5AFMA

Alpha7-achbp in complex with lobeline and fragment 4
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
205
Chain Sequence
GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 205
sequence length 205
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afmA00
5AINA 4LMKA 2QC1B 4NPPA 5KZUA 5HEJA 2XQ7A 3GUAA 2BG9A 2XQ6A 4LMJA 4AFHA 1UV6A 4QAAA 4TWHA 5JMEA 4ZZCA 5CO5A 2YKSA 3U8MA 2YOEA 3ZDGA 5HEHA 5SYOA 4HFCA 4ZK1A 2BG9B 2Y58A 3JAFA 5HCJA 2XNVA 5AFMA 3U8JA 4LMLA 3LSVA 1UX2A 3UU8A 3PEOA 3WTNA 2BR7A 3WTHA 3U8NA 4AFGA 2BYPA 4ILBA 5IUXA 2Y56A 2ZJVA 5AFHA 2BG9C 5L47A 5AFMB 5BP0A 2BYNA 4UY2A 4D01A 3WTLA 4NZBA 4ALXA 2PH9A 2W8GA 3SIOA 2XQ8A 4HFBA 5AFLA 5LXBA 4COFA 2Y7YA 2XYSA 3TLSA 4QH1A 4WV9A 3WTIA 3C84A 4TNWA 4ZRUA 4F8HA 2ZJUA 2C9TA 4BFQA 4TWFA 2XQ3A 2XQ5A 5FJVA 3RHWA 5J0ZA 5L4EA 5LG3A 3P4WA 3P50A 4AFTA 4A98A 5J5IA 5J5GA 5BRXA 3JADA 3U8KA 3SQ6A 4XK9A 2XYTA 1I9BA 5BW2A 2BYQA 4HFDA 5HEGA 3RI5A 2WN9A 3UU4A 2WNLA 2VL0A 4ZJSA 3TLWA 2BR8A 5HCMA 2XZ6A 4HFHA 4UM3A 2WNCA 3RQWA 5KE4A 4HFIA 3ZDHA 4UXUA 2W8FA 3ZKRA 4QH4A 3UQ4A 4XHEA 5AFKA 3WTOA 3EAMA 4ZK4A 3TLVA 3U8LA 3UU3A 2X00A 5TVCA 3C79A 3SQ9A 2WNJA 4UM3P 4IREA 4UM1A 4A97A 4UM3S 4Z91A 3TLTA 3UU5A 3UUBA 3UQ7A 4EZ1A 4BQTA 2XQ9A 2XQ4A 3RIFA 3JAEA 2YN6A 5J5FA 4ILAA 5J5HA 2BYRA 2BYSA 3SH1A 5HEUA 4X5TA 5AFJA 3RIAA 3WTMA 3TLUA 2PGZA 2X00D 4ZR6A 3T4MA 3WIPA 2Y54A 2YMDA 2WZYA 1UW6A 4PIRA 3PMZA 4FRRA 3RQUA 5HEOA 3EI0A 4QACA 4TNVA 4ILCA 3WTKA 4TWDA 4IL4A 4B5DA 4HFEA 4Z90A 2Y57A 2XZ5A 4IL9A 3EHZA 2BG9E 2XNTA 5L4HA 4QABA 3UU6A 2YMEA 4DBMA 3IGQA 4ZJTA 2XNUA 5CFBA 5AFNA 4QH5A 2BJ0A 2UZ6A 4ZZBA 3WTJA 4HQPA 2XQAA
chains in the Genus database with same CATH superfamily
5AINA 4LMKA 2QC1B 4NPPA 5KZUA 5HEJA 2XQ7A 3GUAA 2BG9A 2XQ6A 4LMJA 4AFHA 1UV6A 4QAAA 4TWHA 5JMEA 4ZZCA 5CO5A 2YKSA 3U8MA 2YOEA 3ZDGA 5HEHA 5SYOA 4HFCA 4ZK1A 2BG9B 2Y58A 3JAFA 5HCJA 2XNVA 5AFMA 3U8JA 4LMLA 3LSVA 1UX2A 3UU8A 3PEOA 3WTNA 2BR7A 3WTHA 3U8NA 4AFGA 2BYPA 4ILBA 5IUXA 2Y56A 2ZJVA 5AFHA 2BG9C 5L47A 5AFMB 5BP0A 2BYNA 4UY2A 4D01A 3WTLA 4NZBA 4ALXA 2PH9A 2W8GA 3SIOA 2XQ8A 4HFBA 5AFLA 5LXBA 4COFA 2Y7YA 2XYSA 3TLSA 4QH1A 4WV9A 3WTIA 3C84A 4TNWA 4ZRUA 4F8HA 2ZJUA 2C9TA 4BFQA 4TWFA 2XQ3A 2XQ5A 5FJVA 3RHWA 5J0ZA 5L4EA 5LG3A 3P4WA 3P50A 4AFTA 4A98A 5J5IA 5J5GA 5BRXA 3JADA 3U8KA 3SQ6A 4XK9A 2XYTA 1I9BA 5BW2A 2BYQA 4HFDA 5HEGA 3RI5A 2WN9A 3UU4A 2WNLA 2VL0A 4ZJSA 3TLWA 2BR8A 5HCMA 2XZ6A 4HFHA 4UM3A 2WNCA 3RQWA 5KE4A 4HFIA 3ZDHA 4UXUA 2W8FA 3ZKRA 4QH4A 3UQ4A 4XHEA 5AFKA 3WTOA 3EAMA 4ZK4A 3TLVA 3U8LA 3UU3A 2X00A 5TVCA 3C79A 3SQ9A 2WNJA 4UM3P 4IREA 4UM1A 4A97A 4UM3S 4Z91A 3TLTA 3UU5A 3UUBA 3UQ7A 4EZ1A 4BQTA 2XQ9A 2XQ4A 3RIFA 3JAEA 2YN6A 5J5FA 4ILAA 5J5HA 2BYRA 2BYSA 3SH1A 5HEUA 4X5TA 5AFJA 3RIAA 3WTMA 3TLUA 2PGZA 2X00D 4ZR6A 3T4MA 3WIPA 2Y54A 2YMDA 2WZYA 1UW6A 4PIRA 3PMZA 4FRRA 3RQUA 5HEOA 3EI0A 4QACA 4TNVA 4ILCA 3WTKA 4TWDA 4IL4A 4B5DA 4HFEA 4Z90A 2Y57A 2XZ5A 4IL9A 3EHZA 2BG9E 2XNTA 5L4HA 4QABA 3UU6A 2YMEA 4DBMA 3IGQA 4ZJTA 2XNUA 5CFBA 5AFNA 4QH5A 2BJ0A 2UZ6A 4ZZBA 3WTJA 4HQPA 2XQAA
chains in the Genus database with same CATH topology
5AINA 4LMKA 2QC1B 4NPPA 5KZUA 5HEJA 2XQ7A 3GUAA 2BG9A 2XQ6A 4LMJA 4AFHA 1UV6A 4QAAA 4TWHA 5JMEA 4ZZCA 5CO5A 2YKSA 3U8MA 2YOEA 3ZDGA 5HEHA 5SYOA 4HFCA 4ZK1A 2BG9B 2Y58A 3JAFA 5HCJA 2XNVA 5AFMA 3U8JA 4LMLA 3LSVA 1UX2A 3UU8A 3PEOA 3WTNA 2BR7A 3WTHA 3U8NA 4AFGA 2BYPA 4ILBA 5IUXA 2Y56A 2ZJVA 5AFHA 2BG9C 5L47A 5AFMB 5BP0A 2BYNA 4UY2A 4D01A 3WTLA 4NZBA 4ALXA 2PH9A 2W8GA 3SIOA 2XQ8A 4HFBA 5AFLA 5LXBA 4COFA 2Y7YA 2XYSA 3TLSA 4QH1A 4WV9A 3WTIA 3C84A 4TNWA 4ZRUA 4F8HA 2ZJUA 2C9TA 4BFQA 4TWFA 2XQ3A 2XQ5A 5FJVA 3RHWA 5J0ZA 5L4EA 5LG3A 3P4WA 3P50A 4AFTA 4A98A 5J5IA 5J5GA 5BRXA 3JADA 3U8KA 3SQ6A 4XK9A 2XYTA 1I9BA 5BW2A 2BYQA 4HFDA 5HEGA 3RI5A 2WN9A 3UU4A 2WNLA 2VL0A 4ZJSA 3TLWA 2BR8A 5HCMA 2XZ6A 4HFHA 4UM3A 2WNCA 3RQWA 5KE4A 4HFIA 3ZDHA 4UXUA 2W8FA 3ZKRA 4QH4A 3UQ4A 4XHEA 5AFKA 3WTOA 3EAMA 4ZK4A 3TLVA 3U8LA 3UU3A 2X00A 5TVCA 3C79A 3SQ9A 2WNJA 4UM3P 4IREA 4UM1A 4A97A 4UM3S 4Z91A 3TLTA 3UU5A 3UUBA 3UQ7A 4EZ1A 4BQTA 2XQ9A 2XQ4A 3RIFA 3JAEA 2YN6A 5J5FA 4ILAA 5J5HA 2BYRA 2BYSA 3SH1A 5HEUA 4X5TA 5AFJA 3RIAA 3WTMA 3TLUA 2PGZA 2X00D 4ZR6A 3T4MA 3WIPA 2Y54A 2YMDA 2WZYA 1UW6A 4PIRA 3PMZA 4FRRA 3RQUA 5HEOA 3EI0A 4QACA 4TNVA 4ILCA 3WTKA 4TWDA 4IL4A 4B5DA 4HFEA 4Z90A 2Y57A 2XZ5A 4IL9A 3EHZA 2BG9E 2XNTA 5L4HA 4QABA 3UU6A 2YMEA 4DBMA 3IGQA 4ZJTA 2XNUA 5CFBA 5AFNA 4QH5A 2BJ0A 2UZ6A 4ZZBA 3WTJA 4HQPA 2XQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIN A;  4LMK A;  2QC1 B;  4NPP A;  5KZU A;  5HEJ A;  2XQ7 A;  3GUA A;  2BG9 A;  2XQ6 A;  4LMJ A;  4AFH A;  1UV6 A;  4QAA A;  4TWH A;  5JME A;  4ZZC A;  5CO5 A;  2YKS A;  3U8M A;  2YOE A;  3ZDG A;  5HEH A;  5SYO A;  4HFC A;  4ZK1 A;  2BG9 B;  2Y58 A;  3JAF A;  5HCJ A;  2XNV A;  5AFM A;  3U8J A;  4LML A;  3LSV A;  1UX2 A;  3UU8 A;  3PEO A;  3WTN A;  2BR7 A;  3WTH A;  3U8N A;  4AFG A;  2BYP A;  4ILB A;  5IUX A;  2Y56 A;  2ZJV A;  5AFH A;  2BG9 C;  5L47 A;  5AFM B;  5BP0 A;  2BYN A;  4UY2 A;  4D01 A;  3WTL A;  4NZB A;  4ALX A;  2PH9 A;  2W8G A;  3SIO A;  2XQ8 A;  4HFB A;  5AFL A;  5LXB A;  4COF A;  2Y7Y A;  2XYS A;  3TLS A;  4QH1 A;  4WV9 A;  3WTI A;  3C84 A;  4TNW A;  4ZRU A;  4F8H A;  2ZJU A;  2C9T A;  4BFQ A;  4TWF A;  2XQ3 A;  2XQ5 A;  5FJV A;  3RHW A;  5J0Z A;  5L4E A;  5LG3 A;  3P4W A;  3P50 A;  4AFT A;  4A98 A;  5J5I A;  5J5G A;  5BRX A;  3JAD A;  3U8K A;  3SQ6 A;  4XK9 A;  2XYT A;  1I9B A;  5BW2 A;  2BYQ A;  4HFD A;  5HEG A;  3RI5 A;  2WN9 A;  3UU4 A;  2WNL A;  2VL0 A;  4ZJS A;  3TLW A;  2BR8 A;  5HCM A;  2XZ6 A;  4HFH A;  4UM3 A;  2WNC A;  3RQW A;  5KE4 A;  4HFI A;  3ZDH A;  4UXU A;  2W8F A;  3ZKR A;  4QH4 A;  3UQ4 A;  4XHE A;  5AFK A;  3WTO A;  3EAM A;  4ZK4 A;  3TLV A;  3U8L A;  3UU3 A;  2X00 A;  5TVC A;  3C79 A;  3SQ9 A;  2WNJ A;  4UM3 P;  4IRE A;  4UM1 A;  4A97 A;  4UM3 S;  4Z91 A;  3TLT A;  3UU5 A;  3UUB A;  3UQ7 A;  4EZ1 A;  4BQT A;  2XQ9 A;  2XQ4 A;  3RIF A;  3JAE A;  2YN6 A;  5J5F A;  4ILA A;  5J5H A;  2BYR A;  2BYS A;  3SH1 A;  5HEU A;  4X5T A;  5AFJ A;  3RIA A;  3WTM A;  3TLU A;  2PGZ A;  2X00 D;  4ZR6 A;  3T4M A;  3WIP A;  2Y54 A;  2YMD A;  2WZY A;  1UW6 A;  4PIR A;  3PMZ A;  4FRR A;  3RQU A;  5HEO A;  3EI0 A;  4QAC A;  4TNV A;  4ILC A;  3WTK A;  4TWD A;  4IL4 A;  4B5D A;  4HFE A;  4Z90 A;  2Y57 A;  2XZ5 A;  4IL9 A;  3EHZ A;  2BG9 E;  2XNT A;  5L4H A;  4QAB A;  3UU6 A;  2YME A;  4DBM A;  3IGQ A;  4ZJT A;  2XNU A;  5CFB A;  5AFN A;  4QH5 A;  2BJ0 A;  2UZ6 A;  4ZZB A;  3WTJ A;  4HQP A;  2XQA A; 
#chains in the Genus database with same CATH topology
 5AIN A;  4LMK A;  2QC1 B;  4NPP A;  5KZU A;  5HEJ A;  2XQ7 A;  3GUA A;  2BG9 A;  2XQ6 A;  4LMJ A;  4AFH A;  1UV6 A;  4QAA A;  4TWH A;  5JME A;  4ZZC A;  5CO5 A;  2YKS A;  3U8M A;  2YOE A;  3ZDG A;  5HEH A;  5SYO A;  4HFC A;  4ZK1 A;  2BG9 B;  2Y58 A;  3JAF A;  5HCJ A;  2XNV A;  5AFM A;  3U8J A;  4LML A;  3LSV A;  1UX2 A;  3UU8 A;  3PEO A;  3WTN A;  2BR7 A;  3WTH A;  3U8N A;  4AFG A;  2BYP A;  4ILB A;  5IUX A;  2Y56 A;  2ZJV A;  5AFH A;  2BG9 C;  5L47 A;  5AFM B;  5BP0 A;  2BYN A;  4UY2 A;  4D01 A;  3WTL A;  4NZB A;  4ALX A;  2PH9 A;  2W8G A;  3SIO A;  2XQ8 A;  4HFB A;  5AFL A;  5LXB A;  4COF A;  2Y7Y A;  2XYS A;  3TLS A;  4QH1 A;  4WV9 A;  3WTI A;  3C84 A;  4TNW A;  4ZRU A;  4F8H A;  2ZJU A;  2C9T A;  4BFQ A;  4TWF A;  2XQ3 A;  2XQ5 A;  5FJV A;  3RHW A;  5J0Z A;  5L4E A;  5LG3 A;  3P4W A;  3P50 A;  4AFT A;  4A98 A;  5J5I A;  5J5G A;  5BRX A;  3JAD A;  3U8K A;  3SQ6 A;  4XK9 A;  2XYT A;  1I9B A;  5BW2 A;  2BYQ A;  4HFD A;  5HEG A;  3RI5 A;  2WN9 A;  3UU4 A;  2WNL A;  2VL0 A;  4ZJS A;  3TLW A;  2BR8 A;  5HCM A;  2XZ6 A;  4HFH A;  4UM3 A;  2WNC A;  3RQW A;  5KE4 A;  4HFI A;  3ZDH A;  4UXU A;  2W8F A;  3ZKR A;  4QH4 A;  3UQ4 A;  4XHE A;  5AFK A;  3WTO A;  3EAM A;  4ZK4 A;  3TLV A;  3U8L A;  3UU3 A;  2X00 A;  5TVC A;  3C79 A;  3SQ9 A;  2WNJ A;  4UM3 P;  4IRE A;  4UM1 A;  4A97 A;  4UM3 S;  4Z91 A;  3TLT A;  3UU5 A;  3UUB A;  3UQ7 A;  4EZ1 A;  4BQT A;  2XQ9 A;  2XQ4 A;  3RIF A;  3JAE A;  2YN6 A;  5J5F A;  4ILA A;  5J5H A;  2BYR A;  2BYS A;  3SH1 A;  5HEU A;  4X5T A;  5AFJ A;  3RIA A;  3WTM A;  3TLU A;  2PGZ A;  2X00 D;  4ZR6 A;  3T4M A;  3WIP A;  2Y54 A;  2YMD A;  2WZY A;  1UW6 A;  4PIR A;  3PMZ A;  4FRR A;  3RQU A;  5HEO A;  3EI0 A;  4QAC A;  4TNV A;  4ILC A;  3WTK A;  4TWD A;  4IL4 A;  4B5D A;  4HFE A;  4Z90 A;  2Y57 A;  2XZ5 A;  4IL9 A;  3EHZ A;  2BG9 E;  2XNT A;  5L4H A;  4QAB A;  3UU6 A;  2YME A;  4DBM A;  3IGQ A;  4ZJT A;  2XNU A;  5CFB A;  5AFN A;  4QH5 A;  2BJ0 A;  2UZ6 A;  4ZZB A;  3WTJ A;  4HQP A;  2XQA A; 
#chains in the Genus database with same CATH homology
 5AIN A;  4LMK A;  2QC1 B;  4NPP A;  5KZU A;  5HEJ A;  2XQ7 A;  3GUA A;  2BG9 A;  2XQ6 A;  4LMJ A;  4AFH A;  1UV6 A;  4QAA A;  4TWH A;  5JME A;  4ZZC A;  5CO5 A;  2YKS A;  3U8M A;  2YOE A;  3ZDG A;  5HEH A;  5SYO A;  4HFC A;  4ZK1 A;  2BG9 B;  2Y58 A;  3JAF A;  5HCJ A;  2XNV A;  5AFM A;  3U8J A;  4LML A;  3LSV A;  1UX2 A;  3UU8 A;  3PEO A;  3WTN A;  2BR7 A;  3WTH A;  3U8N A;  4AFG A;  2BYP A;  4ILB A;  5IUX A;  2Y56 A;  2ZJV A;  5AFH A;  2BG9 C;  5L47 A;  5AFM B;  5BP0 A;  2BYN A;  4UY2 A;  4D01 A;  3WTL A;  4NZB A;  4ALX A;  2PH9 A;  2W8G A;  3SIO A;  2XQ8 A;  4HFB A;  5AFL A;  5LXB A;  4COF A;  2Y7Y A;  2XYS A;  3TLS A;  4QH1 A;  4WV9 A;  3WTI A;  3C84 A;  4TNW A;  4ZRU A;  4F8H A;  2ZJU A;  2C9T A;  4BFQ A;  4TWF A;  2XQ3 A;  2XQ5 A;  5FJV A;  3RHW A;  5J0Z A;  5L4E A;  5LG3 A;  3P4W A;  3P50 A;  4AFT A;  4A98 A;  5J5I A;  5J5G A;  5BRX A;  3JAD A;  3U8K A;  3SQ6 A;  4XK9 A;  2XYT A;  1I9B A;  5BW2 A;  2BYQ A;  4HFD A;  5HEG A;  3RI5 A;  2WN9 A;  3UU4 A;  2WNL A;  2VL0 A;  4ZJS A;  3TLW A;  2BR8 A;  5HCM A;  2XZ6 A;  4HFH A;  4UM3 A;  2WNC A;  3RQW A;  5KE4 A;  4HFI A;  3ZDH A;  4UXU A;  2W8F A;  3ZKR A;  4QH4 A;  3UQ4 A;  4XHE A;  5AFK A;  3WTO A;  3EAM A;  4ZK4 A;  3TLV A;  3U8L A;  3UU3 A;  2X00 A;  5TVC A;  3C79 A;  3SQ9 A;  2WNJ A;  4UM3 P;  4IRE A;  4UM1 A;  4A97 A;  4UM3 S;  4Z91 A;  3TLT A;  3UU5 A;  3UUB A;  3UQ7 A;  4EZ1 A;  4BQT A;  2XQ9 A;  2XQ4 A;  3RIF A;  3JAE A;  2YN6 A;  5J5F A;  4ILA A;  5J5H A;  2BYR A;  2BYS A;  3SH1 A;  5HEU A;  4X5T A;  5AFJ A;  3RIA A;  3WTM A;  3TLU A;  2PGZ A;  2X00 D;  4ZR6 A;  3T4M A;  3WIP A;  2Y54 A;  2YMD A;  2WZY A;  1UW6 A;  4PIR A;  3PMZ A;  4FRR A;  3RQU A;  5HEO A;  3EI0 A;  4QAC A;  4TNV A;  4ILC A;  3WTK A;  4TWD A;  4IL4 A;  4B5D A;  4HFE A;  4Z90 A;  2Y57 A;  2XZ5 A;  4IL9 A;  3EHZ A;  2BG9 E;  2XNT A;  5L4H A;  4QAB A;  3UU6 A;  2YME A;  4DBM A;  3IGQ A;  4ZJT A;  2XNU A;  5CFB A;  5AFN A;  4QH5 A;  2BJ0 A;  2UZ6 A;  4ZZB A;  3WTJ A;  4HQP A;  2XQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...