4QAAA

X-ray structure of acetylcholine binding protein (achbp) in complex with 6-(4-methoxyphenyl)-n4-octylpyrimidine-2,4-diamine
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
207
Chain Sequence
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Structural basis for cooperative interactions of substituted 2-aminopyrimidines with the acetylcholine binding protein.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein
total genus 45
structure length 207
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qaaA00
3PMZA 2XQAA 3C79A 4HFBA 4QH5A 4X5TA 4UM1A 4ZJSA 3WTHA 2WN9A 5HEUA 4NPPA 4NZBA 3GUAA 3UUBA 5IUXA 5HEHA 3RI5A 4ALXA 5CFBA 4EZ1A 2PH9A 2XNVA 3JADA 3UU5A 3U8JA 3ZKRA 5AFLA 2Y54A 3UQ7A 2XZ5A 2XQ8A 5HCJA 4A97A 2BYPA 2XQ7A 5AINA 2XQ6A 4ZK4A 4QH4A 3WTOA 4WV9A 4PIRA 1UV6A 4LMKA 2W8FA 3EAMA 3IGQA 4LMJA 2Y57A 3WTNA 2XNTA 2XQ3A 2QC1B 4HFCA 2PGZA 3WTMA 4TWFA 2BYQA 3RQUA 4UM3P 5AFMB 5KE4A 5L4EA 4DBMA 5CO5A 2ZJUA 4HFDA 4XHEA 5BRXA 5AFMA 4ZZBA 3UU3A 3LSVA 2XZ6A 4IL9A 2BJ0A 1UX2A 5HCMA 3SH1A 5L47A 3WTLA 4ZZCA 2WZYA 3U8MA 4ZK1A 2Y7YA 2XQ5A 3WTKA 5J0ZA 2YOEA 3P4WA 3EHZA 4QABA 5FJVA 5JMEA 5LXBA 2ZJVA 3SQ9A 4ILCA 2WNJA 2BG9B 1UW6A 4BFQA 2XQ9A 3RIAA 5AFHA 5L4HA 2Y56A 4ZR6A 2BG9A 3RIFA 2BR7A 4HQPA 5SYOA 5J5GA 3U8LA 5BP0A 5BW2A 4QAAA 4TWHA 3TLVA 2W8GA 3WTJA 3RHWA 4COFA 3TLUA 4BQTA 4F8HA 2X00D 4AFHA 4FRRA 4ZRUA 2C9TA 4Z90A 4HFEA 3UU4A 2BG9E 1I9BA 3TLWA 4ZJTA 2YKSA 4UM3S 3JAFA 5TVCA 4IL4A 4UY2A 4AFGA 4XK9A 4D01A 5AFNA 2BG9C 2BR8A 4TNVA 4QH1A 5J5HA 3EI0A 5KZUA 2BYNA 3U8KA 2WNCA 2BYSA 2BYRA 3PEOA 3ZDGA 5HEOA 4TWDA 3TLSA 2VL0A 2XYTA 4B5DA 5J5FA 5AFJA 4HFHA 4HFIA 5HEGA 3UU6A 3WTIA 4A98A 4UM3A 3WIPA 3T4MA 2XQ4A 5LG3A 3TLTA 3JAEA 2XNUA 3ZDHA 4LMLA 2YMEA 2XYSA 2YN6A 2YMDA 2X00A 3C84A 5HEJA 3UU8A 4TNWA 4IREA 4ILBA 3UQ4A 4AFTA 3SIOA 4ILAA 3SQ6A 5AFKA 2WNLA 4QACA 2Y58A 3P50A 3RQWA 4Z91A 4UXUA 3U8NA 5J5IA 2UZ6A
chains in the Genus database with same CATH superfamily
3PMZA 2XQAA 3C79A 4HFBA 4QH5A 4X5TA 4UM1A 4ZJSA 3WTHA 2WN9A 5HEUA 4NPPA 4NZBA 3GUAA 3UUBA 5IUXA 5HEHA 3RI5A 4ALXA 5CFBA 4EZ1A 2PH9A 2XNVA 3JADA 3UU5A 3U8JA 3ZKRA 5AFLA 2Y54A 3UQ7A 2XZ5A 2XQ8A 5HCJA 4A97A 2BYPA 2XQ7A 5AINA 2XQ6A 4ZK4A 4QH4A 3WTOA 4WV9A 4PIRA 1UV6A 4LMKA 2W8FA 3EAMA 3IGQA 4LMJA 2Y57A 3WTNA 2XNTA 2XQ3A 2QC1B 4HFCA 2PGZA 3WTMA 4TWFA 2BYQA 3RQUA 4UM3P 5AFMB 5KE4A 5L4EA 4DBMA 5CO5A 2ZJUA 4HFDA 4XHEA 5BRXA 5AFMA 4ZZBA 3UU3A 3LSVA 2XZ6A 4IL9A 2BJ0A 1UX2A 5HCMA 3SH1A 5L47A 3WTLA 4ZZCA 2WZYA 3U8MA 4ZK1A 2Y7YA 2XQ5A 3WTKA 5J0ZA 2YOEA 3P4WA 3EHZA 4QABA 5FJVA 5JMEA 5LXBA 2ZJVA 3SQ9A 4ILCA 2WNJA 2BG9B 1UW6A 4BFQA 2XQ9A 3RIAA 5AFHA 5L4HA 2Y56A 4ZR6A 2BG9A 3RIFA 2BR7A 4HQPA 5SYOA 5J5GA 3U8LA 5BP0A 5BW2A 4QAAA 4TWHA 3TLVA 2W8GA 3WTJA 3RHWA 4COFA 3TLUA 4BQTA 4F8HA 2X00D 4AFHA 4FRRA 4ZRUA 2C9TA 4Z90A 4HFEA 3UU4A 2BG9E 1I9BA 3TLWA 4ZJTA 2YKSA 4UM3S 3JAFA 5TVCA 4IL4A 4UY2A 4AFGA 4XK9A 4D01A 5AFNA 2BG9C 2BR8A 4TNVA 4QH1A 5J5HA 3EI0A 5KZUA 2BYNA 3U8KA 2WNCA 2BYSA 2BYRA 3PEOA 3ZDGA 5HEOA 4TWDA 3TLSA 2VL0A 2XYTA 4B5DA 5J5FA 5AFJA 4HFHA 4HFIA 5HEGA 3UU6A 3WTIA 4A98A 4UM3A 3WIPA 3T4MA 2XQ4A 5LG3A 3TLTA 3JAEA 2XNUA 3ZDHA 4LMLA 2YMEA 2XYSA 2YN6A 2YMDA 2X00A 3C84A 5HEJA 3UU8A 4TNWA 4IREA 4ILBA 3UQ4A 4AFTA 3SIOA 4ILAA 3SQ6A 5AFKA 2WNLA 4QACA 2Y58A 3P50A 3RQWA 4Z91A 4UXUA 3U8NA 5J5IA 2UZ6A
chains in the Genus database with same CATH topology
3PMZA 2XQAA 3C79A 4HFBA 4QH5A 4X5TA 4UM1A 4ZJSA 3WTHA 2WN9A 5HEUA 4NPPA 4NZBA 3GUAA 3UUBA 5IUXA 5HEHA 3RI5A 4ALXA 5CFBA 4EZ1A 2PH9A 2XNVA 3JADA 3UU5A 3U8JA 3ZKRA 5AFLA 2Y54A 3UQ7A 2XZ5A 2XQ8A 5HCJA 4A97A 2BYPA 2XQ7A 5AINA 2XQ6A 4ZK4A 4QH4A 3WTOA 4WV9A 4PIRA 1UV6A 4LMKA 2W8FA 3EAMA 3IGQA 4LMJA 2Y57A 3WTNA 2XNTA 2XQ3A 2QC1B 4HFCA 2PGZA 3WTMA 4TWFA 2BYQA 3RQUA 4UM3P 5AFMB 5KE4A 5L4EA 4DBMA 5CO5A 2ZJUA 4HFDA 4XHEA 5BRXA 5AFMA 4ZZBA 3UU3A 3LSVA 2XZ6A 4IL9A 2BJ0A 1UX2A 5HCMA 3SH1A 5L47A 3WTLA 4ZZCA 2WZYA 3U8MA 4ZK1A 2Y7YA 2XQ5A 3WTKA 5J0ZA 2YOEA 3P4WA 3EHZA 4QABA 5FJVA 5JMEA 5LXBA 2ZJVA 3SQ9A 4ILCA 2WNJA 2BG9B 1UW6A 4BFQA 2XQ9A 3RIAA 5AFHA 5L4HA 2Y56A 4ZR6A 2BG9A 3RIFA 2BR7A 4HQPA 5SYOA 5J5GA 3U8LA 5BP0A 5BW2A 4QAAA 4TWHA 3TLVA 2W8GA 3WTJA 3RHWA 4COFA 3TLUA 4BQTA 4F8HA 2X00D 4AFHA 4FRRA 4ZRUA 2C9TA 4Z90A 4HFEA 3UU4A 2BG9E 1I9BA 3TLWA 4ZJTA 2YKSA 4UM3S 3JAFA 5TVCA 4IL4A 4UY2A 4AFGA 4XK9A 4D01A 5AFNA 2BG9C 2BR8A 4TNVA 4QH1A 5J5HA 3EI0A 5KZUA 2BYNA 3U8KA 2WNCA 2BYSA 2BYRA 3PEOA 3ZDGA 5HEOA 4TWDA 3TLSA 2VL0A 2XYTA 4B5DA 5J5FA 5AFJA 4HFHA 4HFIA 5HEGA 3UU6A 3WTIA 4A98A 4UM3A 3WIPA 3T4MA 2XQ4A 5LG3A 3TLTA 3JAEA 2XNUA 3ZDHA 4LMLA 2YMEA 2XYSA 2YN6A 2YMDA 2X00A 3C84A 5HEJA 3UU8A 4TNWA 4IREA 4ILBA 3UQ4A 4AFTA 3SIOA 4ILAA 3SQ6A 5AFKA 2WNLA 4QACA 2Y58A 3P50A 3RQWA 4Z91A 4UXUA 3U8NA 5J5IA 2UZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMZ A;  2XQA A;  3C79 A;  4HFB A;  4QH5 A;  4X5T A;  4UM1 A;  4ZJS A;  3WTH A;  2WN9 A;  5HEU A;  4NPP A;  4NZB A;  3GUA A;  3UUB A;  5IUX A;  5HEH A;  3RI5 A;  4ALX A;  5CFB A;  4EZ1 A;  2PH9 A;  2XNV A;  3JAD A;  3UU5 A;  3U8J A;  3ZKR A;  5AFL A;  2Y54 A;  3UQ7 A;  2XZ5 A;  2XQ8 A;  5HCJ A;  4A97 A;  2BYP A;  2XQ7 A;  5AIN A;  2XQ6 A;  4ZK4 A;  4QH4 A;  3WTO A;  4WV9 A;  4PIR A;  1UV6 A;  4LMK A;  2W8F A;  3EAM A;  3IGQ A;  4LMJ A;  2Y57 A;  3WTN A;  2XNT A;  2XQ3 A;  2QC1 B;  4HFC A;  2PGZ A;  3WTM A;  4TWF A;  2BYQ A;  3RQU A;  4UM3 P;  5AFM B;  5KE4 A;  5L4E A;  4DBM A;  5CO5 A;  2ZJU A;  4HFD A;  4XHE A;  5BRX A;  5AFM A;  4ZZB A;  3UU3 A;  3LSV A;  2XZ6 A;  4IL9 A;  2BJ0 A;  1UX2 A;  5HCM A;  3SH1 A;  5L47 A;  3WTL A;  4ZZC A;  2WZY A;  3U8M A;  4ZK1 A;  2Y7Y A;  2XQ5 A;  3WTK A;  5J0Z A;  2YOE A;  3P4W A;  3EHZ A;  4QAB A;  5FJV A;  5JME A;  5LXB A;  2ZJV A;  3SQ9 A;  4ILC A;  2WNJ A;  2BG9 B;  1UW6 A;  4BFQ A;  2XQ9 A;  3RIA A;  5AFH A;  5L4H A;  2Y56 A;  4ZR6 A;  2BG9 A;  3RIF A;  2BR7 A;  4HQP A;  5SYO A;  5J5G A;  3U8L A;  5BP0 A;  5BW2 A;  4QAA A;  4TWH A;  3TLV A;  2W8G A;  3WTJ A;  3RHW A;  4COF A;  3TLU A;  4BQT A;  4F8H A;  2X00 D;  4AFH A;  4FRR A;  4ZRU A;  2C9T A;  4Z90 A;  4HFE A;  3UU4 A;  2BG9 E;  1I9B A;  3TLW A;  4ZJT A;  2YKS A;  4UM3 S;  3JAF A;  5TVC A;  4IL4 A;  4UY2 A;  4AFG A;  4XK9 A;  4D01 A;  5AFN A;  2BG9 C;  2BR8 A;  4TNV A;  4QH1 A;  5J5H A;  3EI0 A;  5KZU A;  2BYN A;  3U8K A;  2WNC A;  2BYS A;  2BYR A;  3PEO A;  3ZDG A;  5HEO A;  4TWD A;  3TLS A;  2VL0 A;  2XYT A;  4B5D A;  5J5F A;  5AFJ A;  4HFH A;  4HFI A;  5HEG A;  3UU6 A;  3WTI A;  4A98 A;  4UM3 A;  3WIP A;  3T4M A;  2XQ4 A;  5LG3 A;  3TLT A;  3JAE A;  2XNU A;  3ZDH A;  4LML A;  2YME A;  2XYS A;  2YN6 A;  2YMD A;  2X00 A;  3C84 A;  5HEJ A;  3UU8 A;  4TNW A;  4IRE A;  4ILB A;  3UQ4 A;  4AFT A;  3SIO A;  4ILA A;  3SQ6 A;  5AFK A;  2WNL A;  4QAC A;  2Y58 A;  3P50 A;  3RQW A;  4Z91 A;  4UXU A;  3U8N A;  5J5I A;  2UZ6 A; 
#chains in the Genus database with same CATH topology
 3PMZ A;  2XQA A;  3C79 A;  4HFB A;  4QH5 A;  4X5T A;  4UM1 A;  4ZJS A;  3WTH A;  2WN9 A;  5HEU A;  4NPP A;  4NZB A;  3GUA A;  3UUB A;  5IUX A;  5HEH A;  3RI5 A;  4ALX A;  5CFB A;  4EZ1 A;  2PH9 A;  2XNV A;  3JAD A;  3UU5 A;  3U8J A;  3ZKR A;  5AFL A;  2Y54 A;  3UQ7 A;  2XZ5 A;  2XQ8 A;  5HCJ A;  4A97 A;  2BYP A;  2XQ7 A;  5AIN A;  2XQ6 A;  4ZK4 A;  4QH4 A;  3WTO A;  4WV9 A;  4PIR A;  1UV6 A;  4LMK A;  2W8F A;  3EAM A;  3IGQ A;  4LMJ A;  2Y57 A;  3WTN A;  2XNT A;  2XQ3 A;  2QC1 B;  4HFC A;  2PGZ A;  3WTM A;  4TWF A;  2BYQ A;  3RQU A;  4UM3 P;  5AFM B;  5KE4 A;  5L4E A;  4DBM A;  5CO5 A;  2ZJU A;  4HFD A;  4XHE A;  5BRX A;  5AFM A;  4ZZB A;  3UU3 A;  3LSV A;  2XZ6 A;  4IL9 A;  2BJ0 A;  1UX2 A;  5HCM A;  3SH1 A;  5L47 A;  3WTL A;  4ZZC A;  2WZY A;  3U8M A;  4ZK1 A;  2Y7Y A;  2XQ5 A;  3WTK A;  5J0Z A;  2YOE A;  3P4W A;  3EHZ A;  4QAB A;  5FJV A;  5JME A;  5LXB A;  2ZJV A;  3SQ9 A;  4ILC A;  2WNJ A;  2BG9 B;  1UW6 A;  4BFQ A;  2XQ9 A;  3RIA A;  5AFH A;  5L4H A;  2Y56 A;  4ZR6 A;  2BG9 A;  3RIF A;  2BR7 A;  4HQP A;  5SYO A;  5J5G A;  3U8L A;  5BP0 A;  5BW2 A;  4QAA A;  4TWH A;  3TLV A;  2W8G A;  3WTJ A;  3RHW A;  4COF A;  3TLU A;  4BQT A;  4F8H A;  2X00 D;  4AFH A;  4FRR A;  4ZRU A;  2C9T A;  4Z90 A;  4HFE A;  3UU4 A;  2BG9 E;  1I9B A;  3TLW A;  4ZJT A;  2YKS A;  4UM3 S;  3JAF A;  5TVC A;  4IL4 A;  4UY2 A;  4AFG A;  4XK9 A;  4D01 A;  5AFN A;  2BG9 C;  2BR8 A;  4TNV A;  4QH1 A;  5J5H A;  3EI0 A;  5KZU A;  2BYN A;  3U8K A;  2WNC A;  2BYS A;  2BYR A;  3PEO A;  3ZDG A;  5HEO A;  4TWD A;  3TLS A;  2VL0 A;  2XYT A;  4B5D A;  5J5F A;  5AFJ A;  4HFH A;  4HFI A;  5HEG A;  3UU6 A;  3WTI A;  4A98 A;  4UM3 A;  3WIP A;  3T4M A;  2XQ4 A;  5LG3 A;  3TLT A;  3JAE A;  2XNU A;  3ZDH A;  4LML A;  2YME A;  2XYS A;  2YN6 A;  2YMD A;  2X00 A;  3C84 A;  5HEJ A;  3UU8 A;  4TNW A;  4IRE A;  4ILB A;  3UQ4 A;  4AFT A;  3SIO A;  4ILA A;  3SQ6 A;  5AFK A;  2WNL A;  4QAC A;  2Y58 A;  3P50 A;  3RQW A;  4Z91 A;  4UXU A;  3U8N A;  5J5I A;  2UZ6 A; 
#chains in the Genus database with same CATH homology
 3PMZ A;  2XQA A;  3C79 A;  4HFB A;  4QH5 A;  4X5T A;  4UM1 A;  4ZJS A;  3WTH A;  2WN9 A;  5HEU A;  4NPP A;  4NZB A;  3GUA A;  3UUB A;  5IUX A;  5HEH A;  3RI5 A;  4ALX A;  5CFB A;  4EZ1 A;  2PH9 A;  2XNV A;  3JAD A;  3UU5 A;  3U8J A;  3ZKR A;  5AFL A;  2Y54 A;  3UQ7 A;  2XZ5 A;  2XQ8 A;  5HCJ A;  4A97 A;  2BYP A;  2XQ7 A;  5AIN A;  2XQ6 A;  4ZK4 A;  4QH4 A;  3WTO A;  4WV9 A;  4PIR A;  1UV6 A;  4LMK A;  2W8F A;  3EAM A;  3IGQ A;  4LMJ A;  2Y57 A;  3WTN A;  2XNT A;  2XQ3 A;  2QC1 B;  4HFC A;  2PGZ A;  3WTM A;  4TWF A;  2BYQ A;  3RQU A;  4UM3 P;  5AFM B;  5KE4 A;  5L4E A;  4DBM A;  5CO5 A;  2ZJU A;  4HFD A;  4XHE A;  5BRX A;  5AFM A;  4ZZB A;  3UU3 A;  3LSV A;  2XZ6 A;  4IL9 A;  2BJ0 A;  1UX2 A;  5HCM A;  3SH1 A;  5L47 A;  3WTL A;  4ZZC A;  2WZY A;  3U8M A;  4ZK1 A;  2Y7Y A;  2XQ5 A;  3WTK A;  5J0Z A;  2YOE A;  3P4W A;  3EHZ A;  4QAB A;  5FJV A;  5JME A;  5LXB A;  2ZJV A;  3SQ9 A;  4ILC A;  2WNJ A;  2BG9 B;  1UW6 A;  4BFQ A;  2XQ9 A;  3RIA A;  5AFH A;  5L4H A;  2Y56 A;  4ZR6 A;  2BG9 A;  3RIF A;  2BR7 A;  4HQP A;  5SYO A;  5J5G A;  3U8L A;  5BP0 A;  5BW2 A;  4QAA A;  4TWH A;  3TLV A;  2W8G A;  3WTJ A;  3RHW A;  4COF A;  3TLU A;  4BQT A;  4F8H A;  2X00 D;  4AFH A;  4FRR A;  4ZRU A;  2C9T A;  4Z90 A;  4HFE A;  3UU4 A;  2BG9 E;  1I9B A;  3TLW A;  4ZJT A;  2YKS A;  4UM3 S;  3JAF A;  5TVC A;  4IL4 A;  4UY2 A;  4AFG A;  4XK9 A;  4D01 A;  5AFN A;  2BG9 C;  2BR8 A;  4TNV A;  4QH1 A;  5J5H A;  3EI0 A;  5KZU A;  2BYN A;  3U8K A;  2WNC A;  2BYS A;  2BYR A;  3PEO A;  3ZDG A;  5HEO A;  4TWD A;  3TLS A;  2VL0 A;  2XYT A;  4B5D A;  5J5F A;  5AFJ A;  4HFH A;  4HFI A;  5HEG A;  3UU6 A;  3WTI A;  4A98 A;  4UM3 A;  3WIP A;  3T4M A;  2XQ4 A;  5LG3 A;  3TLT A;  3JAE A;  2XNU A;  3ZDH A;  4LML A;  2YME A;  2XYS A;  2YN6 A;  2YMD A;  2X00 A;  3C84 A;  5HEJ A;  3UU8 A;  4TNW A;  4IRE A;  4ILB A;  3UQ4 A;  4AFT A;  3SIO A;  4ILA A;  3SQ6 A;  5AFK A;  2WNL A;  4QAC A;  2Y58 A;  3P50 A;  3RQW A;  4Z91 A;  4UXU A;  3U8N A;  5J5I A;  2UZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...