5TVCA

Crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 3 nicotinic acetylcholine receptor in complex with (e,2s)-n-methyl-5-(5-phenoxy-3-pyridyl)pent-4-en-2-amine (ti-5312)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
211
Chain Sequence
DKLHSQANLMRLKSDLFYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYWEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQYKHDIKYNCCEEIYPDVVLVVKFRERRAGNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein
molecule keywords Soluble acetylcholine receptor,Neuronal acetylcholine recept
publication title Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) containing loop C from the human alpha 3 nicotinic acetylcholine receptor in complex with (E,2S)-N-methyl-5-(5-phenoxy-3-pyridyl)pent-4-en-2-amine (TI-5312)
rcsb
source organism Aplysia californica
total genus 47
structure length 211
sequence length 216
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5tvcA00
4QAAA 5L4EA 2XZ5A 4NZBA 5CFBA 2XQ9A 4EZ1A 4ZRUA 3SQ6A 2WNLA 4B5DA 3RHWA 5AFKA 3UU4A 4TNWA 4TWFA 5HEJA 2XNUA 4AFGA 2YMDA 4ZZCA 5AFHA 4QH4A 5HEUA 3JAEA 5HEGA 3SIOA 2BJ0A 4ILAA 3GUAA 4UM3P 5CO5A 4ZJSA 5LXBA 4WV9A 4A97A 2XYTA 4FRRA 5J5GA 5TVCA 3ZDHA 4LMJA 4ALXA 3U8KA 1UW6A 5L47A 4TWDA 2XNVA 3PEOA 2WNCA 2BG9E 3TLWA 4HFCA 4PIRA 1UX2A 4HFIA 2WNJA 4NPPA 5HCMA 3WTLA 3C79A 2X00A 4UM1A 5AFNA 5BP0A 2YMEA 2YKSA 2Y7YA 2W8GA 4HFBA 3RI5A 3EAMA 2XQ7A 2BYQA 1I9BA 3EI0A 5HCJA 4HQPA 3T4MA 3U8JA 2Y54A 5KZUA 2BG9A 4HFHA 5AFLA 3IGQA 4Z90A 4ZK1A 5J0ZA 2XNTA 4HFEA 4X5TA 2XQ3A 2XQ4A 5HEOA 5BW2A 5SYOA 4BQTA 2Y57A 4ZZBA 4HFDA 4ILCA 5LG3A 5AFMB 3LSVA 2BYNA 4LMLA 5FJVA 4ZK4A 4AFHA 4COFA 2ZJVA 3JADA 3TLTA 2XQ8A 3RIAA 3WIPA 1UV6A 2UZ6A 2C9TA 3UQ7A 3UU6A 2BYSA 2BYPA 4QABA 4TNVA 3RIFA 2VL0A 3WTOA 2BG9C 4ZJTA 3U8MA 2PH9A 2W8FA 5AFJA 3UU3A 4ILBA 4UM3S 5J5FA 3UU8A 3WTIA 5AINA 3WTMA 4UM3A 3SQ9A 4UY2A 5IUXA 2XYSA 4IL9A 3P4WA 3U8NA 3TLVA 2BR7A 5J5IA 2XQ5A 4A98A 2XQ6A 3RQWA 3JAFA 4IREA 3TLUA 2XZ6A 2PGZA 4LMKA 5JMEA 3UUBA 4IL4A 4ZR6A 4TWHA 2XQAA 2BYRA 2ZJUA 3WTHA 3TLSA 4D01A 2Y58A 3C84A 4UXUA 4XHEA 2Y56A 3RQUA 5L4HA 3ZDGA 4F8HA 2WZYA 5J5HA 4QACA 5KE4A 2YOEA 4QH5A 3WTKA 5HEHA 3U8LA 3P50A 2QC1B 3WTJA 3ZKRA 3SH1A 3UU5A 3PMZA 4BFQA 4QH1A 5BRXA 2X00D 2BG9B 4AFTA 2WN9A 4XK9A 5AFMA 3UQ4A 3WTNA 2BR8A 2YN6A 4DBMA 3EHZA 4Z91A
chains in the Genus database with same CATH superfamily
4QAAA 5L4EA 2XZ5A 4NZBA 5CFBA 2XQ9A 4EZ1A 4ZRUA 3SQ6A 2WNLA 4B5DA 3RHWA 5AFKA 3UU4A 4TNWA 4TWFA 5HEJA 2XNUA 4AFGA 2YMDA 4ZZCA 5AFHA 4QH4A 5HEUA 3JAEA 5HEGA 3SIOA 2BJ0A 4ILAA 3GUAA 4UM3P 5CO5A 4ZJSA 5LXBA 4WV9A 4A97A 2XYTA 4FRRA 5J5GA 5TVCA 3ZDHA 4LMJA 4ALXA 3U8KA 1UW6A 5L47A 4TWDA 2XNVA 3PEOA 2WNCA 2BG9E 3TLWA 4HFCA 4PIRA 1UX2A 4HFIA 2WNJA 4NPPA 5HCMA 3WTLA 3C79A 2X00A 4UM1A 5AFNA 5BP0A 2YMEA 2YKSA 2Y7YA 2W8GA 4HFBA 3RI5A 3EAMA 2XQ7A 2BYQA 1I9BA 3EI0A 5HCJA 4HQPA 3T4MA 3U8JA 2Y54A 5KZUA 2BG9A 4HFHA 5AFLA 3IGQA 4Z90A 4ZK1A 5J0ZA 2XNTA 4HFEA 4X5TA 2XQ3A 2XQ4A 5HEOA 5BW2A 5SYOA 4BQTA 2Y57A 4ZZBA 4HFDA 4ILCA 5LG3A 5AFMB 3LSVA 2BYNA 4LMLA 5FJVA 4ZK4A 4AFHA 4COFA 2ZJVA 3JADA 3TLTA 2XQ8A 3RIAA 3WIPA 1UV6A 2UZ6A 2C9TA 3UQ7A 3UU6A 2BYSA 2BYPA 4QABA 4TNVA 3RIFA 2VL0A 3WTOA 2BG9C 4ZJTA 3U8MA 2PH9A 2W8FA 5AFJA 3UU3A 4ILBA 4UM3S 5J5FA 3UU8A 3WTIA 5AINA 3WTMA 4UM3A 3SQ9A 4UY2A 5IUXA 2XYSA 4IL9A 3P4WA 3U8NA 3TLVA 2BR7A 5J5IA 2XQ5A 4A98A 2XQ6A 3RQWA 3JAFA 4IREA 3TLUA 2XZ6A 2PGZA 4LMKA 5JMEA 3UUBA 4IL4A 4ZR6A 4TWHA 2XQAA 2BYRA 2ZJUA 3WTHA 3TLSA 4D01A 2Y58A 3C84A 4UXUA 4XHEA 2Y56A 3RQUA 5L4HA 3ZDGA 4F8HA 2WZYA 5J5HA 4QACA 5KE4A 2YOEA 4QH5A 3WTKA 5HEHA 3U8LA 3P50A 2QC1B 3WTJA 3ZKRA 3SH1A 3UU5A 3PMZA 4BFQA 4QH1A 5BRXA 2X00D 2BG9B 4AFTA 2WN9A 4XK9A 5AFMA 3UQ4A 3WTNA 2BR8A 2YN6A 4DBMA 3EHZA 4Z91A
chains in the Genus database with same CATH topology
4QAAA 5L4EA 2XZ5A 4NZBA 5CFBA 2XQ9A 4EZ1A 4ZRUA 3SQ6A 2WNLA 4B5DA 3RHWA 5AFKA 3UU4A 4TNWA 4TWFA 5HEJA 2XNUA 4AFGA 2YMDA 4ZZCA 5AFHA 4QH4A 5HEUA 3JAEA 5HEGA 3SIOA 2BJ0A 4ILAA 3GUAA 4UM3P 5CO5A 4ZJSA 5LXBA 4WV9A 4A97A 2XYTA 4FRRA 5J5GA 5TVCA 3ZDHA 4LMJA 4ALXA 3U8KA 1UW6A 5L47A 4TWDA 2XNVA 3PEOA 2WNCA 2BG9E 3TLWA 4HFCA 4PIRA 1UX2A 4HFIA 2WNJA 4NPPA 5HCMA 3WTLA 3C79A 2X00A 4UM1A 5AFNA 5BP0A 2YMEA 2YKSA 2Y7YA 2W8GA 4HFBA 3RI5A 3EAMA 2XQ7A 2BYQA 1I9BA 3EI0A 5HCJA 4HQPA 3T4MA 3U8JA 2Y54A 5KZUA 2BG9A 4HFHA 5AFLA 3IGQA 4Z90A 4ZK1A 5J0ZA 2XNTA 4HFEA 4X5TA 2XQ3A 2XQ4A 5HEOA 5BW2A 5SYOA 4BQTA 2Y57A 4ZZBA 4HFDA 4ILCA 5LG3A 5AFMB 3LSVA 2BYNA 4LMLA 5FJVA 4ZK4A 4AFHA 4COFA 2ZJVA 3JADA 3TLTA 2XQ8A 3RIAA 3WIPA 1UV6A 2UZ6A 2C9TA 3UQ7A 3UU6A 2BYSA 2BYPA 4QABA 4TNVA 3RIFA 2VL0A 3WTOA 2BG9C 4ZJTA 3U8MA 2PH9A 2W8FA 5AFJA 3UU3A 4ILBA 4UM3S 5J5FA 3UU8A 3WTIA 5AINA 3WTMA 4UM3A 3SQ9A 4UY2A 5IUXA 2XYSA 4IL9A 3P4WA 3U8NA 3TLVA 2BR7A 5J5IA 2XQ5A 4A98A 2XQ6A 3RQWA 3JAFA 4IREA 3TLUA 2XZ6A 2PGZA 4LMKA 5JMEA 3UUBA 4IL4A 4ZR6A 4TWHA 2XQAA 2BYRA 2ZJUA 3WTHA 3TLSA 4D01A 2Y58A 3C84A 4UXUA 4XHEA 2Y56A 3RQUA 5L4HA 3ZDGA 4F8HA 2WZYA 5J5HA 4QACA 5KE4A 2YOEA 4QH5A 3WTKA 5HEHA 3U8LA 3P50A 2QC1B 3WTJA 3ZKRA 3SH1A 3UU5A 3PMZA 4BFQA 4QH1A 5BRXA 2X00D 2BG9B 4AFTA 2WN9A 4XK9A 5AFMA 3UQ4A 3WTNA 2BR8A 2YN6A 4DBMA 3EHZA 4Z91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QAA A;  5L4E A;  2XZ5 A;  4NZB A;  5CFB A;  2XQ9 A;  4EZ1 A;  4ZRU A;  3SQ6 A;  2WNL A;  4B5D A;  3RHW A;  5AFK A;  3UU4 A;  4TNW A;  4TWF A;  5HEJ A;  2XNU A;  4AFG A;  2YMD A;  4ZZC A;  5AFH A;  4QH4 A;  5HEU A;  3JAE A;  5HEG A;  3SIO A;  2BJ0 A;  4ILA A;  3GUA A;  4UM3 P;  5CO5 A;  4ZJS A;  5LXB A;  4WV9 A;  4A97 A;  2XYT A;  4FRR A;  5J5G A;  5TVC A;  3ZDH A;  4LMJ A;  4ALX A;  3U8K A;  1UW6 A;  5L47 A;  4TWD A;  2XNV A;  3PEO A;  2WNC A;  2BG9 E;  3TLW A;  4HFC A;  4PIR A;  1UX2 A;  4HFI A;  2WNJ A;  4NPP A;  5HCM A;  3WTL A;  3C79 A;  2X00 A;  4UM1 A;  5AFN A;  5BP0 A;  2YME A;  2YKS A;  2Y7Y A;  2W8G A;  4HFB A;  3RI5 A;  3EAM A;  2XQ7 A;  2BYQ A;  1I9B A;  3EI0 A;  5HCJ A;  4HQP A;  3T4M A;  3U8J A;  2Y54 A;  5KZU A;  2BG9 A;  4HFH A;  5AFL A;  3IGQ A;  4Z90 A;  4ZK1 A;  5J0Z A;  2XNT A;  4HFE A;  4X5T A;  2XQ3 A;  2XQ4 A;  5HEO A;  5BW2 A;  5SYO A;  4BQT A;  2Y57 A;  4ZZB A;  4HFD A;  4ILC A;  5LG3 A;  5AFM B;  3LSV A;  2BYN A;  4LML A;  5FJV A;  4ZK4 A;  4AFH A;  4COF A;  2ZJV A;  3JAD A;  3TLT A;  2XQ8 A;  3RIA A;  3WIP A;  1UV6 A;  2UZ6 A;  2C9T A;  3UQ7 A;  3UU6 A;  2BYS A;  2BYP A;  4QAB A;  4TNV A;  3RIF A;  2VL0 A;  3WTO A;  2BG9 C;  4ZJT A;  3U8M A;  2PH9 A;  2W8F A;  5AFJ A;  3UU3 A;  4ILB A;  4UM3 S;  5J5F A;  3UU8 A;  3WTI A;  5AIN A;  3WTM A;  4UM3 A;  3SQ9 A;  4UY2 A;  5IUX A;  2XYS A;  4IL9 A;  3P4W A;  3U8N A;  3TLV A;  2BR7 A;  5J5I A;  2XQ5 A;  4A98 A;  2XQ6 A;  3RQW A;  3JAF A;  4IRE A;  3TLU A;  2XZ6 A;  2PGZ A;  4LMK A;  5JME A;  3UUB A;  4IL4 A;  4ZR6 A;  4TWH A;  2XQA A;  2BYR A;  2ZJU A;  3WTH A;  3TLS A;  4D01 A;  2Y58 A;  3C84 A;  4UXU A;  4XHE A;  2Y56 A;  3RQU A;  5L4H A;  3ZDG A;  4F8H A;  2WZY A;  5J5H A;  4QAC A;  5KE4 A;  2YOE A;  4QH5 A;  3WTK A;  5HEH A;  3U8L A;  3P50 A;  2QC1 B;  3WTJ A;  3ZKR A;  3SH1 A;  3UU5 A;  3PMZ A;  4BFQ A;  4QH1 A;  5BRX A;  2X00 D;  2BG9 B;  4AFT A;  2WN9 A;  4XK9 A;  5AFM A;  3UQ4 A;  3WTN A;  2BR8 A;  2YN6 A;  4DBM A;  3EHZ A;  4Z91 A; 
#chains in the Genus database with same CATH topology
 4QAA A;  5L4E A;  2XZ5 A;  4NZB A;  5CFB A;  2XQ9 A;  4EZ1 A;  4ZRU A;  3SQ6 A;  2WNL A;  4B5D A;  3RHW A;  5AFK A;  3UU4 A;  4TNW A;  4TWF A;  5HEJ A;  2XNU A;  4AFG A;  2YMD A;  4ZZC A;  5AFH A;  4QH4 A;  5HEU A;  3JAE A;  5HEG A;  3SIO A;  2BJ0 A;  4ILA A;  3GUA A;  4UM3 P;  5CO5 A;  4ZJS A;  5LXB A;  4WV9 A;  4A97 A;  2XYT A;  4FRR A;  5J5G A;  5TVC A;  3ZDH A;  4LMJ A;  4ALX A;  3U8K A;  1UW6 A;  5L47 A;  4TWD A;  2XNV A;  3PEO A;  2WNC A;  2BG9 E;  3TLW A;  4HFC A;  4PIR A;  1UX2 A;  4HFI A;  2WNJ A;  4NPP A;  5HCM A;  3WTL A;  3C79 A;  2X00 A;  4UM1 A;  5AFN A;  5BP0 A;  2YME A;  2YKS A;  2Y7Y A;  2W8G A;  4HFB A;  3RI5 A;  3EAM A;  2XQ7 A;  2BYQ A;  1I9B A;  3EI0 A;  5HCJ A;  4HQP A;  3T4M A;  3U8J A;  2Y54 A;  5KZU A;  2BG9 A;  4HFH A;  5AFL A;  3IGQ A;  4Z90 A;  4ZK1 A;  5J0Z A;  2XNT A;  4HFE A;  4X5T A;  2XQ3 A;  2XQ4 A;  5HEO A;  5BW2 A;  5SYO A;  4BQT A;  2Y57 A;  4ZZB A;  4HFD A;  4ILC A;  5LG3 A;  5AFM B;  3LSV A;  2BYN A;  4LML A;  5FJV A;  4ZK4 A;  4AFH A;  4COF A;  2ZJV A;  3JAD A;  3TLT A;  2XQ8 A;  3RIA A;  3WIP A;  1UV6 A;  2UZ6 A;  2C9T A;  3UQ7 A;  3UU6 A;  2BYS A;  2BYP A;  4QAB A;  4TNV A;  3RIF A;  2VL0 A;  3WTO A;  2BG9 C;  4ZJT A;  3U8M A;  2PH9 A;  2W8F A;  5AFJ A;  3UU3 A;  4ILB A;  4UM3 S;  5J5F A;  3UU8 A;  3WTI A;  5AIN A;  3WTM A;  4UM3 A;  3SQ9 A;  4UY2 A;  5IUX A;  2XYS A;  4IL9 A;  3P4W A;  3U8N A;  3TLV A;  2BR7 A;  5J5I A;  2XQ5 A;  4A98 A;  2XQ6 A;  3RQW A;  3JAF A;  4IRE A;  3TLU A;  2XZ6 A;  2PGZ A;  4LMK A;  5JME A;  3UUB A;  4IL4 A;  4ZR6 A;  4TWH A;  2XQA A;  2BYR A;  2ZJU A;  3WTH A;  3TLS A;  4D01 A;  2Y58 A;  3C84 A;  4UXU A;  4XHE A;  2Y56 A;  3RQU A;  5L4H A;  3ZDG A;  4F8H A;  2WZY A;  5J5H A;  4QAC A;  5KE4 A;  2YOE A;  4QH5 A;  3WTK A;  5HEH A;  3U8L A;  3P50 A;  2QC1 B;  3WTJ A;  3ZKR A;  3SH1 A;  3UU5 A;  3PMZ A;  4BFQ A;  4QH1 A;  5BRX A;  2X00 D;  2BG9 B;  4AFT A;  2WN9 A;  4XK9 A;  5AFM A;  3UQ4 A;  3WTN A;  2BR8 A;  2YN6 A;  4DBM A;  3EHZ A;  4Z91 A; 
#chains in the Genus database with same CATH homology
 4QAA A;  5L4E A;  2XZ5 A;  4NZB A;  5CFB A;  2XQ9 A;  4EZ1 A;  4ZRU A;  3SQ6 A;  2WNL A;  4B5D A;  3RHW A;  5AFK A;  3UU4 A;  4TNW A;  4TWF A;  5HEJ A;  2XNU A;  4AFG A;  2YMD A;  4ZZC A;  5AFH A;  4QH4 A;  5HEU A;  3JAE A;  5HEG A;  3SIO A;  2BJ0 A;  4ILA A;  3GUA A;  4UM3 P;  5CO5 A;  4ZJS A;  5LXB A;  4WV9 A;  4A97 A;  2XYT A;  4FRR A;  5J5G A;  5TVC A;  3ZDH A;  4LMJ A;  4ALX A;  3U8K A;  1UW6 A;  5L47 A;  4TWD A;  2XNV A;  3PEO A;  2WNC A;  2BG9 E;  3TLW A;  4HFC A;  4PIR A;  1UX2 A;  4HFI A;  2WNJ A;  4NPP A;  5HCM A;  3WTL A;  3C79 A;  2X00 A;  4UM1 A;  5AFN A;  5BP0 A;  2YME A;  2YKS A;  2Y7Y A;  2W8G A;  4HFB A;  3RI5 A;  3EAM A;  2XQ7 A;  2BYQ A;  1I9B A;  3EI0 A;  5HCJ A;  4HQP A;  3T4M A;  3U8J A;  2Y54 A;  5KZU A;  2BG9 A;  4HFH A;  5AFL A;  3IGQ A;  4Z90 A;  4ZK1 A;  5J0Z A;  2XNT A;  4HFE A;  4X5T A;  2XQ3 A;  2XQ4 A;  5HEO A;  5BW2 A;  5SYO A;  4BQT A;  2Y57 A;  4ZZB A;  4HFD A;  4ILC A;  5LG3 A;  5AFM B;  3LSV A;  2BYN A;  4LML A;  5FJV A;  4ZK4 A;  4AFH A;  4COF A;  2ZJV A;  3JAD A;  3TLT A;  2XQ8 A;  3RIA A;  3WIP A;  1UV6 A;  2UZ6 A;  2C9T A;  3UQ7 A;  3UU6 A;  2BYS A;  2BYP A;  4QAB A;  4TNV A;  3RIF A;  2VL0 A;  3WTO A;  2BG9 C;  4ZJT A;  3U8M A;  2PH9 A;  2W8F A;  5AFJ A;  3UU3 A;  4ILB A;  4UM3 S;  5J5F A;  3UU8 A;  3WTI A;  5AIN A;  3WTM A;  4UM3 A;  3SQ9 A;  4UY2 A;  5IUX A;  2XYS A;  4IL9 A;  3P4W A;  3U8N A;  3TLV A;  2BR7 A;  5J5I A;  2XQ5 A;  4A98 A;  2XQ6 A;  3RQW A;  3JAF A;  4IRE A;  3TLU A;  2XZ6 A;  2PGZ A;  4LMK A;  5JME A;  3UUB A;  4IL4 A;  4ZR6 A;  4TWH A;  2XQA A;  2BYR A;  2ZJU A;  3WTH A;  3TLS A;  4D01 A;  2Y58 A;  3C84 A;  4UXU A;  4XHE A;  2Y56 A;  3RQU A;  5L4H A;  3ZDG A;  4F8H A;  2WZY A;  5J5H A;  4QAC A;  5KE4 A;  2YOE A;  4QH5 A;  3WTK A;  5HEH A;  3U8L A;  3P50 A;  2QC1 B;  3WTJ A;  3ZKR A;  3SH1 A;  3UU5 A;  3PMZ A;  4BFQ A;  4QH1 A;  5BRX A;  2X00 D;  2BG9 B;  4AFT A;  2WN9 A;  4XK9 A;  5AFM A;  3UQ4 A;  3WTN A;  2BR8 A;  2YN6 A;  4DBM A;  3EHZ A;  4Z91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...