  3RI5 A;  5HCM A;  4NPP A;  2WZY A;  2XQ7 A;  5KE4 A;  5AFH A;  2BYR A;  4IL9 A;  4LMJ A;  3UU4 A;  4NZB A;  2YME A;  3UQ4 A;  4HFH A;  5SYO A;  2YOE A;  4ILC A;  4B5D A;  4ALX A;  4BQT A;  5HEJ A;  2X00 A;  2WNL A;  4WV9 A;  5FJV A;  5KZU A;  4UM1 A;  5J5I A;  2XYT A;  2Y57 A;  2Y56 A;  4ZJS A;  3UU6 A;  4A98 A;  3T4M A;  5AFJ A;  5HEH A;  4FRR A;  4ZK1 A;  2W8F A;  4XK9 A;  5HEG A;  3ZKR A;  3EI0 A;  5CO5 A;  3TLU A;  3UU3 A;  4IRE A;  5J5H A;  3WTN A;  3LSV A;  3IGQ A;  3WTO A;  3ZDG A;  2XZ6 A;  5HEU A;  3P4W A;  4EZ1 A;  4ZR6 A;  4TWD A;  4UXU A;  3SQ6 A;  5LXB A;  2BG9 B;  4TNW A;  3RQU A;  4DBM A;  4ILB A;  2ZJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...