3SQ9A

Crystal structures of the ligand binding domain of a pentameric alpha7 nicotinic receptor chimera
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
202
structure length
202
Chain Sequence
b'QRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuronal acetylcholine receptor subunit alpha-7, Acetylcholi
publication title Ligand-binding domain of an alpha 7-nicotinic receptor chimera and its complex with agonist.
pubmed doi rcsb
source organism Homo sapiens, lymnaea stagnalis
molecule tags Transport protein/receptor
total genus 38
structure length 202
sequence length 202
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3sq9A00
2YN6A 4NPPA 3EHZA 3RHWA 4ILCA 4DBMA 2X00A 2ZJVA 2XNUA 4LMKA 2XQ8A 2BYSA 3WIPA 5KE4A 5AFNA 2WNLA 4EZ1A 2YMEA 2BG9E 4AFTA 4BFQA 5L4EA 3WTOA 4HQPA 2Y54A 2PGZA 5AFMA 4AFGA 3IGQA 4ZZBA 2Y57A 3WTIA 4ZR6A 2WN9A 4TNVA 2Y58A 4LMLA 3U8LA 3TLUA 2BYQA 2XQ7A 3JAFA 5FJVA 5TVCA 3UUBA 4HFDA 2C9TA 3UQ4A 3WTMA 2WZYA 1I9BA 3WTNA 4Z91A 2W8GA 4ALXA 4LMJA 4UM3A 3WTLA 4TNWA 2WNCA 2VL0A 5BW2A 4F8HA 3SQ9A 4COFA 3C79A 3U8NA 3U8MA 4QH5A 4XK9A 2Y7YA 5KZUA 3WTKA 2XQ9A 3RIFA 4HFBA 5HEJA 4UXUA 3PMZA 3P50A 2XYSA 2BR7A 2YOEA 4QAAA 5HCMA 3TLSA 4PIRA 4A97A 4ZZCA 5AFLA 2BG9B 4UM3P 2BYPA 4AFHA 5BRXA 3P4WA 3TLVA 5J5IA 3UU5A 2ZJUA 2XQAA 3LSVA 4IL4A 5LG3A 2XQ6A 4WV9A 3GUAA 3UU6A 4IL9A 3ZKRA 4UM3S 5IUXA 3UU8A 3EAMA 1UW6A 3UU3A 3C84A 2BYNA 4QH1A 3EI0A 3JAEA 3WTJA 5L47A 5AINA 5BP0A 5AFHA 5HEHA 3ZDHA 4HFEA 3U8KA 1UV6A 4NZBA 4XHEA 4Z90A 4TWDA 5HEGA 4UM1A 5AFJA 3TLWA 2XNTA 2WNJA 2QC1B 2BYRA 2BR8A 2XQ3A 2BJ0A 4ILBA 4UY2A 4HFIA 4HFCA 2XQ5A 4D01A 3PEOA 3SQ6A 4X5TA 5HEUA 2W8FA 2X00D 4QH4A 4B5DA 5SYOA 2XZ5A 3RI5A 4IREA 3T4MA 1UX2A 2XZ6A 5AFMB 3RIAA 4ZRUA 2BG9A 5J5HA 5J5GA 4A98A 5J5FA 3SIOA 2Y56A 4ZK4A 3U8JA 5AFKA 5LXBA 5CFBA 5J0ZA 4BQTA 5L4HA 2XNVA 4ILAA 3RQUA 4QACA 3ZDGA 4HFHA 2XYTA 5CO5A 3TLTA 3UQ7A 2YMDA 5HCJA 3JADA 4TWFA 4ZJSA 5HEOA 3RQWA 2PH9A 4ZJTA 4ZK1A 4QABA 3UU4A 4FRRA 3WTHA 4TWHA 2YKSA 2UZ6A 2XQ4A 5JMEA 2BG9C 3SH1A
chains in the Genus database with same CATH superfamily
2YN6A 4NPPA 3EHZA 3RHWA 4ILCA 4DBMA 2X00A 2ZJVA 2XNUA 4LMKA 2XQ8A 2BYSA 3WIPA 5KE4A 5AFNA 2WNLA 4EZ1A 2YMEA 2BG9E 4AFTA 4BFQA 5L4EA 3WTOA 4HQPA 2Y54A 2PGZA 5AFMA 4AFGA 3IGQA 4ZZBA 2Y57A 3WTIA 4ZR6A 2WN9A 4TNVA 2Y58A 4LMLA 3U8LA 3TLUA 2BYQA 2XQ7A 3JAFA 5FJVA 5TVCA 3UUBA 4HFDA 2C9TA 3UQ4A 3WTMA 2WZYA 1I9BA 3WTNA 4Z91A 2W8GA 4ALXA 4LMJA 4UM3A 3WTLA 4TNWA 2WNCA 2VL0A 5BW2A 4F8HA 3SQ9A 4COFA 3C79A 3U8NA 3U8MA 4QH5A 4XK9A 2Y7YA 5KZUA 3WTKA 2XQ9A 3RIFA 4HFBA 5HEJA 4UXUA 3PMZA 3P50A 2XYSA 2BR7A 2YOEA 4QAAA 5HCMA 3TLSA 4PIRA 4A97A 4ZZCA 5AFLA 2BG9B 4UM3P 2BYPA 4AFHA 5BRXA 3P4WA 3TLVA 5J5IA 3UU5A 2ZJUA 2XQAA 3LSVA 4IL4A 5LG3A 2XQ6A 4WV9A 3GUAA 3UU6A 4IL9A 3ZKRA 4UM3S 5IUXA 3UU8A 3EAMA 1UW6A 3UU3A 3C84A 2BYNA 4QH1A 3EI0A 3JAEA 3WTJA 5L47A 5AINA 5BP0A 5AFHA 5HEHA 3ZDHA 4HFEA 3U8KA 1UV6A 4NZBA 4XHEA 4Z90A 4TWDA 5HEGA 4UM1A 5AFJA 3TLWA 2XNTA 2WNJA 2QC1B 2BYRA 2BR8A 2XQ3A 2BJ0A 4ILBA 4UY2A 4HFIA 4HFCA 2XQ5A 4D01A 3PEOA 3SQ6A 4X5TA 5HEUA 2W8FA 2X00D 4QH4A 4B5DA 5SYOA 2XZ5A 3RI5A 4IREA 3T4MA 1UX2A 2XZ6A 5AFMB 3RIAA 4ZRUA 2BG9A 5J5HA 5J5GA 4A98A 5J5FA 3SIOA 2Y56A 4ZK4A 3U8JA 5AFKA 5LXBA 5CFBA 5J0ZA 4BQTA 5L4HA 2XNVA 4ILAA 3RQUA 4QACA 3ZDGA 4HFHA 2XYTA 5CO5A 3TLTA 3UQ7A 2YMDA 5HCJA 3JADA 4TWFA 4ZJSA 5HEOA 3RQWA 2PH9A 4ZJTA 4ZK1A 4QABA 3UU4A 4FRRA 3WTHA 4TWHA 2YKSA 2UZ6A 2XQ4A 5JMEA 2BG9C 3SH1A
chains in the Genus database with same CATH topology
2YN6A 4NPPA 3EHZA 3RHWA 4ILCA 4DBMA 2X00A 2ZJVA 2XNUA 4LMKA 2XQ8A 2BYSA 3WIPA 5KE4A 5AFNA 2WNLA 4EZ1A 2YMEA 2BG9E 4AFTA 4BFQA 5L4EA 3WTOA 4HQPA 2Y54A 2PGZA 5AFMA 4AFGA 3IGQA 4ZZBA 2Y57A 3WTIA 4ZR6A 2WN9A 4TNVA 2Y58A 4LMLA 3U8LA 3TLUA 2BYQA 2XQ7A 3JAFA 5FJVA 5TVCA 3UUBA 4HFDA 2C9TA 3UQ4A 3WTMA 2WZYA 1I9BA 3WTNA 4Z91A 2W8GA 4ALXA 4LMJA 4UM3A 3WTLA 4TNWA 2WNCA 2VL0A 5BW2A 4F8HA 3SQ9A 4COFA 3C79A 3U8NA 3U8MA 4QH5A 4XK9A 2Y7YA 5KZUA 3WTKA 2XQ9A 3RIFA 4HFBA 5HEJA 4UXUA 3PMZA 3P50A 2XYSA 2BR7A 2YOEA 4QAAA 5HCMA 3TLSA 4PIRA 4A97A 4ZZCA 5AFLA 2BG9B 4UM3P 2BYPA 4AFHA 5BRXA 3P4WA 3TLVA 5J5IA 3UU5A 2ZJUA 2XQAA 3LSVA 4IL4A 5LG3A 2XQ6A 4WV9A 3GUAA 3UU6A 4IL9A 3ZKRA 4UM3S 5IUXA 3UU8A 3EAMA 1UW6A 3UU3A 3C84A 2BYNA 4QH1A 3EI0A 3JAEA 3WTJA 5L47A 5AINA 5BP0A 5AFHA 5HEHA 3ZDHA 4HFEA 3U8KA 1UV6A 4NZBA 4XHEA 4Z90A 4TWDA 5HEGA 4UM1A 5AFJA 3TLWA 2XNTA 2WNJA 2QC1B 2BYRA 2BR8A 2XQ3A 2BJ0A 4ILBA 4UY2A 4HFIA 4HFCA 2XQ5A 4D01A 3PEOA 3SQ6A 4X5TA 5HEUA 2W8FA 2X00D 4QH4A 4B5DA 5SYOA 2XZ5A 3RI5A 4IREA 3T4MA 1UX2A 2XZ6A 5AFMB 3RIAA 4ZRUA 2BG9A 5J5HA 5J5GA 4A98A 5J5FA 3SIOA 2Y56A 4ZK4A 3U8JA 5AFKA 5LXBA 5CFBA 5J0ZA 4BQTA 5L4HA 2XNVA 4ILAA 3RQUA 4QACA 3ZDGA 4HFHA 2XYTA 5CO5A 3TLTA 3UQ7A 2YMDA 5HCJA 3JADA 4TWFA 4ZJSA 5HEOA 3RQWA 2PH9A 4ZJTA 4ZK1A 4QABA 3UU4A 4FRRA 3WTHA 4TWHA 2YKSA 2UZ6A 2XQ4A 5JMEA 2BG9C 3SH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YN6 A;  4NPP A;  3EHZ A;  3RHW A;  4ILC A;  4DBM A;  2X00 A;  2ZJV A;  2XNU A;  4LMK A;  2XQ8 A;  2BYS A;  3WIP A;  5KE4 A;  5AFN A;  2WNL A;  4EZ1 A;  2YME A;  2BG9 E;  4AFT A;  4BFQ A;  5L4E A;  3WTO A;  4HQP A;  2Y54 A;  2PGZ A;  5AFM A;  4AFG A;  3IGQ A;  4ZZB A;  2Y57 A;  3WTI A;  4ZR6 A;  2WN9 A;  4TNV A;  2Y58 A;  4LML A;  3U8L A;  3TLU A;  2BYQ A;  2XQ7 A;  3JAF A;  5FJV A;  5TVC A;  3UUB A;  4HFD A;  2C9T A;  3UQ4 A;  3WTM A;  2WZY A;  1I9B A;  3WTN A;  4Z91 A;  2W8G A;  4ALX A;  4LMJ A;  4UM3 A;  3WTL A;  4TNW A;  2WNC A;  2VL0 A;  5BW2 A;  4F8H A;  3SQ9 A;  4COF A;  3C79 A;  3U8N A;  3U8M A;  4QH5 A;  4XK9 A;  2Y7Y A;  5KZU A;  3WTK A;  2XQ9 A;  3RIF A;  4HFB A;  5HEJ A;  4UXU A;  3PMZ A;  3P50 A;  2XYS A;  2BR7 A;  2YOE A;  4QAA A;  5HCM A;  3TLS A;  4PIR A;  4A97 A;  4ZZC A;  5AFL A;  2BG9 B;  4UM3 P;  2BYP A;  4AFH A;  5BRX A;  3P4W A;  3TLV A;  5J5I A;  3UU5 A;  2ZJU A;  2XQA A;  3LSV A;  4IL4 A;  5LG3 A;  2XQ6 A;  4WV9 A;  3GUA A;  3UU6 A;  4IL9 A;  3ZKR A;  4UM3 S;  5IUX A;  3UU8 A;  3EAM A;  1UW6 A;  3UU3 A;  3C84 A;  2BYN A;  4QH1 A;  3EI0 A;  3JAE A;  3WTJ A;  5L47 A;  5AIN A;  5BP0 A;  5AFH A;  5HEH A;  3ZDH A;  4HFE A;  3U8K A;  1UV6 A;  4NZB A;  4XHE A;  4Z90 A;  4TWD A;  5HEG A;  4UM1 A;  5AFJ A;  3TLW A;  2XNT A;  2WNJ A;  2QC1 B;  2BYR A;  2BR8 A;  2XQ3 A;  2BJ0 A;  4ILB A;  4UY2 A;  4HFI A;  4HFC A;  2XQ5 A;  4D01 A;  3PEO A;  3SQ6 A;  4X5T A;  5HEU A;  2W8F A;  2X00 D;  4QH4 A;  4B5D A;  5SYO A;  2XZ5 A;  3RI5 A;  4IRE A;  3T4M A;  1UX2 A;  2XZ6 A;  5AFM B;  3RIA A;  4ZRU A;  2BG9 A;  5J5H A;  5J5G A;  4A98 A;  5J5F A;  3SIO A;  2Y56 A;  4ZK4 A;  3U8J A;  5AFK A;  5LXB A;  5CFB A;  5J0Z A;  4BQT A;  5L4H A;  2XNV A;  4ILA A;  3RQU A;  4QAC A;  3ZDG A;  4HFH A;  2XYT A;  5CO5 A;  3TLT A;  3UQ7 A;  2YMD A;  5HCJ A;  3JAD A;  4TWF A;  4ZJS A;  5HEO A;  3RQW A;  2PH9 A;  4ZJT A;  4ZK1 A;  4QAB A;  3UU4 A;  4FRR A;  3WTH A;  4TWH A;  2YKS A;  2UZ6 A;  2XQ4 A;  5JME A;  2BG9 C;  3SH1 A; 
#chains in the Genus database with same CATH topology
 2YN6 A;  4NPP A;  3EHZ A;  3RHW A;  4ILC A;  4DBM A;  2X00 A;  2ZJV A;  2XNU A;  4LMK A;  2XQ8 A;  2BYS A;  3WIP A;  5KE4 A;  5AFN A;  2WNL A;  4EZ1 A;  2YME A;  2BG9 E;  4AFT A;  4BFQ A;  5L4E A;  3WTO A;  4HQP A;  2Y54 A;  2PGZ A;  5AFM A;  4AFG A;  3IGQ A;  4ZZB A;  2Y57 A;  3WTI A;  4ZR6 A;  2WN9 A;  4TNV A;  2Y58 A;  4LML A;  3U8L A;  3TLU A;  2BYQ A;  2XQ7 A;  3JAF A;  5FJV A;  5TVC A;  3UUB A;  4HFD A;  2C9T A;  3UQ4 A;  3WTM A;  2WZY A;  1I9B A;  3WTN A;  4Z91 A;  2W8G A;  4ALX A;  4LMJ A;  4UM3 A;  3WTL A;  4TNW A;  2WNC A;  2VL0 A;  5BW2 A;  4F8H A;  3SQ9 A;  4COF A;  3C79 A;  3U8N A;  3U8M A;  4QH5 A;  4XK9 A;  2Y7Y A;  5KZU A;  3WTK A;  2XQ9 A;  3RIF A;  4HFB A;  5HEJ A;  4UXU A;  3PMZ A;  3P50 A;  2XYS A;  2BR7 A;  2YOE A;  4QAA A;  5HCM A;  3TLS A;  4PIR A;  4A97 A;  4ZZC A;  5AFL A;  2BG9 B;  4UM3 P;  2BYP A;  4AFH A;  5BRX A;  3P4W A;  3TLV A;  5J5I A;  3UU5 A;  2ZJU A;  2XQA A;  3LSV A;  4IL4 A;  5LG3 A;  2XQ6 A;  4WV9 A;  3GUA A;  3UU6 A;  4IL9 A;  3ZKR A;  4UM3 S;  5IUX A;  3UU8 A;  3EAM A;  1UW6 A;  3UU3 A;  3C84 A;  2BYN A;  4QH1 A;  3EI0 A;  3JAE A;  3WTJ A;  5L47 A;  5AIN A;  5BP0 A;  5AFH A;  5HEH A;  3ZDH A;  4HFE A;  3U8K A;  1UV6 A;  4NZB A;  4XHE A;  4Z90 A;  4TWD A;  5HEG A;  4UM1 A;  5AFJ A;  3TLW A;  2XNT A;  2WNJ A;  2QC1 B;  2BYR A;  2BR8 A;  2XQ3 A;  2BJ0 A;  4ILB A;  4UY2 A;  4HFI A;  4HFC A;  2XQ5 A;  4D01 A;  3PEO A;  3SQ6 A;  4X5T A;  5HEU A;  2W8F A;  2X00 D;  4QH4 A;  4B5D A;  5SYO A;  2XZ5 A;  3RI5 A;  4IRE A;  3T4M A;  1UX2 A;  2XZ6 A;  5AFM B;  3RIA A;  4ZRU A;  2BG9 A;  5J5H A;  5J5G A;  4A98 A;  5J5F A;  3SIO A;  2Y56 A;  4ZK4 A;  3U8J A;  5AFK A;  5LXB A;  5CFB A;  5J0Z A;  4BQT A;  5L4H A;  2XNV A;  4ILA A;  3RQU A;  4QAC A;  3ZDG A;  4HFH A;  2XYT A;  5CO5 A;  3TLT A;  3UQ7 A;  2YMD A;  5HCJ A;  3JAD A;  4TWF A;  4ZJS A;  5HEO A;  3RQW A;  2PH9 A;  4ZJT A;  4ZK1 A;  4QAB A;  3UU4 A;  4FRR A;  3WTH A;  4TWH A;  2YKS A;  2UZ6 A;  2XQ4 A;  5JME A;  2BG9 C;  3SH1 A; 
#chains in the Genus database with same CATH homology
 2YN6 A;  4NPP A;  3EHZ A;  3RHW A;  4ILC A;  4DBM A;  2X00 A;  2ZJV A;  2XNU A;  4LMK A;  2XQ8 A;  2BYS A;  3WIP A;  5KE4 A;  5AFN A;  2WNL A;  4EZ1 A;  2YME A;  2BG9 E;  4AFT A;  4BFQ A;  5L4E A;  3WTO A;  4HQP A;  2Y54 A;  2PGZ A;  5AFM A;  4AFG A;  3IGQ A;  4ZZB A;  2Y57 A;  3WTI A;  4ZR6 A;  2WN9 A;  4TNV A;  2Y58 A;  4LML A;  3U8L A;  3TLU A;  2BYQ A;  2XQ7 A;  3JAF A;  5FJV A;  5TVC A;  3UUB A;  4HFD A;  2C9T A;  3UQ4 A;  3WTM A;  2WZY A;  1I9B A;  3WTN A;  4Z91 A;  2W8G A;  4ALX A;  4LMJ A;  4UM3 A;  3WTL A;  4TNW A;  2WNC A;  2VL0 A;  5BW2 A;  4F8H A;  3SQ9 A;  4COF A;  3C79 A;  3U8N A;  3U8M A;  4QH5 A;  4XK9 A;  2Y7Y A;  5KZU A;  3WTK A;  2XQ9 A;  3RIF A;  4HFB A;  5HEJ A;  4UXU A;  3PMZ A;  3P50 A;  2XYS A;  2BR7 A;  2YOE A;  4QAA A;  5HCM A;  3TLS A;  4PIR A;  4A97 A;  4ZZC A;  5AFL A;  2BG9 B;  4UM3 P;  2BYP A;  4AFH A;  5BRX A;  3P4W A;  3TLV A;  5J5I A;  3UU5 A;  2ZJU A;  2XQA A;  3LSV A;  4IL4 A;  5LG3 A;  2XQ6 A;  4WV9 A;  3GUA A;  3UU6 A;  4IL9 A;  3ZKR A;  4UM3 S;  5IUX A;  3UU8 A;  3EAM A;  1UW6 A;  3UU3 A;  3C84 A;  2BYN A;  4QH1 A;  3EI0 A;  3JAE A;  3WTJ A;  5L47 A;  5AIN A;  5BP0 A;  5AFH A;  5HEH A;  3ZDH A;  4HFE A;  3U8K A;  1UV6 A;  4NZB A;  4XHE A;  4Z90 A;  4TWD A;  5HEG A;  4UM1 A;  5AFJ A;  3TLW A;  2XNT A;  2WNJ A;  2QC1 B;  2BYR A;  2BR8 A;  2XQ3 A;  2BJ0 A;  4ILB A;  4UY2 A;  4HFI A;  4HFC A;  2XQ5 A;  4D01 A;  3PEO A;  3SQ6 A;  4X5T A;  5HEU A;  2W8F A;  2X00 D;  4QH4 A;  4B5D A;  5SYO A;  2XZ5 A;  3RI5 A;  4IRE A;  3T4M A;  1UX2 A;  2XZ6 A;  5AFM B;  3RIA A;  4ZRU A;  2BG9 A;  5J5H A;  5J5G A;  4A98 A;  5J5F A;  3SIO A;  2Y56 A;  4ZK4 A;  3U8J A;  5AFK A;  5LXB A;  5CFB A;  5J0Z A;  4BQT A;  5L4H A;  2XNV A;  4ILA A;  3RQU A;  4QAC A;  3ZDG A;  4HFH A;  2XYT A;  5CO5 A;  3TLT A;  3UQ7 A;  2YMD A;  5HCJ A;  3JAD A;  4TWF A;  4ZJS A;  5HEO A;  3RQW A;  2PH9 A;  4ZJT A;  4ZK1 A;  4QAB A;  3UU4 A;  4FRR A;  3WTH A;  4TWH A;  2YKS A;  2UZ6 A;  2XQ4 A;  5JME A;  2BG9 C;  3SH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...