3U8NA

Crystal structure of the acetylcholine binding protein (achbp) from lymnaea stagnalis in complex with ns3950 (1-(6-bromo-5-ethoxypyridin-3-yl)-1,4-diazepane)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
202
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Intersubunit bridge formation governs agonist efficacy at nicotinic acetylcholine alpha 4 beta 2 receptors: unique role of halogen bonding revealed.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein/agonist
total genus 49
structure length 202
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3u8nA00
5L4HA 3SQ6A 4ZK1A 4AFTA 2BYRA 2XQ9A 2XQ4A 3WTLA 4HFDA 4UM3S 4QH1A 5BW2A 4UM3P 2PGZA 2BG9E 5LG3A 4IL4A 5HEHA 2VL0A 4ZZBA 2BR7A 3EHZA 3JAFA 4QH5A 5AFJA 5J5FA 5LXBA 4TWHA 3TLSA 2WNLA 5J5GA 3TLUA 4TWDA 4ZK4A 4B5DA 3UQ4A 4QH4A 4LMJA 3P50A 2XYSA 2BG9A 5TVCA 3WTJA 5HEOA 3C79A 5HCMA 2ZJUA 2X00D 4HQPA 4NZBA 4Z91A 4XK9A 4BFQA 4ALXA 2Y56A 5FJVA 2BR8A 5AFHA 3ZDHA 3UU5A 5BP0A 2Y58A 3ZKRA 2W8GA 4UXUA 5CFBA 3TLWA 1UV6A 3TLVA 4ILBA 2Y7YA 3WTNA 4D01A 4PIRA 2WNJA 2WZYA 5HEUA 3U8MA 2XQAA 2XYTA 5L47A 4ZJTA 4QABA 4Z90A 5L4EA 5SYOA 5AINA 4HFHA 4UM1A 5AFLA 4WV9A 4HFBA 2XQ6A 4UM3A 3TLTA 4F8HA 5J0ZA 3UU3A 3U8JA 2BYNA 4ZZCA 5J5IA 2UZ6A 4COFA 5HEGA 4A98A 2XQ3A 4ZR6A 3WIPA 2XQ5A 2YN6A 1I9BA 3JADA 2QC1B 4EZ1A 2ZJVA 4TNWA 2XQ7A 4UY2A 4HFCA 3UU8A 3WTKA 4A97A 3RHWA 3PEOA 2XNUA 4BQTA 3RQWA 5JMEA 2WNCA 4IL9A 3U8LA 5AFMB 2YMEA 4DBMA 5BRXA 5J5HA 3U8KA 3UQ7A 2BYPA 3WTHA 5IUXA 2YMDA 4NPPA 4ILAA 3UU4A 3IGQA 3RI5A 2PH9A 2BYSA 3RQUA 3EI0A 3SIOA 2WN9A 5HCJA 3RIFA 4HFEA 3P4WA 4IREA 4QACA 3SH1A 4X5TA 2X00A 3LSVA 4AFGA 2W8FA 3EAMA 2C9TA 3GUAA 3RIAA 5HEJA 2XZ6A 4LMKA 1UW6A 3T4MA 2BJ0A 3C84A 4AFHA 5KZUA 2BG9C 1UX2A 2XQ8A 2XNVA 4QAAA 4XHEA 4HFIA 4ZRUA 3PMZA 5CO5A 3WTMA 4ZJSA 5AFKA 3JAEA 2BG9B 2Y57A 5AFMA 4LMLA 2XZ5A 4FRRA 2YKSA 2YOEA 2Y54A 3WTOA 4TWFA 3ZDGA 3UUBA 2BYQA 3U8NA 3WTIA 5KE4A 2XNTA 4TNVA 3SQ9A 4ILCA 3UU6A 5AFNA
chains in the Genus database with same CATH superfamily
5L4HA 3SQ6A 4ZK1A 4AFTA 2BYRA 2XQ9A 2XQ4A 3WTLA 4HFDA 4UM3S 4QH1A 5BW2A 4UM3P 2PGZA 2BG9E 5LG3A 4IL4A 5HEHA 2VL0A 4ZZBA 2BR7A 3EHZA 3JAFA 4QH5A 5AFJA 5J5FA 5LXBA 4TWHA 3TLSA 2WNLA 5J5GA 3TLUA 4TWDA 4ZK4A 4B5DA 3UQ4A 4QH4A 4LMJA 3P50A 2XYSA 2BG9A 5TVCA 3WTJA 5HEOA 3C79A 5HCMA 2ZJUA 2X00D 4HQPA 4NZBA 4Z91A 4XK9A 4BFQA 4ALXA 2Y56A 5FJVA 2BR8A 5AFHA 3ZDHA 3UU5A 5BP0A 2Y58A 3ZKRA 2W8GA 4UXUA 5CFBA 3TLWA 1UV6A 3TLVA 4ILBA 2Y7YA 3WTNA 4D01A 4PIRA 2WNJA 2WZYA 5HEUA 3U8MA 2XQAA 2XYTA 5L47A 4ZJTA 4QABA 4Z90A 5L4EA 5SYOA 5AINA 4HFHA 4UM1A 5AFLA 4WV9A 4HFBA 2XQ6A 4UM3A 3TLTA 4F8HA 5J0ZA 3UU3A 3U8JA 2BYNA 4ZZCA 5J5IA 2UZ6A 4COFA 5HEGA 4A98A 2XQ3A 4ZR6A 3WIPA 2XQ5A 2YN6A 1I9BA 3JADA 2QC1B 4EZ1A 2ZJVA 4TNWA 2XQ7A 4UY2A 4HFCA 3UU8A 3WTKA 4A97A 3RHWA 3PEOA 2XNUA 4BQTA 3RQWA 5JMEA 2WNCA 4IL9A 3U8LA 5AFMB 2YMEA 4DBMA 5BRXA 5J5HA 3U8KA 3UQ7A 2BYPA 3WTHA 5IUXA 2YMDA 4NPPA 4ILAA 3UU4A 3IGQA 3RI5A 2PH9A 2BYSA 3RQUA 3EI0A 3SIOA 2WN9A 5HCJA 3RIFA 4HFEA 3P4WA 4IREA 4QACA 3SH1A 4X5TA 2X00A 3LSVA 4AFGA 2W8FA 3EAMA 2C9TA 3GUAA 3RIAA 5HEJA 2XZ6A 4LMKA 1UW6A 3T4MA 2BJ0A 3C84A 4AFHA 5KZUA 2BG9C 1UX2A 2XQ8A 2XNVA 4QAAA 4XHEA 4HFIA 4ZRUA 3PMZA 5CO5A 3WTMA 4ZJSA 5AFKA 3JAEA 2BG9B 2Y57A 5AFMA 4LMLA 2XZ5A 4FRRA 2YKSA 2YOEA 2Y54A 3WTOA 4TWFA 3ZDGA 3UUBA 2BYQA 3U8NA 3WTIA 5KE4A 2XNTA 4TNVA 3SQ9A 4ILCA 3UU6A 5AFNA
chains in the Genus database with same CATH topology
5L4HA 3SQ6A 4ZK1A 4AFTA 2BYRA 2XQ9A 2XQ4A 3WTLA 4HFDA 4UM3S 4QH1A 5BW2A 4UM3P 2PGZA 2BG9E 5LG3A 4IL4A 5HEHA 2VL0A 4ZZBA 2BR7A 3EHZA 3JAFA 4QH5A 5AFJA 5J5FA 5LXBA 4TWHA 3TLSA 2WNLA 5J5GA 3TLUA 4TWDA 4ZK4A 4B5DA 3UQ4A 4QH4A 4LMJA 3P50A 2XYSA 2BG9A 5TVCA 3WTJA 5HEOA 3C79A 5HCMA 2ZJUA 2X00D 4HQPA 4NZBA 4Z91A 4XK9A 4BFQA 4ALXA 2Y56A 5FJVA 2BR8A 5AFHA 3ZDHA 3UU5A 5BP0A 2Y58A 3ZKRA 2W8GA 4UXUA 5CFBA 3TLWA 1UV6A 3TLVA 4ILBA 2Y7YA 3WTNA 4D01A 4PIRA 2WNJA 2WZYA 5HEUA 3U8MA 2XQAA 2XYTA 5L47A 4ZJTA 4QABA 4Z90A 5L4EA 5SYOA 5AINA 4HFHA 4UM1A 5AFLA 4WV9A 4HFBA 2XQ6A 4UM3A 3TLTA 4F8HA 5J0ZA 3UU3A 3U8JA 2BYNA 4ZZCA 5J5IA 2UZ6A 4COFA 5HEGA 4A98A 2XQ3A 4ZR6A 3WIPA 2XQ5A 2YN6A 1I9BA 3JADA 2QC1B 4EZ1A 2ZJVA 4TNWA 2XQ7A 4UY2A 4HFCA 3UU8A 3WTKA 4A97A 3RHWA 3PEOA 2XNUA 4BQTA 3RQWA 5JMEA 2WNCA 4IL9A 3U8LA 5AFMB 2YMEA 4DBMA 5BRXA 5J5HA 3U8KA 3UQ7A 2BYPA 3WTHA 5IUXA 2YMDA 4NPPA 4ILAA 3UU4A 3IGQA 3RI5A 2PH9A 2BYSA 3RQUA 3EI0A 3SIOA 2WN9A 5HCJA 3RIFA 4HFEA 3P4WA 4IREA 4QACA 3SH1A 4X5TA 2X00A 3LSVA 4AFGA 2W8FA 3EAMA 2C9TA 3GUAA 3RIAA 5HEJA 2XZ6A 4LMKA 1UW6A 3T4MA 2BJ0A 3C84A 4AFHA 5KZUA 2BG9C 1UX2A 2XQ8A 2XNVA 4QAAA 4XHEA 4HFIA 4ZRUA 3PMZA 5CO5A 3WTMA 4ZJSA 5AFKA 3JAEA 2BG9B 2Y57A 5AFMA 4LMLA 2XZ5A 4FRRA 2YKSA 2YOEA 2Y54A 3WTOA 4TWFA 3ZDGA 3UUBA 2BYQA 3U8NA 3WTIA 5KE4A 2XNTA 4TNVA 3SQ9A 4ILCA 3UU6A 5AFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L4H A;  3SQ6 A;  4ZK1 A;  4AFT A;  2BYR A;  2XQ9 A;  2XQ4 A;  3WTL A;  4HFD A;  4UM3 S;  4QH1 A;  5BW2 A;  4UM3 P;  2PGZ A;  2BG9 E;  5LG3 A;  4IL4 A;  5HEH A;  2VL0 A;  4ZZB A;  2BR7 A;  3EHZ A;  3JAF A;  4QH5 A;  5AFJ A;  5J5F A;  5LXB A;  4TWH A;  3TLS A;  2WNL A;  5J5G A;  3TLU A;  4TWD A;  4ZK4 A;  4B5D A;  3UQ4 A;  4QH4 A;  4LMJ A;  3P50 A;  2XYS A;  2BG9 A;  5TVC A;  3WTJ A;  5HEO A;  3C79 A;  5HCM A;  2ZJU A;  2X00 D;  4HQP A;  4NZB A;  4Z91 A;  4XK9 A;  4BFQ A;  4ALX A;  2Y56 A;  5FJV A;  2BR8 A;  5AFH A;  3ZDH A;  3UU5 A;  5BP0 A;  2Y58 A;  3ZKR A;  2W8G A;  4UXU A;  5CFB A;  3TLW A;  1UV6 A;  3TLV A;  4ILB A;  2Y7Y A;  3WTN A;  4D01 A;  4PIR A;  2WNJ A;  2WZY A;  5HEU A;  3U8M A;  2XQA A;  2XYT A;  5L47 A;  4ZJT A;  4QAB A;  4Z90 A;  5L4E A;  5SYO A;  5AIN A;  4HFH A;  4UM1 A;  5AFL A;  4WV9 A;  4HFB A;  2XQ6 A;  4UM3 A;  3TLT A;  4F8H A;  5J0Z A;  3UU3 A;  3U8J A;  2BYN A;  4ZZC A;  5J5I A;  2UZ6 A;  4COF A;  5HEG A;  4A98 A;  2XQ3 A;  4ZR6 A;  3WIP A;  2XQ5 A;  2YN6 A;  1I9B A;  3JAD A;  2QC1 B;  4EZ1 A;  2ZJV A;  4TNW A;  2XQ7 A;  4UY2 A;  4HFC A;  3UU8 A;  3WTK A;  4A97 A;  3RHW A;  3PEO A;  2XNU A;  4BQT A;  3RQW A;  5JME A;  2WNC A;  4IL9 A;  3U8L A;  5AFM B;  2YME A;  4DBM A;  5BRX A;  5J5H A;  3U8K A;  3UQ7 A;  2BYP A;  3WTH A;  5IUX A;  2YMD A;  4NPP A;  4ILA A;  3UU4 A;  3IGQ A;  3RI5 A;  2PH9 A;  2BYS A;  3RQU A;  3EI0 A;  3SIO A;  2WN9 A;  5HCJ A;  3RIF A;  4HFE A;  3P4W A;  4IRE A;  4QAC A;  3SH1 A;  4X5T A;  2X00 A;  3LSV A;  4AFG A;  2W8F A;  3EAM A;  2C9T A;  3GUA A;  3RIA A;  5HEJ A;  2XZ6 A;  4LMK A;  1UW6 A;  3T4M A;  2BJ0 A;  3C84 A;  4AFH A;  5KZU A;  2BG9 C;  1UX2 A;  2XQ8 A;  2XNV A;  4QAA A;  4XHE A;  4HFI A;  4ZRU A;  3PMZ A;  5CO5 A;  3WTM A;  4ZJS A;  5AFK A;  3JAE A;  2BG9 B;  2Y57 A;  5AFM A;  4LML A;  2XZ5 A;  4FRR A;  2YKS A;  2YOE A;  2Y54 A;  3WTO A;  4TWF A;  3ZDG A;  3UUB A;  2BYQ A;  3U8N A;  3WTI A;  5KE4 A;  2XNT A;  4TNV A;  3SQ9 A;  4ILC A;  3UU6 A;  5AFN A; 
#chains in the Genus database with same CATH topology
 5L4H A;  3SQ6 A;  4ZK1 A;  4AFT A;  2BYR A;  2XQ9 A;  2XQ4 A;  3WTL A;  4HFD A;  4UM3 S;  4QH1 A;  5BW2 A;  4UM3 P;  2PGZ A;  2BG9 E;  5LG3 A;  4IL4 A;  5HEH A;  2VL0 A;  4ZZB A;  2BR7 A;  3EHZ A;  3JAF A;  4QH5 A;  5AFJ A;  5J5F A;  5LXB A;  4TWH A;  3TLS A;  2WNL A;  5J5G A;  3TLU A;  4TWD A;  4ZK4 A;  4B5D A;  3UQ4 A;  4QH4 A;  4LMJ A;  3P50 A;  2XYS A;  2BG9 A;  5TVC A;  3WTJ A;  5HEO A;  3C79 A;  5HCM A;  2ZJU A;  2X00 D;  4HQP A;  4NZB A;  4Z91 A;  4XK9 A;  4BFQ A;  4ALX A;  2Y56 A;  5FJV A;  2BR8 A;  5AFH A;  3ZDH A;  3UU5 A;  5BP0 A;  2Y58 A;  3ZKR A;  2W8G A;  4UXU A;  5CFB A;  3TLW A;  1UV6 A;  3TLV A;  4ILB A;  2Y7Y A;  3WTN A;  4D01 A;  4PIR A;  2WNJ A;  2WZY A;  5HEU A;  3U8M A;  2XQA A;  2XYT A;  5L47 A;  4ZJT A;  4QAB A;  4Z90 A;  5L4E A;  5SYO A;  5AIN A;  4HFH A;  4UM1 A;  5AFL A;  4WV9 A;  4HFB A;  2XQ6 A;  4UM3 A;  3TLT A;  4F8H A;  5J0Z A;  3UU3 A;  3U8J A;  2BYN A;  4ZZC A;  5J5I A;  2UZ6 A;  4COF A;  5HEG A;  4A98 A;  2XQ3 A;  4ZR6 A;  3WIP A;  2XQ5 A;  2YN6 A;  1I9B A;  3JAD A;  2QC1 B;  4EZ1 A;  2ZJV A;  4TNW A;  2XQ7 A;  4UY2 A;  4HFC A;  3UU8 A;  3WTK A;  4A97 A;  3RHW A;  3PEO A;  2XNU A;  4BQT A;  3RQW A;  5JME A;  2WNC A;  4IL9 A;  3U8L A;  5AFM B;  2YME A;  4DBM A;  5BRX A;  5J5H A;  3U8K A;  3UQ7 A;  2BYP A;  3WTH A;  5IUX A;  2YMD A;  4NPP A;  4ILA A;  3UU4 A;  3IGQ A;  3RI5 A;  2PH9 A;  2BYS A;  3RQU A;  3EI0 A;  3SIO A;  2WN9 A;  5HCJ A;  3RIF A;  4HFE A;  3P4W A;  4IRE A;  4QAC A;  3SH1 A;  4X5T A;  2X00 A;  3LSV A;  4AFG A;  2W8F A;  3EAM A;  2C9T A;  3GUA A;  3RIA A;  5HEJ A;  2XZ6 A;  4LMK A;  1UW6 A;  3T4M A;  2BJ0 A;  3C84 A;  4AFH A;  5KZU A;  2BG9 C;  1UX2 A;  2XQ8 A;  2XNV A;  4QAA A;  4XHE A;  4HFI A;  4ZRU A;  3PMZ A;  5CO5 A;  3WTM A;  4ZJS A;  5AFK A;  3JAE A;  2BG9 B;  2Y57 A;  5AFM A;  4LML A;  2XZ5 A;  4FRR A;  2YKS A;  2YOE A;  2Y54 A;  3WTO A;  4TWF A;  3ZDG A;  3UUB A;  2BYQ A;  3U8N A;  3WTI A;  5KE4 A;  2XNT A;  4TNV A;  3SQ9 A;  4ILC A;  3UU6 A;  5AFN A; 
#chains in the Genus database with same CATH homology
 5L4H A;  3SQ6 A;  4ZK1 A;  4AFT A;  2BYR A;  2XQ9 A;  2XQ4 A;  3WTL A;  4HFD A;  4UM3 S;  4QH1 A;  5BW2 A;  4UM3 P;  2PGZ A;  2BG9 E;  5LG3 A;  4IL4 A;  5HEH A;  2VL0 A;  4ZZB A;  2BR7 A;  3EHZ A;  3JAF A;  4QH5 A;  5AFJ A;  5J5F A;  5LXB A;  4TWH A;  3TLS A;  2WNL A;  5J5G A;  3TLU A;  4TWD A;  4ZK4 A;  4B5D A;  3UQ4 A;  4QH4 A;  4LMJ A;  3P50 A;  2XYS A;  2BG9 A;  5TVC A;  3WTJ A;  5HEO A;  3C79 A;  5HCM A;  2ZJU A;  2X00 D;  4HQP A;  4NZB A;  4Z91 A;  4XK9 A;  4BFQ A;  4ALX A;  2Y56 A;  5FJV A;  2BR8 A;  5AFH A;  3ZDH A;  3UU5 A;  5BP0 A;  2Y58 A;  3ZKR A;  2W8G A;  4UXU A;  5CFB A;  3TLW A;  1UV6 A;  3TLV A;  4ILB A;  2Y7Y A;  3WTN A;  4D01 A;  4PIR A;  2WNJ A;  2WZY A;  5HEU A;  3U8M A;  2XQA A;  2XYT A;  5L47 A;  4ZJT A;  4QAB A;  4Z90 A;  5L4E A;  5SYO A;  5AIN A;  4HFH A;  4UM1 A;  5AFL A;  4WV9 A;  4HFB A;  2XQ6 A;  4UM3 A;  3TLT A;  4F8H A;  5J0Z A;  3UU3 A;  3U8J A;  2BYN A;  4ZZC A;  5J5I A;  2UZ6 A;  4COF A;  5HEG A;  4A98 A;  2XQ3 A;  4ZR6 A;  3WIP A;  2XQ5 A;  2YN6 A;  1I9B A;  3JAD A;  2QC1 B;  4EZ1 A;  2ZJV A;  4TNW A;  2XQ7 A;  4UY2 A;  4HFC A;  3UU8 A;  3WTK A;  4A97 A;  3RHW A;  3PEO A;  2XNU A;  4BQT A;  3RQW A;  5JME A;  2WNC A;  4IL9 A;  3U8L A;  5AFM B;  2YME A;  4DBM A;  5BRX A;  5J5H A;  3U8K A;  3UQ7 A;  2BYP A;  3WTH A;  5IUX A;  2YMD A;  4NPP A;  4ILA A;  3UU4 A;  3IGQ A;  3RI5 A;  2PH9 A;  2BYS A;  3RQU A;  3EI0 A;  3SIO A;  2WN9 A;  5HCJ A;  3RIF A;  4HFE A;  3P4W A;  4IRE A;  4QAC A;  3SH1 A;  4X5T A;  2X00 A;  3LSV A;  4AFG A;  2W8F A;  3EAM A;  2C9T A;  3GUA A;  3RIA A;  5HEJ A;  2XZ6 A;  4LMK A;  1UW6 A;  3T4M A;  2BJ0 A;  3C84 A;  4AFH A;  5KZU A;  2BG9 C;  1UX2 A;  2XQ8 A;  2XNV A;  4QAA A;  4XHE A;  4HFI A;  4ZRU A;  3PMZ A;  5CO5 A;  3WTM A;  4ZJS A;  5AFK A;  3JAE A;  2BG9 B;  2Y57 A;  5AFM A;  4LML A;  2XZ5 A;  4FRR A;  2YKS A;  2YOE A;  2Y54 A;  3WTO A;  4TWF A;  3ZDG A;  3UUB A;  2BYQ A;  3U8N A;  3WTI A;  5KE4 A;  2XNT A;  4TNV A;  3SQ9 A;  4ILC A;  3UU6 A;  5AFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...