5AFMA

Alpha7-achbp in complex with lobeline and fragment 4
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
205
Chain Sequence
GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 43
structure length 205
sequence length 205
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afmA00
3U8LA 3P4WA 2XQ7A 5FJVA 2YMDA 3WTNA 3UU8A 2WNJA 3JAFA 2YMEA 2Y57A 5HEJA 1UX2A 5J5IA 2PH9A 4IREA 3P50A 3UQ4A 4ZZBA 3JADA 2XNVA 2XQAA 4ZZCA 4QH5A 4HFBA 4WV9A 2Y7YA 2Y58A 3JAEA 4X5TA 2PGZA 4TWFA 4ZK4A 3RI5A 4NPPA 3GUAA 3ZKRA 2XQ3A 2YKSA 5AFKA 2XYSA 5J5GA 3RQWA 5L4EA 5HEOA 2X00D 3PEOA 4FRRA 3WIPA 2BYNA 2W8FA 4UM3P 5BP0A 4COFA 3WTJA 4ZK1A 3ZDHA 4QH1A 5AFLA 4ILAA 5L4HA 5TVCA 4HFHA 2BG9A 4IL4A 2BYQA 5AFNA 4QABA 5AFJA 3RIAA 4UM3S 5CFBA 1I9BA 3T4MA 3PMZA 4ZJTA 2WZYA 4HFEA 2XQ6A 3RHWA 3RQUA 4B5DA 4HFCA 5AFHA 4IL9A 4BFQA 3TLUA 3WTLA 3WTOA 4D01A 4ALXA 4A97A 3TLSA 2UZ6A 1UV6A 2XNUA 4TNWA 4HFIA 4TWDA 3WTKA 5AINA 4TNVA 3LSVA 5KZUA 5LXBA 2W8GA 3UQ7A 2BG9C 2Y54A 3TLVA 5HCMA 3UU4A 2C9TA 4UXUA 2BR8A 2BJ0A 4ZR6A 3U8JA 2ZJUA 3EI0A 4NZBA 5HEHA 4UM1A 3UUBA 4UM3A 5SYOA 5J0ZA 5L47A 3TLWA 3EHZA 4LMJA 2BYSA 5JMEA 3WTIA 4AFHA 2WNCA 2BYRA 4F8HA 3C84A 2VL0A 4Z91A 3U8MA 4ILBA 4QAAA 3SIOA 2XQ9A 5BW2A 5J5FA 4LMKA 2BYPA 4XHEA 5HEGA 3ZDGA 4HQPA 4TWHA 3UU3A 5CO5A 2X00A 2YOEA 4AFGA 2XNTA 4UY2A 3IGQA 5AFMB 3SH1A 4ILCA 2XQ5A 2ZJVA 4QACA 4Z90A 4PIRA 2BR7A 3TLTA 3UU5A 3WTHA 3EAMA 3SQ9A 4XK9A 2XZ6A 2WNLA 2YN6A 2Y56A 3WTMA 2BG9E 4ZJSA 3U8KA 5HEUA 5J5HA 2BG9B 2XQ8A 2XQ4A 5HCJA 5LG3A 4AFTA 4A98A 2QC1B 4LMLA 3SQ6A 2XYTA 5IUXA 5AFMA 3U8NA 3UU6A 4ZRUA 4DBMA 5BRXA 4QH4A 3RIFA 1UW6A 2WN9A 5KE4A 4EZ1A 2XZ5A 3C79A 4BQTA 4HFDA
chains in the Genus database with same CATH superfamily
3U8LA 3P4WA 2XQ7A 5FJVA 2YMDA 3WTNA 3UU8A 2WNJA 3JAFA 2YMEA 2Y57A 5HEJA 1UX2A 5J5IA 2PH9A 4IREA 3P50A 3UQ4A 4ZZBA 3JADA 2XNVA 2XQAA 4ZZCA 4QH5A 4HFBA 4WV9A 2Y7YA 2Y58A 3JAEA 4X5TA 2PGZA 4TWFA 4ZK4A 3RI5A 4NPPA 3GUAA 3ZKRA 2XQ3A 2YKSA 5AFKA 2XYSA 5J5GA 3RQWA 5L4EA 5HEOA 2X00D 3PEOA 4FRRA 3WIPA 2BYNA 2W8FA 4UM3P 5BP0A 4COFA 3WTJA 4ZK1A 3ZDHA 4QH1A 5AFLA 4ILAA 5L4HA 5TVCA 4HFHA 2BG9A 4IL4A 2BYQA 5AFNA 4QABA 5AFJA 3RIAA 4UM3S 5CFBA 1I9BA 3T4MA 3PMZA 4ZJTA 2WZYA 4HFEA 2XQ6A 3RHWA 3RQUA 4B5DA 4HFCA 5AFHA 4IL9A 4BFQA 3TLUA 3WTLA 3WTOA 4D01A 4ALXA 4A97A 3TLSA 2UZ6A 1UV6A 2XNUA 4TNWA 4HFIA 4TWDA 3WTKA 5AINA 4TNVA 3LSVA 5KZUA 5LXBA 2W8GA 3UQ7A 2BG9C 2Y54A 3TLVA 5HCMA 3UU4A 2C9TA 4UXUA 2BR8A 2BJ0A 4ZR6A 3U8JA 2ZJUA 3EI0A 4NZBA 5HEHA 4UM1A 3UUBA 4UM3A 5SYOA 5J0ZA 5L47A 3TLWA 3EHZA 4LMJA 2BYSA 5JMEA 3WTIA 4AFHA 2WNCA 2BYRA 4F8HA 3C84A 2VL0A 4Z91A 3U8MA 4ILBA 4QAAA 3SIOA 2XQ9A 5BW2A 5J5FA 4LMKA 2BYPA 4XHEA 5HEGA 3ZDGA 4HQPA 4TWHA 3UU3A 5CO5A 2X00A 2YOEA 4AFGA 2XNTA 4UY2A 3IGQA 5AFMB 3SH1A 4ILCA 2XQ5A 2ZJVA 4QACA 4Z90A 4PIRA 2BR7A 3TLTA 3UU5A 3WTHA 3EAMA 3SQ9A 4XK9A 2XZ6A 2WNLA 2YN6A 2Y56A 3WTMA 2BG9E 4ZJSA 3U8KA 5HEUA 5J5HA 2BG9B 2XQ8A 2XQ4A 5HCJA 5LG3A 4AFTA 4A98A 2QC1B 4LMLA 3SQ6A 2XYTA 5IUXA 5AFMA 3U8NA 3UU6A 4ZRUA 4DBMA 5BRXA 4QH4A 3RIFA 1UW6A 2WN9A 5KE4A 4EZ1A 2XZ5A 3C79A 4BQTA 4HFDA
chains in the Genus database with same CATH topology
3U8LA 3P4WA 2XQ7A 5FJVA 2YMDA 3WTNA 3UU8A 2WNJA 3JAFA 2YMEA 2Y57A 5HEJA 1UX2A 5J5IA 2PH9A 4IREA 3P50A 3UQ4A 4ZZBA 3JADA 2XNVA 2XQAA 4ZZCA 4QH5A 4HFBA 4WV9A 2Y7YA 2Y58A 3JAEA 4X5TA 2PGZA 4TWFA 4ZK4A 3RI5A 4NPPA 3GUAA 3ZKRA 2XQ3A 2YKSA 5AFKA 2XYSA 5J5GA 3RQWA 5L4EA 5HEOA 2X00D 3PEOA 4FRRA 3WIPA 2BYNA 2W8FA 4UM3P 5BP0A 4COFA 3WTJA 4ZK1A 3ZDHA 4QH1A 5AFLA 4ILAA 5L4HA 5TVCA 4HFHA 2BG9A 4IL4A 2BYQA 5AFNA 4QABA 5AFJA 3RIAA 4UM3S 5CFBA 1I9BA 3T4MA 3PMZA 4ZJTA 2WZYA 4HFEA 2XQ6A 3RHWA 3RQUA 4B5DA 4HFCA 5AFHA 4IL9A 4BFQA 3TLUA 3WTLA 3WTOA 4D01A 4ALXA 4A97A 3TLSA 2UZ6A 1UV6A 2XNUA 4TNWA 4HFIA 4TWDA 3WTKA 5AINA 4TNVA 3LSVA 5KZUA 5LXBA 2W8GA 3UQ7A 2BG9C 2Y54A 3TLVA 5HCMA 3UU4A 2C9TA 4UXUA 2BR8A 2BJ0A 4ZR6A 3U8JA 2ZJUA 3EI0A 4NZBA 5HEHA 4UM1A 3UUBA 4UM3A 5SYOA 5J0ZA 5L47A 3TLWA 3EHZA 4LMJA 2BYSA 5JMEA 3WTIA 4AFHA 2WNCA 2BYRA 4F8HA 3C84A 2VL0A 4Z91A 3U8MA 4ILBA 4QAAA 3SIOA 2XQ9A 5BW2A 5J5FA 4LMKA 2BYPA 4XHEA 5HEGA 3ZDGA 4HQPA 4TWHA 3UU3A 5CO5A 2X00A 2YOEA 4AFGA 2XNTA 4UY2A 3IGQA 5AFMB 3SH1A 4ILCA 2XQ5A 2ZJVA 4QACA 4Z90A 4PIRA 2BR7A 3TLTA 3UU5A 3WTHA 3EAMA 3SQ9A 4XK9A 2XZ6A 2WNLA 2YN6A 2Y56A 3WTMA 2BG9E 4ZJSA 3U8KA 5HEUA 5J5HA 2BG9B 2XQ8A 2XQ4A 5HCJA 5LG3A 4AFTA 4A98A 2QC1B 4LMLA 3SQ6A 2XYTA 5IUXA 5AFMA 3U8NA 3UU6A 4ZRUA 4DBMA 5BRXA 4QH4A 3RIFA 1UW6A 2WN9A 5KE4A 4EZ1A 2XZ5A 3C79A 4BQTA 4HFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8L A;  3P4W A;  2XQ7 A;  5FJV A;  2YMD A;  3WTN A;  3UU8 A;  2WNJ A;  3JAF A;  2YME A;  2Y57 A;  5HEJ A;  1UX2 A;  5J5I A;  2PH9 A;  4IRE A;  3P50 A;  3UQ4 A;  4ZZB A;  3JAD A;  2XNV A;  2XQA A;  4ZZC A;  4QH5 A;  4HFB A;  4WV9 A;  2Y7Y A;  2Y58 A;  3JAE A;  4X5T A;  2PGZ A;  4TWF A;  4ZK4 A;  3RI5 A;  4NPP A;  3GUA A;  3ZKR A;  2XQ3 A;  2YKS A;  5AFK A;  2XYS A;  5J5G A;  3RQW A;  5L4E A;  5HEO A;  2X00 D;  3PEO A;  4FRR A;  3WIP A;  2BYN A;  2W8F A;  4UM3 P;  5BP0 A;  4COF A;  3WTJ A;  4ZK1 A;  3ZDH A;  4QH1 A;  5AFL A;  4ILA A;  5L4H A;  5TVC A;  4HFH A;  2BG9 A;  4IL4 A;  2BYQ A;  5AFN A;  4QAB A;  5AFJ A;  3RIA A;  4UM3 S;  5CFB A;  1I9B A;  3T4M A;  3PMZ A;  4ZJT A;  2WZY A;  4HFE A;  2XQ6 A;  3RHW A;  3RQU A;  4B5D A;  4HFC A;  5AFH A;  4IL9 A;  4BFQ A;  3TLU A;  3WTL A;  3WTO A;  4D01 A;  4ALX A;  4A97 A;  3TLS A;  2UZ6 A;  1UV6 A;  2XNU A;  4TNW A;  4HFI A;  4TWD A;  3WTK A;  5AIN A;  4TNV A;  3LSV A;  5KZU A;  5LXB A;  2W8G A;  3UQ7 A;  2BG9 C;  2Y54 A;  3TLV A;  5HCM A;  3UU4 A;  2C9T A;  4UXU A;  2BR8 A;  2BJ0 A;  4ZR6 A;  3U8J A;  2ZJU A;  3EI0 A;  4NZB A;  5HEH A;  4UM1 A;  3UUB A;  4UM3 A;  5SYO A;  5J0Z A;  5L47 A;  3TLW A;  3EHZ A;  4LMJ A;  2BYS A;  5JME A;  3WTI A;  4AFH A;  2WNC A;  2BYR A;  4F8H A;  3C84 A;  2VL0 A;  4Z91 A;  3U8M A;  4ILB A;  4QAA A;  3SIO A;  2XQ9 A;  5BW2 A;  5J5F A;  4LMK A;  2BYP A;  4XHE A;  5HEG A;  3ZDG A;  4HQP A;  4TWH A;  3UU3 A;  5CO5 A;  2X00 A;  2YOE A;  4AFG A;  2XNT A;  4UY2 A;  3IGQ A;  5AFM B;  3SH1 A;  4ILC A;  2XQ5 A;  2ZJV A;  4QAC A;  4Z90 A;  4PIR A;  2BR7 A;  3TLT A;  3UU5 A;  3WTH A;  3EAM A;  3SQ9 A;  4XK9 A;  2XZ6 A;  2WNL A;  2YN6 A;  2Y56 A;  3WTM A;  2BG9 E;  4ZJS A;  3U8K A;  5HEU A;  5J5H A;  2BG9 B;  2XQ8 A;  2XQ4 A;  5HCJ A;  5LG3 A;  4AFT A;  4A98 A;  2QC1 B;  4LML A;  3SQ6 A;  2XYT A;  5IUX A;  5AFM A;  3U8N A;  3UU6 A;  4ZRU A;  4DBM A;  5BRX A;  4QH4 A;  3RIF A;  1UW6 A;  2WN9 A;  5KE4 A;  4EZ1 A;  2XZ5 A;  3C79 A;  4BQT A;  4HFD A; 
#chains in the Genus database with same CATH topology
 3U8L A;  3P4W A;  2XQ7 A;  5FJV A;  2YMD A;  3WTN A;  3UU8 A;  2WNJ A;  3JAF A;  2YME A;  2Y57 A;  5HEJ A;  1UX2 A;  5J5I A;  2PH9 A;  4IRE A;  3P50 A;  3UQ4 A;  4ZZB A;  3JAD A;  2XNV A;  2XQA A;  4ZZC A;  4QH5 A;  4HFB A;  4WV9 A;  2Y7Y A;  2Y58 A;  3JAE A;  4X5T A;  2PGZ A;  4TWF A;  4ZK4 A;  3RI5 A;  4NPP A;  3GUA A;  3ZKR A;  2XQ3 A;  2YKS A;  5AFK A;  2XYS A;  5J5G A;  3RQW A;  5L4E A;  5HEO A;  2X00 D;  3PEO A;  4FRR A;  3WIP A;  2BYN A;  2W8F A;  4UM3 P;  5BP0 A;  4COF A;  3WTJ A;  4ZK1 A;  3ZDH A;  4QH1 A;  5AFL A;  4ILA A;  5L4H A;  5TVC A;  4HFH A;  2BG9 A;  4IL4 A;  2BYQ A;  5AFN A;  4QAB A;  5AFJ A;  3RIA A;  4UM3 S;  5CFB A;  1I9B A;  3T4M A;  3PMZ A;  4ZJT A;  2WZY A;  4HFE A;  2XQ6 A;  3RHW A;  3RQU A;  4B5D A;  4HFC A;  5AFH A;  4IL9 A;  4BFQ A;  3TLU A;  3WTL A;  3WTO A;  4D01 A;  4ALX A;  4A97 A;  3TLS A;  2UZ6 A;  1UV6 A;  2XNU A;  4TNW A;  4HFI A;  4TWD A;  3WTK A;  5AIN A;  4TNV A;  3LSV A;  5KZU A;  5LXB A;  2W8G A;  3UQ7 A;  2BG9 C;  2Y54 A;  3TLV A;  5HCM A;  3UU4 A;  2C9T A;  4UXU A;  2BR8 A;  2BJ0 A;  4ZR6 A;  3U8J A;  2ZJU A;  3EI0 A;  4NZB A;  5HEH A;  4UM1 A;  3UUB A;  4UM3 A;  5SYO A;  5J0Z A;  5L47 A;  3TLW A;  3EHZ A;  4LMJ A;  2BYS A;  5JME A;  3WTI A;  4AFH A;  2WNC A;  2BYR A;  4F8H A;  3C84 A;  2VL0 A;  4Z91 A;  3U8M A;  4ILB A;  4QAA A;  3SIO A;  2XQ9 A;  5BW2 A;  5J5F A;  4LMK A;  2BYP A;  4XHE A;  5HEG A;  3ZDG A;  4HQP A;  4TWH A;  3UU3 A;  5CO5 A;  2X00 A;  2YOE A;  4AFG A;  2XNT A;  4UY2 A;  3IGQ A;  5AFM B;  3SH1 A;  4ILC A;  2XQ5 A;  2ZJV A;  4QAC A;  4Z90 A;  4PIR A;  2BR7 A;  3TLT A;  3UU5 A;  3WTH A;  3EAM A;  3SQ9 A;  4XK9 A;  2XZ6 A;  2WNL A;  2YN6 A;  2Y56 A;  3WTM A;  2BG9 E;  4ZJS A;  3U8K A;  5HEU A;  5J5H A;  2BG9 B;  2XQ8 A;  2XQ4 A;  5HCJ A;  5LG3 A;  4AFT A;  4A98 A;  2QC1 B;  4LML A;  3SQ6 A;  2XYT A;  5IUX A;  5AFM A;  3U8N A;  3UU6 A;  4ZRU A;  4DBM A;  5BRX A;  4QH4 A;  3RIF A;  1UW6 A;  2WN9 A;  5KE4 A;  4EZ1 A;  2XZ5 A;  3C79 A;  4BQT A;  4HFD A; 
#chains in the Genus database with same CATH homology
 3U8L A;  3P4W A;  2XQ7 A;  5FJV A;  2YMD A;  3WTN A;  3UU8 A;  2WNJ A;  3JAF A;  2YME A;  2Y57 A;  5HEJ A;  1UX2 A;  5J5I A;  2PH9 A;  4IRE A;  3P50 A;  3UQ4 A;  4ZZB A;  3JAD A;  2XNV A;  2XQA A;  4ZZC A;  4QH5 A;  4HFB A;  4WV9 A;  2Y7Y A;  2Y58 A;  3JAE A;  4X5T A;  2PGZ A;  4TWF A;  4ZK4 A;  3RI5 A;  4NPP A;  3GUA A;  3ZKR A;  2XQ3 A;  2YKS A;  5AFK A;  2XYS A;  5J5G A;  3RQW A;  5L4E A;  5HEO A;  2X00 D;  3PEO A;  4FRR A;  3WIP A;  2BYN A;  2W8F A;  4UM3 P;  5BP0 A;  4COF A;  3WTJ A;  4ZK1 A;  3ZDH A;  4QH1 A;  5AFL A;  4ILA A;  5L4H A;  5TVC A;  4HFH A;  2BG9 A;  4IL4 A;  2BYQ A;  5AFN A;  4QAB A;  5AFJ A;  3RIA A;  4UM3 S;  5CFB A;  1I9B A;  3T4M A;  3PMZ A;  4ZJT A;  2WZY A;  4HFE A;  2XQ6 A;  3RHW A;  3RQU A;  4B5D A;  4HFC A;  5AFH A;  4IL9 A;  4BFQ A;  3TLU A;  3WTL A;  3WTO A;  4D01 A;  4ALX A;  4A97 A;  3TLS A;  2UZ6 A;  1UV6 A;  2XNU A;  4TNW A;  4HFI A;  4TWD A;  3WTK A;  5AIN A;  4TNV A;  3LSV A;  5KZU A;  5LXB A;  2W8G A;  3UQ7 A;  2BG9 C;  2Y54 A;  3TLV A;  5HCM A;  3UU4 A;  2C9T A;  4UXU A;  2BR8 A;  2BJ0 A;  4ZR6 A;  3U8J A;  2ZJU A;  3EI0 A;  4NZB A;  5HEH A;  4UM1 A;  3UUB A;  4UM3 A;  5SYO A;  5J0Z A;  5L47 A;  3TLW A;  3EHZ A;  4LMJ A;  2BYS A;  5JME A;  3WTI A;  4AFH A;  2WNC A;  2BYR A;  4F8H A;  3C84 A;  2VL0 A;  4Z91 A;  3U8M A;  4ILB A;  4QAA A;  3SIO A;  2XQ9 A;  5BW2 A;  5J5F A;  4LMK A;  2BYP A;  4XHE A;  5HEG A;  3ZDG A;  4HQP A;  4TWH A;  3UU3 A;  5CO5 A;  2X00 A;  2YOE A;  4AFG A;  2XNT A;  4UY2 A;  3IGQ A;  5AFM B;  3SH1 A;  4ILC A;  2XQ5 A;  2ZJV A;  4QAC A;  4Z90 A;  4PIR A;  2BR7 A;  3TLT A;  3UU5 A;  3WTH A;  3EAM A;  3SQ9 A;  4XK9 A;  2XZ6 A;  2WNL A;  2YN6 A;  2Y56 A;  3WTM A;  2BG9 E;  4ZJS A;  3U8K A;  5HEU A;  5J5H A;  2BG9 B;  2XQ8 A;  2XQ4 A;  5HCJ A;  5LG3 A;  4AFT A;  4A98 A;  2QC1 B;  4LML A;  3SQ6 A;  2XYT A;  5IUX A;  5AFM A;  3U8N A;  3UU6 A;  4ZRU A;  4DBM A;  5BRX A;  4QH4 A;  3RIF A;  1UW6 A;  2WN9 A;  5KE4 A;  4EZ1 A;  2XZ5 A;  3C79 A;  4BQT A;  4HFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...