3U8NA

Crystal structure of the acetylcholine binding protein (achbp) from lymnaea stagnalis in complex with ns3950 (1-(6-bromo-5-ethoxypyridin-3-yl)-1,4-diazepane)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
202
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein/agonist
molecule keywords Acetylcholine-binding protein
publication title Intersubunit bridge formation governs agonist efficacy at nicotinic acetylcholine alpha 4 beta 2 receptors: unique role of halogen bonding revealed.
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 49
structure length 202
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3u8nA00
2XZ5A 4ZRUA 5BP0A 3UU6A 3EI0A 2Y54A 4EZ1A 5AFLA 4QH4A 2W8GA 4AFHA 4FRRA 3U8LA 5L47A 2Y7YA 5HEGA 2BYPA 3ZDGA 5J5GA 2XNVA 5HEUA 2WN9A 3RIAA 5AFMB 3U8JA 4COFA 5BW2A 2X00D 2YMEA 2XQ7A 4HFCA 5FJVA 3SH1A 4NPPA 5HEOA 3JADA 4X5TA 3EAMA 5AFHA 5TVCA 4QH5A 4QACA 3UQ4A 4Z91A 4HFBA 5SYOA 3PMZA 4B5DA 4UM1A 3IGQA 1UV6A 3LSVA 4HFEA 4TWFA 3SQ9A 3TLWA 3TLVA 4HFIA 4TNVA 3ZDHA 4BQTA 4A97A 5AFMA 4ZZBA 5L4HA 4IL9A 3SQ6A 3WTKA 3JAFA 4UM3P 5HCJA 3UU3A 5JMEA 4HFHA 3WTJA 5LXBA 2XQ5A 5KE4A 4QH1A 3SIOA 3WTIA 3GUAA 1I9BA 2BR7A 2WNCA 4WV9A 4ALXA 2PH9A 4F8HA 4ZZCA 5KZUA 5BRXA 4NZBA 5IUXA 3U8KA 5CFBA 3EHZA 4LMLA 3UUBA 2UZ6A 2YKSA 5L4EA 4TWHA 5AFKA 5J5IA 2BG9E 2BJ0A 4LMKA 4A98A 3RHWA 4LMJA 2XYTA 4UXUA 5AFNA 3RQWA 3WTOA 4TWDA 4ZR6A 5AFJA 4ILCA 3UU4A 3UQ7A 2XQAA 3WTMA 2C9TA 3C79A 2W8FA 2XNUA 4ZJTA 3TLTA 2Y57A 3JAEA 2BG9C 5J5FA 2QC1B 2Y58A 5J5HA 3TLUA 3PEOA 2XQ3A 3RIFA 4Z90A 4D01A 2BYNA 3WTLA 4UM3S 2ZJUA 2XQ6A 4DBMA 4ZK1A 4XHEA 1UX2A 3P50A 2ZJVA 3ZKRA 2YMDA 3RQUA 5J0ZA 2WNLA 2YN6A 2XZ6A 4PIRA 3P4WA 2BYSA 2XQ4A 4UM3A 3C84A 3U8NA 2WZYA 2YOEA 3T4MA 4AFTA 5LG3A 2BG9A 5HEHA 2XYSA 4IL4A 2PGZA 3UU8A 5HCMA 3WTHA 4HFDA 3RI5A 2BYRA 2Y56A 4ILAA 2BR8A 5CO5A 4UY2A 2BG9B 4QAAA 4HQPA 5HEJA 4XK9A 4ZJSA 2VL0A 2X00A 2XQ8A 3UU5A 3WIPA 2BYQA 2XNTA 4QABA 4AFGA 4ILBA 4IREA 3TLSA 2XQ9A 3WTNA 5AINA 3U8MA 4BFQA 4ZK4A 1UW6A 4TNWA 2WNJA
chains in the Genus database with same CATH superfamily
2XZ5A 4ZRUA 5BP0A 3UU6A 3EI0A 2Y54A 4EZ1A 5AFLA 4QH4A 2W8GA 4AFHA 4FRRA 3U8LA 5L47A 2Y7YA 5HEGA 2BYPA 3ZDGA 5J5GA 2XNVA 5HEUA 2WN9A 3RIAA 5AFMB 3U8JA 4COFA 5BW2A 2X00D 2YMEA 2XQ7A 4HFCA 5FJVA 3SH1A 4NPPA 5HEOA 3JADA 4X5TA 3EAMA 5AFHA 5TVCA 4QH5A 4QACA 3UQ4A 4Z91A 4HFBA 5SYOA 3PMZA 4B5DA 4UM1A 3IGQA 1UV6A 3LSVA 4HFEA 4TWFA 3SQ9A 3TLWA 3TLVA 4HFIA 4TNVA 3ZDHA 4BQTA 4A97A 5AFMA 4ZZBA 5L4HA 4IL9A 3SQ6A 3WTKA 3JAFA 4UM3P 5HCJA 3UU3A 5JMEA 4HFHA 3WTJA 5LXBA 2XQ5A 5KE4A 4QH1A 3SIOA 3WTIA 3GUAA 1I9BA 2BR7A 2WNCA 4WV9A 4ALXA 2PH9A 4F8HA 4ZZCA 5KZUA 5BRXA 4NZBA 5IUXA 3U8KA 5CFBA 3EHZA 4LMLA 3UUBA 2UZ6A 2YKSA 5L4EA 4TWHA 5AFKA 5J5IA 2BG9E 2BJ0A 4LMKA 4A98A 3RHWA 4LMJA 2XYTA 4UXUA 5AFNA 3RQWA 3WTOA 4TWDA 4ZR6A 5AFJA 4ILCA 3UU4A 3UQ7A 2XQAA 3WTMA 2C9TA 3C79A 2W8FA 2XNUA 4ZJTA 3TLTA 2Y57A 3JAEA 2BG9C 5J5FA 2QC1B 2Y58A 5J5HA 3TLUA 3PEOA 2XQ3A 3RIFA 4Z90A 4D01A 2BYNA 3WTLA 4UM3S 2ZJUA 2XQ6A 4DBMA 4ZK1A 4XHEA 1UX2A 3P50A 2ZJVA 3ZKRA 2YMDA 3RQUA 5J0ZA 2WNLA 2YN6A 2XZ6A 4PIRA 3P4WA 2BYSA 2XQ4A 4UM3A 3C84A 3U8NA 2WZYA 2YOEA 3T4MA 4AFTA 5LG3A 2BG9A 5HEHA 2XYSA 4IL4A 2PGZA 3UU8A 5HCMA 3WTHA 4HFDA 3RI5A 2BYRA 2Y56A 4ILAA 2BR8A 5CO5A 4UY2A 2BG9B 4QAAA 4HQPA 5HEJA 4XK9A 4ZJSA 2VL0A 2X00A 2XQ8A 3UU5A 3WIPA 2BYQA 2XNTA 4QABA 4AFGA 4ILBA 4IREA 3TLSA 2XQ9A 3WTNA 5AINA 3U8MA 4BFQA 4ZK4A 1UW6A 4TNWA 2WNJA
chains in the Genus database with same CATH topology
2XZ5A 4ZRUA 5BP0A 3UU6A 3EI0A 2Y54A 4EZ1A 5AFLA 4QH4A 2W8GA 4AFHA 4FRRA 3U8LA 5L47A 2Y7YA 5HEGA 2BYPA 3ZDGA 5J5GA 2XNVA 5HEUA 2WN9A 3RIAA 5AFMB 3U8JA 4COFA 5BW2A 2X00D 2YMEA 2XQ7A 4HFCA 5FJVA 3SH1A 4NPPA 5HEOA 3JADA 4X5TA 3EAMA 5AFHA 5TVCA 4QH5A 4QACA 3UQ4A 4Z91A 4HFBA 5SYOA 3PMZA 4B5DA 4UM1A 3IGQA 1UV6A 3LSVA 4HFEA 4TWFA 3SQ9A 3TLWA 3TLVA 4HFIA 4TNVA 3ZDHA 4BQTA 4A97A 5AFMA 4ZZBA 5L4HA 4IL9A 3SQ6A 3WTKA 3JAFA 4UM3P 5HCJA 3UU3A 5JMEA 4HFHA 3WTJA 5LXBA 2XQ5A 5KE4A 4QH1A 3SIOA 3WTIA 3GUAA 1I9BA 2BR7A 2WNCA 4WV9A 4ALXA 2PH9A 4F8HA 4ZZCA 5KZUA 5BRXA 4NZBA 5IUXA 3U8KA 5CFBA 3EHZA 4LMLA 3UUBA 2UZ6A 2YKSA 5L4EA 4TWHA 5AFKA 5J5IA 2BG9E 2BJ0A 4LMKA 4A98A 3RHWA 4LMJA 2XYTA 4UXUA 5AFNA 3RQWA 3WTOA 4TWDA 4ZR6A 5AFJA 4ILCA 3UU4A 3UQ7A 2XQAA 3WTMA 2C9TA 3C79A 2W8FA 2XNUA 4ZJTA 3TLTA 2Y57A 3JAEA 2BG9C 5J5FA 2QC1B 2Y58A 5J5HA 3TLUA 3PEOA 2XQ3A 3RIFA 4Z90A 4D01A 2BYNA 3WTLA 4UM3S 2ZJUA 2XQ6A 4DBMA 4ZK1A 4XHEA 1UX2A 3P50A 2ZJVA 3ZKRA 2YMDA 3RQUA 5J0ZA 2WNLA 2YN6A 2XZ6A 4PIRA 3P4WA 2BYSA 2XQ4A 4UM3A 3C84A 3U8NA 2WZYA 2YOEA 3T4MA 4AFTA 5LG3A 2BG9A 5HEHA 2XYSA 4IL4A 2PGZA 3UU8A 5HCMA 3WTHA 4HFDA 3RI5A 2BYRA 2Y56A 4ILAA 2BR8A 5CO5A 4UY2A 2BG9B 4QAAA 4HQPA 5HEJA 4XK9A 4ZJSA 2VL0A 2X00A 2XQ8A 3UU5A 3WIPA 2BYQA 2XNTA 4QABA 4AFGA 4ILBA 4IREA 3TLSA 2XQ9A 3WTNA 5AINA 3U8MA 4BFQA 4ZK4A 1UW6A 4TNWA 2WNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZ5 A;  4ZRU A;  5BP0 A;  3UU6 A;  3EI0 A;  2Y54 A;  4EZ1 A;  5AFL A;  4QH4 A;  2W8G A;  4AFH A;  4FRR A;  3U8L A;  5L47 A;  2Y7Y A;  5HEG A;  2BYP A;  3ZDG A;  5J5G A;  2XNV A;  5HEU A;  2WN9 A;  3RIA A;  5AFM B;  3U8J A;  4COF A;  5BW2 A;  2X00 D;  2YME A;  2XQ7 A;  4HFC A;  5FJV A;  3SH1 A;  4NPP A;  5HEO A;  3JAD A;  4X5T A;  3EAM A;  5AFH A;  5TVC A;  4QH5 A;  4QAC A;  3UQ4 A;  4Z91 A;  4HFB A;  5SYO A;  3PMZ A;  4B5D A;  4UM1 A;  3IGQ A;  1UV6 A;  3LSV A;  4HFE A;  4TWF A;  3SQ9 A;  3TLW A;  3TLV A;  4HFI A;  4TNV A;  3ZDH A;  4BQT A;  4A97 A;  5AFM A;  4ZZB A;  5L4H A;  4IL9 A;  3SQ6 A;  3WTK A;  3JAF A;  4UM3 P;  5HCJ A;  3UU3 A;  5JME A;  4HFH A;  3WTJ A;  5LXB A;  2XQ5 A;  5KE4 A;  4QH1 A;  3SIO A;  3WTI A;  3GUA A;  1I9B A;  2BR7 A;  2WNC A;  4WV9 A;  4ALX A;  2PH9 A;  4F8H A;  4ZZC A;  5KZU A;  5BRX A;  4NZB A;  5IUX A;  3U8K A;  5CFB A;  3EHZ A;  4LML A;  3UUB A;  2UZ6 A;  2YKS A;  5L4E A;  4TWH A;  5AFK A;  5J5I A;  2BG9 E;  2BJ0 A;  4LMK A;  4A98 A;  3RHW A;  4LMJ A;  2XYT A;  4UXU A;  5AFN A;  3RQW A;  3WTO A;  4TWD A;  4ZR6 A;  5AFJ A;  4ILC A;  3UU4 A;  3UQ7 A;  2XQA A;  3WTM A;  2C9T A;  3C79 A;  2W8F A;  2XNU A;  4ZJT A;  3TLT A;  2Y57 A;  3JAE A;  2BG9 C;  5J5F A;  2QC1 B;  2Y58 A;  5J5H A;  3TLU A;  3PEO A;  2XQ3 A;  3RIF A;  4Z90 A;  4D01 A;  2BYN A;  3WTL A;  4UM3 S;  2ZJU A;  2XQ6 A;  4DBM A;  4ZK1 A;  4XHE A;  1UX2 A;  3P50 A;  2ZJV A;  3ZKR A;  2YMD A;  3RQU A;  5J0Z A;  2WNL A;  2YN6 A;  2XZ6 A;  4PIR A;  3P4W A;  2BYS A;  2XQ4 A;  4UM3 A;  3C84 A;  3U8N A;  2WZY A;  2YOE A;  3T4M A;  4AFT A;  5LG3 A;  2BG9 A;  5HEH A;  2XYS A;  4IL4 A;  2PGZ A;  3UU8 A;  5HCM A;  3WTH A;  4HFD A;  3RI5 A;  2BYR A;  2Y56 A;  4ILA A;  2BR8 A;  5CO5 A;  4UY2 A;  2BG9 B;  4QAA A;  4HQP A;  5HEJ A;  4XK9 A;  4ZJS A;  2VL0 A;  2X00 A;  2XQ8 A;  3UU5 A;  3WIP A;  2BYQ A;  2XNT A;  4QAB A;  4AFG A;  4ILB A;  4IRE A;  3TLS A;  2XQ9 A;  3WTN A;  5AIN A;  3U8M A;  4BFQ A;  4ZK4 A;  1UW6 A;  4TNW A;  2WNJ A; 
#chains in the Genus database with same CATH topology
 2XZ5 A;  4ZRU A;  5BP0 A;  3UU6 A;  3EI0 A;  2Y54 A;  4EZ1 A;  5AFL A;  4QH4 A;  2W8G A;  4AFH A;  4FRR A;  3U8L A;  5L47 A;  2Y7Y A;  5HEG A;  2BYP A;  3ZDG A;  5J5G A;  2XNV A;  5HEU A;  2WN9 A;  3RIA A;  5AFM B;  3U8J A;  4COF A;  5BW2 A;  2X00 D;  2YME A;  2XQ7 A;  4HFC A;  5FJV A;  3SH1 A;  4NPP A;  5HEO A;  3JAD A;  4X5T A;  3EAM A;  5AFH A;  5TVC A;  4QH5 A;  4QAC A;  3UQ4 A;  4Z91 A;  4HFB A;  5SYO A;  3PMZ A;  4B5D A;  4UM1 A;  3IGQ A;  1UV6 A;  3LSV A;  4HFE A;  4TWF A;  3SQ9 A;  3TLW A;  3TLV A;  4HFI A;  4TNV A;  3ZDH A;  4BQT A;  4A97 A;  5AFM A;  4ZZB A;  5L4H A;  4IL9 A;  3SQ6 A;  3WTK A;  3JAF A;  4UM3 P;  5HCJ A;  3UU3 A;  5JME A;  4HFH A;  3WTJ A;  5LXB A;  2XQ5 A;  5KE4 A;  4QH1 A;  3SIO A;  3WTI A;  3GUA A;  1I9B A;  2BR7 A;  2WNC A;  4WV9 A;  4ALX A;  2PH9 A;  4F8H A;  4ZZC A;  5KZU A;  5BRX A;  4NZB A;  5IUX A;  3U8K A;  5CFB A;  3EHZ A;  4LML A;  3UUB A;  2UZ6 A;  2YKS A;  5L4E A;  4TWH A;  5AFK A;  5J5I A;  2BG9 E;  2BJ0 A;  4LMK A;  4A98 A;  3RHW A;  4LMJ A;  2XYT A;  4UXU A;  5AFN A;  3RQW A;  3WTO A;  4TWD A;  4ZR6 A;  5AFJ A;  4ILC A;  3UU4 A;  3UQ7 A;  2XQA A;  3WTM A;  2C9T A;  3C79 A;  2W8F A;  2XNU A;  4ZJT A;  3TLT A;  2Y57 A;  3JAE A;  2BG9 C;  5J5F A;  2QC1 B;  2Y58 A;  5J5H A;  3TLU A;  3PEO A;  2XQ3 A;  3RIF A;  4Z90 A;  4D01 A;  2BYN A;  3WTL A;  4UM3 S;  2ZJU A;  2XQ6 A;  4DBM A;  4ZK1 A;  4XHE A;  1UX2 A;  3P50 A;  2ZJV A;  3ZKR A;  2YMD A;  3RQU A;  5J0Z A;  2WNL A;  2YN6 A;  2XZ6 A;  4PIR A;  3P4W A;  2BYS A;  2XQ4 A;  4UM3 A;  3C84 A;  3U8N A;  2WZY A;  2YOE A;  3T4M A;  4AFT A;  5LG3 A;  2BG9 A;  5HEH A;  2XYS A;  4IL4 A;  2PGZ A;  3UU8 A;  5HCM A;  3WTH A;  4HFD A;  3RI5 A;  2BYR A;  2Y56 A;  4ILA A;  2BR8 A;  5CO5 A;  4UY2 A;  2BG9 B;  4QAA A;  4HQP A;  5HEJ A;  4XK9 A;  4ZJS A;  2VL0 A;  2X00 A;  2XQ8 A;  3UU5 A;  3WIP A;  2BYQ A;  2XNT A;  4QAB A;  4AFG A;  4ILB A;  4IRE A;  3TLS A;  2XQ9 A;  3WTN A;  5AIN A;  3U8M A;  4BFQ A;  4ZK4 A;  1UW6 A;  4TNW A;  2WNJ A; 
#chains in the Genus database with same CATH homology
 2XZ5 A;  4ZRU A;  5BP0 A;  3UU6 A;  3EI0 A;  2Y54 A;  4EZ1 A;  5AFL A;  4QH4 A;  2W8G A;  4AFH A;  4FRR A;  3U8L A;  5L47 A;  2Y7Y A;  5HEG A;  2BYP A;  3ZDG A;  5J5G A;  2XNV A;  5HEU A;  2WN9 A;  3RIA A;  5AFM B;  3U8J A;  4COF A;  5BW2 A;  2X00 D;  2YME A;  2XQ7 A;  4HFC A;  5FJV A;  3SH1 A;  4NPP A;  5HEO A;  3JAD A;  4X5T A;  3EAM A;  5AFH A;  5TVC A;  4QH5 A;  4QAC A;  3UQ4 A;  4Z91 A;  4HFB A;  5SYO A;  3PMZ A;  4B5D A;  4UM1 A;  3IGQ A;  1UV6 A;  3LSV A;  4HFE A;  4TWF A;  3SQ9 A;  3TLW A;  3TLV A;  4HFI A;  4TNV A;  3ZDH A;  4BQT A;  4A97 A;  5AFM A;  4ZZB A;  5L4H A;  4IL9 A;  3SQ6 A;  3WTK A;  3JAF A;  4UM3 P;  5HCJ A;  3UU3 A;  5JME A;  4HFH A;  3WTJ A;  5LXB A;  2XQ5 A;  5KE4 A;  4QH1 A;  3SIO A;  3WTI A;  3GUA A;  1I9B A;  2BR7 A;  2WNC A;  4WV9 A;  4ALX A;  2PH9 A;  4F8H A;  4ZZC A;  5KZU A;  5BRX A;  4NZB A;  5IUX A;  3U8K A;  5CFB A;  3EHZ A;  4LML A;  3UUB A;  2UZ6 A;  2YKS A;  5L4E A;  4TWH A;  5AFK A;  5J5I A;  2BG9 E;  2BJ0 A;  4LMK A;  4A98 A;  3RHW A;  4LMJ A;  2XYT A;  4UXU A;  5AFN A;  3RQW A;  3WTO A;  4TWD A;  4ZR6 A;  5AFJ A;  4ILC A;  3UU4 A;  3UQ7 A;  2XQA A;  3WTM A;  2C9T A;  3C79 A;  2W8F A;  2XNU A;  4ZJT A;  3TLT A;  2Y57 A;  3JAE A;  2BG9 C;  5J5F A;  2QC1 B;  2Y58 A;  5J5H A;  3TLU A;  3PEO A;  2XQ3 A;  3RIF A;  4Z90 A;  4D01 A;  2BYN A;  3WTL A;  4UM3 S;  2ZJU A;  2XQ6 A;  4DBM A;  4ZK1 A;  4XHE A;  1UX2 A;  3P50 A;  2ZJV A;  3ZKR A;  2YMD A;  3RQU A;  5J0Z A;  2WNL A;  2YN6 A;  2XZ6 A;  4PIR A;  3P4W A;  2BYS A;  2XQ4 A;  4UM3 A;  3C84 A;  3U8N A;  2WZY A;  2YOE A;  3T4M A;  4AFT A;  5LG3 A;  2BG9 A;  5HEH A;  2XYS A;  4IL4 A;  2PGZ A;  3UU8 A;  5HCM A;  3WTH A;  4HFD A;  3RI5 A;  2BYR A;  2Y56 A;  4ILA A;  2BR8 A;  5CO5 A;  4UY2 A;  2BG9 B;  4QAA A;  4HQP A;  5HEJ A;  4XK9 A;  4ZJS A;  2VL0 A;  2X00 A;  2XQ8 A;  3UU5 A;  3WIP A;  2BYQ A;  2XNT A;  4QAB A;  4AFG A;  4ILB A;  4IRE A;  3TLS A;  2XQ9 A;  3WTN A;  5AIN A;  3U8M A;  4BFQ A;  4ZK4 A;  1UW6 A;  4TNW A;  2WNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...