2UZ6A

Achbp-targeted a-conotoxin correlates distinct binding orientations with nachr subtype selectivity.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
b'QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Achbp-Targeted Alpha-Conotoxin Correlates Distinct Binding Orientations with Nachr Subtype Selectivity
pubmed doi rcsb
molecule tags Receptor/toxin
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2uz6A00
5AFJA 2XQ6A 4PIRA 3ZKRA 4TNWA 2XNUA 2YMEA 3UU6A 3TLUA 3WTOA 5L4EA 3WTHA 5LXBA 4ZZCA 5HCMA 2C9TA 3C84A 2X00D 3IGQA 5HCJA 2W8FA 5J5GA 2XYSA 2Y57A 2BYSA 3RQWA 4X5TA 3UU8A 5J5HA 2XQ5A 2XZ6A 3WTKA 5SYOA 2BYPA 2VL0A 3RHWA 4A98A 2BG9E 3UU5A 4LMKA 1UX2A 3WTLA 4ALXA 4EZ1A 2BG9B 5TVCA 3JAFA 3WTIA 4ZJSA 5KE4A 3LSVA 4ZZBA 5J5IA 3U8NA 4TWDA 4DBMA 4QAAA 3ZDGA 5HEGA 3UU3A 4B5DA 2XYTA 3EHZA 5L4HA 2Y56A 5AINA 4IL4A 2XQ4A 2WNLA 4ZR6A 2BYRA 4LMJA 3TLVA 4HFIA 4HFHA 4NZBA 1UW6A 3WTJA 3PMZA 2W8GA 5AFMB 4HFDA 3EAMA 5HEHA 3T4MA 2X00A 2XQAA 3WIPA 3SIOA 2QC1B 3U8MA 5LG3A 3SQ9A 3UUBA 4ZK1A 4D01A 5FJVA 2PGZA 2XNTA 4ZRUA 4XHEA 5J5FA 3SQ6A 2WZYA 3RI5A 4ILBA 5AFNA 2Y58A 4UM1A 2XQ3A 2Y7YA 4UM3A 3RIAA 4ZK4A 5CFBA 5AFKA 4IREA 5HEOA 4F8HA 4UM3P 5BW2A 3TLTA 3TLWA 3WTNA 1UV6A 4BFQA 2BR7A 2XNVA 2XQ7A 4AFHA 4Z91A 4ILCA 5CO5A 3U8JA 3U8KA 3WTMA 2ZJUA 5L47A 3UQ7A 2BG9A 2XZ5A 3P4WA 2WN9A 4QABA 5BRXA 4COFA 4TWHA 3C79A 5AFHA 2WNJA 2YOEA 4QH4A 4QH1A 3EI0A 3U8LA 2YN6A 2BG9C 3UQ4A 4BQTA 2ZJVA 3PEOA 2XQ8A 3RQUA 4UY2A 2BYNA 2UZ6A 3ZDHA 4HFCA 2BR8A 4HQPA 4XK9A 3SH1A 2WNCA 4IL9A 4Z90A 5KZUA 4WV9A 2YKSA 5HEJA 5IUXA 3RIFA 4TNVA 4NPPA 4UXUA 5HEUA 2XQ9A 5AFMA 2BJ0A 2BYQA 1I9BA 3P50A 4FRRA 4HFBA 4AFTA 3TLSA 3GUAA 4ZJTA 5BP0A 4QH5A 5J0ZA 3JADA 2PH9A 4TWFA 3UU4A 4ILAA 2YMDA 5AFLA 4HFEA 2Y54A 4QACA 4A97A 4AFGA 4UM3S 4LMLA 5JMEA 3JAEA
chains in the Genus database with same CATH superfamily
5AFJA 2XQ6A 4PIRA 3ZKRA 4TNWA 2XNUA 2YMEA 3UU6A 3TLUA 3WTOA 5L4EA 3WTHA 5LXBA 4ZZCA 5HCMA 2C9TA 3C84A 2X00D 3IGQA 5HCJA 2W8FA 5J5GA 2XYSA 2Y57A 2BYSA 3RQWA 4X5TA 3UU8A 5J5HA 2XQ5A 2XZ6A 3WTKA 5SYOA 2BYPA 2VL0A 3RHWA 4A98A 2BG9E 3UU5A 4LMKA 1UX2A 3WTLA 4ALXA 4EZ1A 2BG9B 5TVCA 3JAFA 3WTIA 4ZJSA 5KE4A 3LSVA 4ZZBA 5J5IA 3U8NA 4TWDA 4DBMA 4QAAA 3ZDGA 5HEGA 3UU3A 4B5DA 2XYTA 3EHZA 5L4HA 2Y56A 5AINA 4IL4A 2XQ4A 2WNLA 4ZR6A 2BYRA 4LMJA 3TLVA 4HFIA 4HFHA 4NZBA 1UW6A 3WTJA 3PMZA 2W8GA 5AFMB 4HFDA 3EAMA 5HEHA 3T4MA 2X00A 2XQAA 3WIPA 3SIOA 2QC1B 3U8MA 5LG3A 3SQ9A 3UUBA 4ZK1A 4D01A 5FJVA 2PGZA 2XNTA 4ZRUA 4XHEA 5J5FA 3SQ6A 2WZYA 3RI5A 4ILBA 5AFNA 2Y58A 4UM1A 2XQ3A 2Y7YA 4UM3A 3RIAA 4ZK4A 5CFBA 5AFKA 4IREA 5HEOA 4F8HA 4UM3P 5BW2A 3TLTA 3TLWA 3WTNA 1UV6A 4BFQA 2BR7A 2XNVA 2XQ7A 4AFHA 4Z91A 4ILCA 5CO5A 3U8JA 3U8KA 3WTMA 2ZJUA 5L47A 3UQ7A 2BG9A 2XZ5A 3P4WA 2WN9A 4QABA 5BRXA 4COFA 4TWHA 3C79A 5AFHA 2WNJA 2YOEA 4QH4A 4QH1A 3EI0A 3U8LA 2YN6A 2BG9C 3UQ4A 4BQTA 2ZJVA 3PEOA 2XQ8A 3RQUA 4UY2A 2BYNA 2UZ6A 3ZDHA 4HFCA 2BR8A 4HQPA 4XK9A 3SH1A 2WNCA 4IL9A 4Z90A 5KZUA 4WV9A 2YKSA 5HEJA 5IUXA 3RIFA 4TNVA 4NPPA 4UXUA 5HEUA 2XQ9A 5AFMA 2BJ0A 2BYQA 1I9BA 3P50A 4FRRA 4HFBA 4AFTA 3TLSA 3GUAA 4ZJTA 5BP0A 4QH5A 5J0ZA 3JADA 2PH9A 4TWFA 3UU4A 4ILAA 2YMDA 5AFLA 4HFEA 2Y54A 4QACA 4A97A 4AFGA 4UM3S 4LMLA 5JMEA 3JAEA
chains in the Genus database with same CATH topology
5AFJA 2XQ6A 4PIRA 3ZKRA 4TNWA 2XNUA 2YMEA 3UU6A 3TLUA 3WTOA 5L4EA 3WTHA 5LXBA 4ZZCA 5HCMA 2C9TA 3C84A 2X00D 3IGQA 5HCJA 2W8FA 5J5GA 2XYSA 2Y57A 2BYSA 3RQWA 4X5TA 3UU8A 5J5HA 2XQ5A 2XZ6A 3WTKA 5SYOA 2BYPA 2VL0A 3RHWA 4A98A 2BG9E 3UU5A 4LMKA 1UX2A 3WTLA 4ALXA 4EZ1A 2BG9B 5TVCA 3JAFA 3WTIA 4ZJSA 5KE4A 3LSVA 4ZZBA 5J5IA 3U8NA 4TWDA 4DBMA 4QAAA 3ZDGA 5HEGA 3UU3A 4B5DA 2XYTA 3EHZA 5L4HA 2Y56A 5AINA 4IL4A 2XQ4A 2WNLA 4ZR6A 2BYRA 4LMJA 3TLVA 4HFIA 4HFHA 4NZBA 1UW6A 3WTJA 3PMZA 2W8GA 5AFMB 4HFDA 3EAMA 5HEHA 3T4MA 2X00A 2XQAA 3WIPA 3SIOA 2QC1B 3U8MA 5LG3A 3SQ9A 3UUBA 4ZK1A 4D01A 5FJVA 2PGZA 2XNTA 4ZRUA 4XHEA 5J5FA 3SQ6A 2WZYA 3RI5A 4ILBA 5AFNA 2Y58A 4UM1A 2XQ3A 2Y7YA 4UM3A 3RIAA 4ZK4A 5CFBA 5AFKA 4IREA 5HEOA 4F8HA 4UM3P 5BW2A 3TLTA 3TLWA 3WTNA 1UV6A 4BFQA 2BR7A 2XNVA 2XQ7A 4AFHA 4Z91A 4ILCA 5CO5A 3U8JA 3U8KA 3WTMA 2ZJUA 5L47A 3UQ7A 2BG9A 2XZ5A 3P4WA 2WN9A 4QABA 5BRXA 4COFA 4TWHA 3C79A 5AFHA 2WNJA 2YOEA 4QH4A 4QH1A 3EI0A 3U8LA 2YN6A 2BG9C 3UQ4A 4BQTA 2ZJVA 3PEOA 2XQ8A 3RQUA 4UY2A 2BYNA 2UZ6A 3ZDHA 4HFCA 2BR8A 4HQPA 4XK9A 3SH1A 2WNCA 4IL9A 4Z90A 5KZUA 4WV9A 2YKSA 5HEJA 5IUXA 3RIFA 4TNVA 4NPPA 4UXUA 5HEUA 2XQ9A 5AFMA 2BJ0A 2BYQA 1I9BA 3P50A 4FRRA 4HFBA 4AFTA 3TLSA 3GUAA 4ZJTA 5BP0A 4QH5A 5J0ZA 3JADA 2PH9A 4TWFA 3UU4A 4ILAA 2YMDA 5AFLA 4HFEA 2Y54A 4QACA 4A97A 4AFGA 4UM3S 4LMLA 5JMEA 3JAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFJ A;  2XQ6 A;  4PIR A;  3ZKR A;  4TNW A;  2XNU A;  2YME A;  3UU6 A;  3TLU A;  3WTO A;  5L4E A;  3WTH A;  5LXB A;  4ZZC A;  5HCM A;  2C9T A;  3C84 A;  2X00 D;  3IGQ A;  5HCJ A;  2W8F A;  5J5G A;  2XYS A;  2Y57 A;  2BYS A;  3RQW A;  4X5T A;  3UU8 A;  5J5H A;  2XQ5 A;  2XZ6 A;  3WTK A;  5SYO A;  2BYP A;  2VL0 A;  3RHW A;  4A98 A;  2BG9 E;  3UU5 A;  4LMK A;  1UX2 A;  3WTL A;  4ALX A;  4EZ1 A;  2BG9 B;  5TVC A;  3JAF A;  3WTI A;  4ZJS A;  5KE4 A;  3LSV A;  4ZZB A;  5J5I A;  3U8N A;  4TWD A;  4DBM A;  4QAA A;  3ZDG A;  5HEG A;  3UU3 A;  4B5D A;  2XYT A;  3EHZ A;  5L4H A;  2Y56 A;  5AIN A;  4IL4 A;  2XQ4 A;  2WNL A;  4ZR6 A;  2BYR A;  4LMJ A;  3TLV A;  4HFI A;  4HFH A;  4NZB A;  1UW6 A;  3WTJ A;  3PMZ A;  2W8G A;  5AFM B;  4HFD A;  3EAM A;  5HEH A;  3T4M A;  2X00 A;  2XQA A;  3WIP A;  3SIO A;  2QC1 B;  3U8M A;  5LG3 A;  3SQ9 A;  3UUB A;  4ZK1 A;  4D01 A;  5FJV A;  2PGZ A;  2XNT A;  4ZRU A;  4XHE A;  5J5F A;  3SQ6 A;  2WZY A;  3RI5 A;  4ILB A;  5AFN A;  2Y58 A;  4UM1 A;  2XQ3 A;  2Y7Y A;  4UM3 A;  3RIA A;  4ZK4 A;  5CFB A;  5AFK A;  4IRE A;  5HEO A;  4F8H A;  4UM3 P;  5BW2 A;  3TLT A;  3TLW A;  3WTN A;  1UV6 A;  4BFQ A;  2BR7 A;  2XNV A;  2XQ7 A;  4AFH A;  4Z91 A;  4ILC A;  5CO5 A;  3U8J A;  3U8K A;  3WTM A;  2ZJU A;  5L47 A;  3UQ7 A;  2BG9 A;  2XZ5 A;  3P4W A;  2WN9 A;  4QAB A;  5BRX A;  4COF A;  4TWH A;  3C79 A;  5AFH A;  2WNJ A;  2YOE A;  4QH4 A;  4QH1 A;  3EI0 A;  3U8L A;  2YN6 A;  2BG9 C;  3UQ4 A;  4BQT A;  2ZJV A;  3PEO A;  2XQ8 A;  3RQU A;  4UY2 A;  2BYN A;  2UZ6 A;  3ZDH A;  4HFC A;  2BR8 A;  4HQP A;  4XK9 A;  3SH1 A;  2WNC A;  4IL9 A;  4Z90 A;  5KZU A;  4WV9 A;  2YKS A;  5HEJ A;  5IUX A;  3RIF A;  4TNV A;  4NPP A;  4UXU A;  5HEU A;  2XQ9 A;  5AFM A;  2BJ0 A;  2BYQ A;  1I9B A;  3P50 A;  4FRR A;  4HFB A;  4AFT A;  3TLS A;  3GUA A;  4ZJT A;  5BP0 A;  4QH5 A;  5J0Z A;  3JAD A;  2PH9 A;  4TWF A;  3UU4 A;  4ILA A;  2YMD A;  5AFL A;  4HFE A;  2Y54 A;  4QAC A;  4A97 A;  4AFG A;  4UM3 S;  4LML A;  5JME A;  3JAE A; 
#chains in the Genus database with same CATH topology
 5AFJ A;  2XQ6 A;  4PIR A;  3ZKR A;  4TNW A;  2XNU A;  2YME A;  3UU6 A;  3TLU A;  3WTO A;  5L4E A;  3WTH A;  5LXB A;  4ZZC A;  5HCM A;  2C9T A;  3C84 A;  2X00 D;  3IGQ A;  5HCJ A;  2W8F A;  5J5G A;  2XYS A;  2Y57 A;  2BYS A;  3RQW A;  4X5T A;  3UU8 A;  5J5H A;  2XQ5 A;  2XZ6 A;  3WTK A;  5SYO A;  2BYP A;  2VL0 A;  3RHW A;  4A98 A;  2BG9 E;  3UU5 A;  4LMK A;  1UX2 A;  3WTL A;  4ALX A;  4EZ1 A;  2BG9 B;  5TVC A;  3JAF A;  3WTI A;  4ZJS A;  5KE4 A;  3LSV A;  4ZZB A;  5J5I A;  3U8N A;  4TWD A;  4DBM A;  4QAA A;  3ZDG A;  5HEG A;  3UU3 A;  4B5D A;  2XYT A;  3EHZ A;  5L4H A;  2Y56 A;  5AIN A;  4IL4 A;  2XQ4 A;  2WNL A;  4ZR6 A;  2BYR A;  4LMJ A;  3TLV A;  4HFI A;  4HFH A;  4NZB A;  1UW6 A;  3WTJ A;  3PMZ A;  2W8G A;  5AFM B;  4HFD A;  3EAM A;  5HEH A;  3T4M A;  2X00 A;  2XQA A;  3WIP A;  3SIO A;  2QC1 B;  3U8M A;  5LG3 A;  3SQ9 A;  3UUB A;  4ZK1 A;  4D01 A;  5FJV A;  2PGZ A;  2XNT A;  4ZRU A;  4XHE A;  5J5F A;  3SQ6 A;  2WZY A;  3RI5 A;  4ILB A;  5AFN A;  2Y58 A;  4UM1 A;  2XQ3 A;  2Y7Y A;  4UM3 A;  3RIA A;  4ZK4 A;  5CFB A;  5AFK A;  4IRE A;  5HEO A;  4F8H A;  4UM3 P;  5BW2 A;  3TLT A;  3TLW A;  3WTN A;  1UV6 A;  4BFQ A;  2BR7 A;  2XNV A;  2XQ7 A;  4AFH A;  4Z91 A;  4ILC A;  5CO5 A;  3U8J A;  3U8K A;  3WTM A;  2ZJU A;  5L47 A;  3UQ7 A;  2BG9 A;  2XZ5 A;  3P4W A;  2WN9 A;  4QAB A;  5BRX A;  4COF A;  4TWH A;  3C79 A;  5AFH A;  2WNJ A;  2YOE A;  4QH4 A;  4QH1 A;  3EI0 A;  3U8L A;  2YN6 A;  2BG9 C;  3UQ4 A;  4BQT A;  2ZJV A;  3PEO A;  2XQ8 A;  3RQU A;  4UY2 A;  2BYN A;  2UZ6 A;  3ZDH A;  4HFC A;  2BR8 A;  4HQP A;  4XK9 A;  3SH1 A;  2WNC A;  4IL9 A;  4Z90 A;  5KZU A;  4WV9 A;  2YKS A;  5HEJ A;  5IUX A;  3RIF A;  4TNV A;  4NPP A;  4UXU A;  5HEU A;  2XQ9 A;  5AFM A;  2BJ0 A;  2BYQ A;  1I9B A;  3P50 A;  4FRR A;  4HFB A;  4AFT A;  3TLS A;  3GUA A;  4ZJT A;  5BP0 A;  4QH5 A;  5J0Z A;  3JAD A;  2PH9 A;  4TWF A;  3UU4 A;  4ILA A;  2YMD A;  5AFL A;  4HFE A;  2Y54 A;  4QAC A;  4A97 A;  4AFG A;  4UM3 S;  4LML A;  5JME A;  3JAE A; 
#chains in the Genus database with same CATH homology
 5AFJ A;  2XQ6 A;  4PIR A;  3ZKR A;  4TNW A;  2XNU A;  2YME A;  3UU6 A;  3TLU A;  3WTO A;  5L4E A;  3WTH A;  5LXB A;  4ZZC A;  5HCM A;  2C9T A;  3C84 A;  2X00 D;  3IGQ A;  5HCJ A;  2W8F A;  5J5G A;  2XYS A;  2Y57 A;  2BYS A;  3RQW A;  4X5T A;  3UU8 A;  5J5H A;  2XQ5 A;  2XZ6 A;  3WTK A;  5SYO A;  2BYP A;  2VL0 A;  3RHW A;  4A98 A;  2BG9 E;  3UU5 A;  4LMK A;  1UX2 A;  3WTL A;  4ALX A;  4EZ1 A;  2BG9 B;  5TVC A;  3JAF A;  3WTI A;  4ZJS A;  5KE4 A;  3LSV A;  4ZZB A;  5J5I A;  3U8N A;  4TWD A;  4DBM A;  4QAA A;  3ZDG A;  5HEG A;  3UU3 A;  4B5D A;  2XYT A;  3EHZ A;  5L4H A;  2Y56 A;  5AIN A;  4IL4 A;  2XQ4 A;  2WNL A;  4ZR6 A;  2BYR A;  4LMJ A;  3TLV A;  4HFI A;  4HFH A;  4NZB A;  1UW6 A;  3WTJ A;  3PMZ A;  2W8G A;  5AFM B;  4HFD A;  3EAM A;  5HEH A;  3T4M A;  2X00 A;  2XQA A;  3WIP A;  3SIO A;  2QC1 B;  3U8M A;  5LG3 A;  3SQ9 A;  3UUB A;  4ZK1 A;  4D01 A;  5FJV A;  2PGZ A;  2XNT A;  4ZRU A;  4XHE A;  5J5F A;  3SQ6 A;  2WZY A;  3RI5 A;  4ILB A;  5AFN A;  2Y58 A;  4UM1 A;  2XQ3 A;  2Y7Y A;  4UM3 A;  3RIA A;  4ZK4 A;  5CFB A;  5AFK A;  4IRE A;  5HEO A;  4F8H A;  4UM3 P;  5BW2 A;  3TLT A;  3TLW A;  3WTN A;  1UV6 A;  4BFQ A;  2BR7 A;  2XNV A;  2XQ7 A;  4AFH A;  4Z91 A;  4ILC A;  5CO5 A;  3U8J A;  3U8K A;  3WTM A;  2ZJU A;  5L47 A;  3UQ7 A;  2BG9 A;  2XZ5 A;  3P4W A;  2WN9 A;  4QAB A;  5BRX A;  4COF A;  4TWH A;  3C79 A;  5AFH A;  2WNJ A;  2YOE A;  4QH4 A;  4QH1 A;  3EI0 A;  3U8L A;  2YN6 A;  2BG9 C;  3UQ4 A;  4BQT A;  2ZJV A;  3PEO A;  2XQ8 A;  3RQU A;  4UY2 A;  2BYN A;  2UZ6 A;  3ZDH A;  4HFC A;  2BR8 A;  4HQP A;  4XK9 A;  3SH1 A;  2WNC A;  4IL9 A;  4Z90 A;  5KZU A;  4WV9 A;  2YKS A;  5HEJ A;  5IUX A;  3RIF A;  4TNV A;  4NPP A;  4UXU A;  5HEU A;  2XQ9 A;  5AFM A;  2BJ0 A;  2BYQ A;  1I9B A;  3P50 A;  4FRR A;  4HFB A;  4AFT A;  3TLS A;  3GUA A;  4ZJT A;  5BP0 A;  4QH5 A;  5J0Z A;  3JAD A;  2PH9 A;  4TWF A;  3UU4 A;  4ILA A;  2YMD A;  5AFL A;  4HFE A;  2Y54 A;  4QAC A;  4A97 A;  4AFG A;  4UM3 S;  4LML A;  5JME A;  3JAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...