3WTKA

Crystal structure of lymnaea stagnalis acetylcholine-binding protein q55r mutant complexed with thiacloprid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
208
structure length
208
Chain Sequence
AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQRTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Acetylcholine-binding protein
publication title Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 44
structure length 208
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wtkA00
3SIOA 3P4WA 3JADA 4F8HA 3RQUA 5AFKA 2VL0A 2BYRA 2XYTA 5HCMA 4IL9A 4ZJSA 3LSVA 4UM3A 5CFBA 2Y7YA 4HFHA 5J5HA 2YMEA 3WTIA 3EI0A 3TLVA 3U8LA 3RIFA 4TNWA 4HFIA 2XQ4A 5IUXA 3EAMA 4PIRA 1UX2A 3U8NA 4XHEA 2XQ9A 2UZ6A 2PH9A 4AFGA 2BG9C 5SYOA 4LMJA 4DBMA 4X5TA 2BR8A 2XNUA 4D01A 3JAFA 5KZUA 4ILCA 5FJVA 2XQAA 5AFMA 4HFEA 2XQ7A 3UU4A 3ZKRA 4UM3S 5TVCA 3RHWA 3SQ9A 3WTMA 4EZ1A 4NPPA 3WIPA 5HEOA 4QACA 2BG9A 4Z90A 3U8KA 4ZRUA 3UUBA 4COFA 5J0ZA 5J5IA 3PMZA 4NZBA 5HCJA 4QH5A 2PGZA 3RQWA 5LXBA 3C79A 3RI5A 3JAEA 5L4HA 3UU5A 5HEHA 4LMKA 4A98A 2WNJA 4A97A 5AFLA 5J5FA 5BW2A 3SQ6A 5LG3A 2Y57A 2XNVA 4QH4A 2X00A 2YMDA 3TLTA 5AFNA 2BYSA 4UXUA 3UU6A 2WNLA 4ILAA 3ZDGA 5AFHA 2XYSA 2XQ5A 4XK9A 5JMEA 3C84A 3U8JA 2WNCA 4ZJTA 5L4EA 4ALXA 2YOEA 2XNTA 4IREA 4UM1A 3SH1A 2XQ3A 3P50A 4ZK1A 2YN6A 4TWHA 3TLWA 5HEJA 2BYNA 4HFDA 2XQ6A 4QABA 4QH1A 2Y56A 3WTLA 2BG9E 5HEUA 4TNVA 2C9TA 2ZJUA 5HEGA 3WTHA 1UW6A 2XZ5A 2BJ0A 4HFBA 4B5DA 2BG9B 4UM3P 4AFTA 4QAAA 4BFQA 3UQ7A 3T4MA 3U8MA 4WV9A 3IGQA 4ZR6A 1UV6A 4TWDA 2W8GA 2YKSA 3WTNA 1I9BA 2XZ6A 2WN9A 2XQ8A 4HFCA 3ZDHA 2QC1B 4BQTA 3GUAA 4ZK4A 5KE4A 5BRXA 3RIAA 3WTOA 5L47A 2WZYA 2ZJVA 3UU3A 2Y54A 3TLSA 3UQ4A 5AINA 4ILBA 4AFHA 5AFMB 4FRRA 2X00D 2BYPA 3WTJA 5J5GA 4ZZBA 3TLUA 4HQPA 3UU8A 5AFJA 4Z91A 4TWFA 2BYQA 4IL4A 2W8FA 4UY2A 5CO5A 3PEOA 2Y58A 4LMLA 2BR7A 3WTKA 5BP0A 3EHZA 4ZZCA
chains in the Genus database with same CATH superfamily
3SIOA 3P4WA 3JADA 4F8HA 3RQUA 5AFKA 2VL0A 2BYRA 2XYTA 5HCMA 4IL9A 4ZJSA 3LSVA 4UM3A 5CFBA 2Y7YA 4HFHA 5J5HA 2YMEA 3WTIA 3EI0A 3TLVA 3U8LA 3RIFA 4TNWA 4HFIA 2XQ4A 5IUXA 3EAMA 4PIRA 1UX2A 3U8NA 4XHEA 2XQ9A 2UZ6A 2PH9A 4AFGA 2BG9C 5SYOA 4LMJA 4DBMA 4X5TA 2BR8A 2XNUA 4D01A 3JAFA 5KZUA 4ILCA 5FJVA 2XQAA 5AFMA 4HFEA 2XQ7A 3UU4A 3ZKRA 4UM3S 5TVCA 3RHWA 3SQ9A 3WTMA 4EZ1A 4NPPA 3WIPA 5HEOA 4QACA 2BG9A 4Z90A 3U8KA 4ZRUA 3UUBA 4COFA 5J0ZA 5J5IA 3PMZA 4NZBA 5HCJA 4QH5A 2PGZA 3RQWA 5LXBA 3C79A 3RI5A 3JAEA 5L4HA 3UU5A 5HEHA 4LMKA 4A98A 2WNJA 4A97A 5AFLA 5J5FA 5BW2A 3SQ6A 5LG3A 2Y57A 2XNVA 4QH4A 2X00A 2YMDA 3TLTA 5AFNA 2BYSA 4UXUA 3UU6A 2WNLA 4ILAA 3ZDGA 5AFHA 2XYSA 2XQ5A 4XK9A 5JMEA 3C84A 3U8JA 2WNCA 4ZJTA 5L4EA 4ALXA 2YOEA 2XNTA 4IREA 4UM1A 3SH1A 2XQ3A 3P50A 4ZK1A 2YN6A 4TWHA 3TLWA 5HEJA 2BYNA 4HFDA 2XQ6A 4QABA 4QH1A 2Y56A 3WTLA 2BG9E 5HEUA 4TNVA 2C9TA 2ZJUA 5HEGA 3WTHA 1UW6A 2XZ5A 2BJ0A 4HFBA 4B5DA 2BG9B 4UM3P 4AFTA 4QAAA 4BFQA 3UQ7A 3T4MA 3U8MA 4WV9A 3IGQA 4ZR6A 1UV6A 4TWDA 2W8GA 2YKSA 3WTNA 1I9BA 2XZ6A 2WN9A 2XQ8A 4HFCA 3ZDHA 2QC1B 4BQTA 3GUAA 4ZK4A 5KE4A 5BRXA 3RIAA 3WTOA 5L47A 2WZYA 2ZJVA 3UU3A 2Y54A 3TLSA 3UQ4A 5AINA 4ILBA 4AFHA 5AFMB 4FRRA 2X00D 2BYPA 3WTJA 5J5GA 4ZZBA 3TLUA 4HQPA 3UU8A 5AFJA 4Z91A 4TWFA 2BYQA 4IL4A 2W8FA 4UY2A 5CO5A 3PEOA 2Y58A 4LMLA 2BR7A 3WTKA 5BP0A 3EHZA 4ZZCA
chains in the Genus database with same CATH topology
3SIOA 3P4WA 3JADA 4F8HA 3RQUA 5AFKA 2VL0A 2BYRA 2XYTA 5HCMA 4IL9A 4ZJSA 3LSVA 4UM3A 5CFBA 2Y7YA 4HFHA 5J5HA 2YMEA 3WTIA 3EI0A 3TLVA 3U8LA 3RIFA 4TNWA 4HFIA 2XQ4A 5IUXA 3EAMA 4PIRA 1UX2A 3U8NA 4XHEA 2XQ9A 2UZ6A 2PH9A 4AFGA 2BG9C 5SYOA 4LMJA 4DBMA 4X5TA 2BR8A 2XNUA 4D01A 3JAFA 5KZUA 4ILCA 5FJVA 2XQAA 5AFMA 4HFEA 2XQ7A 3UU4A 3ZKRA 4UM3S 5TVCA 3RHWA 3SQ9A 3WTMA 4EZ1A 4NPPA 3WIPA 5HEOA 4QACA 2BG9A 4Z90A 3U8KA 4ZRUA 3UUBA 4COFA 5J0ZA 5J5IA 3PMZA 4NZBA 5HCJA 4QH5A 2PGZA 3RQWA 5LXBA 3C79A 3RI5A 3JAEA 5L4HA 3UU5A 5HEHA 4LMKA 4A98A 2WNJA 4A97A 5AFLA 5J5FA 5BW2A 3SQ6A 5LG3A 2Y57A 2XNVA 4QH4A 2X00A 2YMDA 3TLTA 5AFNA 2BYSA 4UXUA 3UU6A 2WNLA 4ILAA 3ZDGA 5AFHA 2XYSA 2XQ5A 4XK9A 5JMEA 3C84A 3U8JA 2WNCA 4ZJTA 5L4EA 4ALXA 2YOEA 2XNTA 4IREA 4UM1A 3SH1A 2XQ3A 3P50A 4ZK1A 2YN6A 4TWHA 3TLWA 5HEJA 2BYNA 4HFDA 2XQ6A 4QABA 4QH1A 2Y56A 3WTLA 2BG9E 5HEUA 4TNVA 2C9TA 2ZJUA 5HEGA 3WTHA 1UW6A 2XZ5A 2BJ0A 4HFBA 4B5DA 2BG9B 4UM3P 4AFTA 4QAAA 4BFQA 3UQ7A 3T4MA 3U8MA 4WV9A 3IGQA 4ZR6A 1UV6A 4TWDA 2W8GA 2YKSA 3WTNA 1I9BA 2XZ6A 2WN9A 2XQ8A 4HFCA 3ZDHA 2QC1B 4BQTA 3GUAA 4ZK4A 5KE4A 5BRXA 3RIAA 3WTOA 5L47A 2WZYA 2ZJVA 3UU3A 2Y54A 3TLSA 3UQ4A 5AINA 4ILBA 4AFHA 5AFMB 4FRRA 2X00D 2BYPA 3WTJA 5J5GA 4ZZBA 3TLUA 4HQPA 3UU8A 5AFJA 4Z91A 4TWFA 2BYQA 4IL4A 2W8FA 4UY2A 5CO5A 3PEOA 2Y58A 4LMLA 2BR7A 3WTKA 5BP0A 3EHZA 4ZZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIO A;  3P4W A;  3JAD A;  4F8H A;  3RQU A;  5AFK A;  2VL0 A;  2BYR A;  2XYT A;  5HCM A;  4IL9 A;  4ZJS A;  3LSV A;  4UM3 A;  5CFB A;  2Y7Y A;  4HFH A;  5J5H A;  2YME A;  3WTI A;  3EI0 A;  3TLV A;  3U8L A;  3RIF A;  4TNW A;  4HFI A;  2XQ4 A;  5IUX A;  3EAM A;  4PIR A;  1UX2 A;  3U8N A;  4XHE A;  2XQ9 A;  2UZ6 A;  2PH9 A;  4AFG A;  2BG9 C;  5SYO A;  4LMJ A;  4DBM A;  4X5T A;  2BR8 A;  2XNU A;  4D01 A;  3JAF A;  5KZU A;  4ILC A;  5FJV A;  2XQA A;  5AFM A;  4HFE A;  2XQ7 A;  3UU4 A;  3ZKR A;  4UM3 S;  5TVC A;  3RHW A;  3SQ9 A;  3WTM A;  4EZ1 A;  4NPP A;  3WIP A;  5HEO A;  4QAC A;  2BG9 A;  4Z90 A;  3U8K A;  4ZRU A;  3UUB A;  4COF A;  5J0Z A;  5J5I A;  3PMZ A;  4NZB A;  5HCJ A;  4QH5 A;  2PGZ A;  3RQW A;  5LXB A;  3C79 A;  3RI5 A;  3JAE A;  5L4H A;  3UU5 A;  5HEH A;  4LMK A;  4A98 A;  2WNJ A;  4A97 A;  5AFL A;  5J5F A;  5BW2 A;  3SQ6 A;  5LG3 A;  2Y57 A;  2XNV A;  4QH4 A;  2X00 A;  2YMD A;  3TLT A;  5AFN A;  2BYS A;  4UXU A;  3UU6 A;  2WNL A;  4ILA A;  3ZDG A;  5AFH A;  2XYS A;  2XQ5 A;  4XK9 A;  5JME A;  3C84 A;  3U8J A;  2WNC A;  4ZJT A;  5L4E A;  4ALX A;  2YOE A;  2XNT A;  4IRE A;  4UM1 A;  3SH1 A;  2XQ3 A;  3P50 A;  4ZK1 A;  2YN6 A;  4TWH A;  3TLW A;  5HEJ A;  2BYN A;  4HFD A;  2XQ6 A;  4QAB A;  4QH1 A;  2Y56 A;  3WTL A;  2BG9 E;  5HEU A;  4TNV A;  2C9T A;  2ZJU A;  5HEG A;  3WTH A;  1UW6 A;  2XZ5 A;  2BJ0 A;  4HFB A;  4B5D A;  2BG9 B;  4UM3 P;  4AFT A;  4QAA A;  4BFQ A;  3UQ7 A;  3T4M A;  3U8M A;  4WV9 A;  3IGQ A;  4ZR6 A;  1UV6 A;  4TWD A;  2W8G A;  2YKS A;  3WTN A;  1I9B A;  2XZ6 A;  2WN9 A;  2XQ8 A;  4HFC A;  3ZDH A;  2QC1 B;  4BQT A;  3GUA A;  4ZK4 A;  5KE4 A;  5BRX A;  3RIA A;  3WTO A;  5L47 A;  2WZY A;  2ZJV A;  3UU3 A;  2Y54 A;  3TLS A;  3UQ4 A;  5AIN A;  4ILB A;  4AFH A;  5AFM B;  4FRR A;  2X00 D;  2BYP A;  3WTJ A;  5J5G A;  4ZZB A;  3TLU A;  4HQP A;  3UU8 A;  5AFJ A;  4Z91 A;  4TWF A;  2BYQ A;  4IL4 A;  2W8F A;  4UY2 A;  5CO5 A;  3PEO A;  2Y58 A;  4LML A;  2BR7 A;  3WTK A;  5BP0 A;  3EHZ A;  4ZZC A; 
#chains in the Genus database with same CATH topology
 3SIO A;  3P4W A;  3JAD A;  4F8H A;  3RQU A;  5AFK A;  2VL0 A;  2BYR A;  2XYT A;  5HCM A;  4IL9 A;  4ZJS A;  3LSV A;  4UM3 A;  5CFB A;  2Y7Y A;  4HFH A;  5J5H A;  2YME A;  3WTI A;  3EI0 A;  3TLV A;  3U8L A;  3RIF A;  4TNW A;  4HFI A;  2XQ4 A;  5IUX A;  3EAM A;  4PIR A;  1UX2 A;  3U8N A;  4XHE A;  2XQ9 A;  2UZ6 A;  2PH9 A;  4AFG A;  2BG9 C;  5SYO A;  4LMJ A;  4DBM A;  4X5T A;  2BR8 A;  2XNU A;  4D01 A;  3JAF A;  5KZU A;  4ILC A;  5FJV A;  2XQA A;  5AFM A;  4HFE A;  2XQ7 A;  3UU4 A;  3ZKR A;  4UM3 S;  5TVC A;  3RHW A;  3SQ9 A;  3WTM A;  4EZ1 A;  4NPP A;  3WIP A;  5HEO A;  4QAC A;  2BG9 A;  4Z90 A;  3U8K A;  4ZRU A;  3UUB A;  4COF A;  5J0Z A;  5J5I A;  3PMZ A;  4NZB A;  5HCJ A;  4QH5 A;  2PGZ A;  3RQW A;  5LXB A;  3C79 A;  3RI5 A;  3JAE A;  5L4H A;  3UU5 A;  5HEH A;  4LMK A;  4A98 A;  2WNJ A;  4A97 A;  5AFL A;  5J5F A;  5BW2 A;  3SQ6 A;  5LG3 A;  2Y57 A;  2XNV A;  4QH4 A;  2X00 A;  2YMD A;  3TLT A;  5AFN A;  2BYS A;  4UXU A;  3UU6 A;  2WNL A;  4ILA A;  3ZDG A;  5AFH A;  2XYS A;  2XQ5 A;  4XK9 A;  5JME A;  3C84 A;  3U8J A;  2WNC A;  4ZJT A;  5L4E A;  4ALX A;  2YOE A;  2XNT A;  4IRE A;  4UM1 A;  3SH1 A;  2XQ3 A;  3P50 A;  4ZK1 A;  2YN6 A;  4TWH A;  3TLW A;  5HEJ A;  2BYN A;  4HFD A;  2XQ6 A;  4QAB A;  4QH1 A;  2Y56 A;  3WTL A;  2BG9 E;  5HEU A;  4TNV A;  2C9T A;  2ZJU A;  5HEG A;  3WTH A;  1UW6 A;  2XZ5 A;  2BJ0 A;  4HFB A;  4B5D A;  2BG9 B;  4UM3 P;  4AFT A;  4QAA A;  4BFQ A;  3UQ7 A;  3T4M A;  3U8M A;  4WV9 A;  3IGQ A;  4ZR6 A;  1UV6 A;  4TWD A;  2W8G A;  2YKS A;  3WTN A;  1I9B A;  2XZ6 A;  2WN9 A;  2XQ8 A;  4HFC A;  3ZDH A;  2QC1 B;  4BQT A;  3GUA A;  4ZK4 A;  5KE4 A;  5BRX A;  3RIA A;  3WTO A;  5L47 A;  2WZY A;  2ZJV A;  3UU3 A;  2Y54 A;  3TLS A;  3UQ4 A;  5AIN A;  4ILB A;  4AFH A;  5AFM B;  4FRR A;  2X00 D;  2BYP A;  3WTJ A;  5J5G A;  4ZZB A;  3TLU A;  4HQP A;  3UU8 A;  5AFJ A;  4Z91 A;  4TWF A;  2BYQ A;  4IL4 A;  2W8F A;  4UY2 A;  5CO5 A;  3PEO A;  2Y58 A;  4LML A;  2BR7 A;  3WTK A;  5BP0 A;  3EHZ A;  4ZZC A; 
#chains in the Genus database with same CATH homology
 3SIO A;  3P4W A;  3JAD A;  4F8H A;  3RQU A;  5AFK A;  2VL0 A;  2BYR A;  2XYT A;  5HCM A;  4IL9 A;  4ZJS A;  3LSV A;  4UM3 A;  5CFB A;  2Y7Y A;  4HFH A;  5J5H A;  2YME A;  3WTI A;  3EI0 A;  3TLV A;  3U8L A;  3RIF A;  4TNW A;  4HFI A;  2XQ4 A;  5IUX A;  3EAM A;  4PIR A;  1UX2 A;  3U8N A;  4XHE A;  2XQ9 A;  2UZ6 A;  2PH9 A;  4AFG A;  2BG9 C;  5SYO A;  4LMJ A;  4DBM A;  4X5T A;  2BR8 A;  2XNU A;  4D01 A;  3JAF A;  5KZU A;  4ILC A;  5FJV A;  2XQA A;  5AFM A;  4HFE A;  2XQ7 A;  3UU4 A;  3ZKR A;  4UM3 S;  5TVC A;  3RHW A;  3SQ9 A;  3WTM A;  4EZ1 A;  4NPP A;  3WIP A;  5HEO A;  4QAC A;  2BG9 A;  4Z90 A;  3U8K A;  4ZRU A;  3UUB A;  4COF A;  5J0Z A;  5J5I A;  3PMZ A;  4NZB A;  5HCJ A;  4QH5 A;  2PGZ A;  3RQW A;  5LXB A;  3C79 A;  3RI5 A;  3JAE A;  5L4H A;  3UU5 A;  5HEH A;  4LMK A;  4A98 A;  2WNJ A;  4A97 A;  5AFL A;  5J5F A;  5BW2 A;  3SQ6 A;  5LG3 A;  2Y57 A;  2XNV A;  4QH4 A;  2X00 A;  2YMD A;  3TLT A;  5AFN A;  2BYS A;  4UXU A;  3UU6 A;  2WNL A;  4ILA A;  3ZDG A;  5AFH A;  2XYS A;  2XQ5 A;  4XK9 A;  5JME A;  3C84 A;  3U8J A;  2WNC A;  4ZJT A;  5L4E A;  4ALX A;  2YOE A;  2XNT A;  4IRE A;  4UM1 A;  3SH1 A;  2XQ3 A;  3P50 A;  4ZK1 A;  2YN6 A;  4TWH A;  3TLW A;  5HEJ A;  2BYN A;  4HFD A;  2XQ6 A;  4QAB A;  4QH1 A;  2Y56 A;  3WTL A;  2BG9 E;  5HEU A;  4TNV A;  2C9T A;  2ZJU A;  5HEG A;  3WTH A;  1UW6 A;  2XZ5 A;  2BJ0 A;  4HFB A;  4B5D A;  2BG9 B;  4UM3 P;  4AFT A;  4QAA A;  4BFQ A;  3UQ7 A;  3T4M A;  3U8M A;  4WV9 A;  3IGQ A;  4ZR6 A;  1UV6 A;  4TWD A;  2W8G A;  2YKS A;  3WTN A;  1I9B A;  2XZ6 A;  2WN9 A;  2XQ8 A;  4HFC A;  3ZDH A;  2QC1 B;  4BQT A;  3GUA A;  4ZK4 A;  5KE4 A;  5BRX A;  3RIA A;  3WTO A;  5L47 A;  2WZY A;  2ZJV A;  3UU3 A;  2Y54 A;  3TLS A;  3UQ4 A;  5AIN A;  4ILB A;  4AFH A;  5AFM B;  4FRR A;  2X00 D;  2BYP A;  3WTJ A;  5J5G A;  4ZZB A;  3TLU A;  4HQP A;  3UU8 A;  5AFJ A;  4Z91 A;  4TWF A;  2BYQ A;  4IL4 A;  2W8F A;  4UY2 A;  5CO5 A;  3PEO A;  2Y58 A;  4LML A;  2BR7 A;  3WTK A;  5BP0 A;  3EHZ A;  4ZZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...