4ZZBA

The glic pentameric ligand-gated ion channel locally-closed form complexed to xenon
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural Basis for Xenon Inhibition in a Cationic Pentameric Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 8105
molecule tags Transport protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4zzbA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4zzbA01
5JMEA 4ILBA 2BYSA 2W8FA 3EAMA 2LM2A 3U8KA 2VL0A 4UM3A 5SYOA 5AFMA 4IL9A 2BYRA 1I9BA 4ZJSA 5HCJA 2XNTA 2XNVA 2BYNA 2YOEA 4Z91A 3RQUA 2BJ0A 2Y56A 3ZDGA 2BR7A 4TNVA 3C84A 4HFDA 3PMZA 4BFQA 2KSRA 3SQ9A 4A97A 2Y54A 5AFKA 5J5FA 4UXUA 4UM1A 3WTNA 4HFCA 4DBMA 4ZR6A 2LKHA 2WN9A 5TVCA 3WTJA 4ILAA 4IREA 2XYSA 3RIAA 5J5IA 3UU4A 5J5GA 4XHEA 3TLTA 2PGZA 3U8MA 4EZ1A 5HEJA 5J0ZA 2XNUA 5AFNA 3RIFA 4UY2A 4D01A 2C9TA 4HFEA 4PIRA 3UQ7A 4AFHA 5HEHA 2YMEA 3T4MA 5CFBA 3UU6A 2BG9B 3TLVA 2Y57A 3JAEA 4ZZCA 2XZ6A 4QABA 3TLUA 3EI0A 1OEDA 4ZZBA 5L4EA 5HEGA 2BYQA 3UQ4A 4UM3S 4ZRUA 2XQ5A 4TWHA 4HQPA 5HEUA 4ALXA 2M6IA 3IGQA 2PH9A 3JAFA 4A98A 4LMKA 4WV9A 3RQWA 5CO5A 2XZ5A 4ZK4A 1OEDB 5AFLA 3P50A 4NZBA 2BG9A 2WNLA 3PEOA 2YMDA 5BP0A 4COFA 2XQ3A 5AFJA 4QH1A 2W8GA 2XQ9A 3WTLA 2WNJA 4HFBA 1OEDC 3P4WA 2MAWA 1UX2A 2Y7YA 4AFTA 5AFHA 4TNWA 3TLWA 3TLSA 3ZDHA 4LMJA 4ILCA 3WTMA 4QACA 3U8NA 5L47A 1UV6A 4ZJTA 4NPPA 2M6BA 4IL4A 4X5TA 4XK9A 2BG9C 2UZ6A 5KE4A 4TWFA 2LLYA 5LG3A 3RHWA 5L4HA 5KZUA 5HCMA 4HFIA 3UU5A 5BRXA 3ZKRA 5IUXA 3UUBA 2ZJVA 2XQ6A 5BW2A 1UW6A 2BR8A 5J5HA 3WTOA 4UM3P 4AFGA 3U8LA 4ZK1A 3UU8A 3WTKA 2X00A 3JADA 2WNCA 2LKGA 2BYPA 4TWDA 3SIOA 4BQTA 4F8HA 5AINA 1OEDE 3GUAA 2ZJUA 2YKSA 4QH4A 2WZYA 3WIPA 3EHZA 2YN6A 3SH1A 4HFHA 2XQ8A 2XQAA 2QC1B 2XYTA 2XQ4A 5HEOA 3C79A 5FJVA 2X00D 2XQ7A 5AFMB 4LMLA 4QAAA 3RI5A 4QH5A 3WTHA 3SQ6A 4B5DA 2BG9E 3LSVA 3WTIA 2Y58A 3UU3A 5LXBA 4FRRA 4Z90A 3U8JA
chains in the Genus database with same CATH superfamily
3KV6A 1NAFA 1CUNA 2W62A 5AFMA 1HR0T 4GYSA 3RIUA 4LF9T 4HGAA 4TNVA 3P4QA 3PMZA 3O9XA 4DR4T 4H9PC 5LB7B 3WTNA 4HKAA 2ZM2A 2PBIA 4DV5T 3TLTA 2KZ7B 4UVCB 4P0AA 1X79A 4KHZF 3RYIE 5A1LA 4JLEA 5FKYA 3GMIA 4IDZA 5AQVB 5JDLA 2XZ6A 5LG4A 4MLKA 3TLUA 4CN4A 1IJ5A 3N9MA 2XQ5A 5L3FB 2M6IA 4PK6A 3CVRA 4AKLA 4ERRA 2MAWA 4UV8B 1W9RA 2ODVA 1BR1A 3VR8A 5HXSA 3U8NA 5IWAT 1V9DA 4ZJTA 2V1DB 2JMHA 4WYVA 3P4SA 4U2ZA 4ZS3A 4CN6A 5HCMA 5IUXA 1N33T 2ZJVA 5J5HA 2QA7A 2V5DA 3P4PA 2NOXA 3U8LA 3JC6D 4AKGA 3KV5A 1W0BA 3OPCA 3Q5XA 2X9XA 1OEDE 2X9WA 2XQ8A 1WR0A 3AEEA 5HEOA 2XSBA 4AQGA 5CJ5A 3Q2MA 4GK5E 3MZKB 3WTHA 2G0UA 1XMOT 4ASKA 3QB5A 4UR9A 3TKLB 3FZFB 2E9XA 5LP6E 1BR4A 5AQGB 2Q9QC 3BK9A 4EIWA 2E9XD 3ZCIA 4IGUA 4IE6A 3C98B 1WFDA 2D0UA 1OXZA 4H9RC 2MPKA 4ZR6A 2KXPB 2LRLA 4EZ1A 3ZSSA 2W61A 5ABEA 2EHOA 3CX6B 2N2NA 1D0ZA 2VQET 1ZOYA 3RYCE 5LJNA 2EHOD 2LJLA 2CE7A 4KX6A 4J2CA 4JI8T 1NWMX 2LM9A 2XZ5A 3CQCB 3PTRB 1VRBA 1HG2A 1G73A 5BP0A 3PUZF 4CZZB 2CHNA 4ZS2A 1UX2A 5AFHA 5JTGA 4DV3T 2VASA 2CWOA 4O2BE 4DUZT 1N32T 4X5TA 4YTNA 2LLYA 2WS3A 4IDNA 1JNRA 3KBUA 4UM3P 2XTLA 3VR9A 2LOSA 3RYHE 3GA8A 2YN6A 3BQIA 5FYMA 2LSJA 2BDEA 4B5DA 2YU2A 4M1PA 2FBWA 3KFWX 4IDQA 4EOZB 1MMNA 5HYAA 2CA5A 3RF1A 2PG8A 3U8KA 4DMWA 2VKJA 2ES0A 4WBNE 1J5ET 1S94A 3CPZA 4L0RA 4LF4T 2BR7A 4E7ZA 3EUHA 5J5FA 3FB2A 4GKKT 2X9YA 2ODUA 3SRZA 5CFBA 4ZZCA 4P1NA 3I1AA 4ZZBA 1XWMA 2YDQA 3FBZA 3FBLA 4LMKA 1IAPA 3P50A 1XMQT 3PEOA 3Q5WA 4XZCA 2C5KT 4UF0A 4UVBB 4DUYT 1MIYA 4X1KE 4ZI2D 2WMOA 5FVKA 2BG9C 2CLYB 2R6GF 2W4XA 3CMLA 3QUJA 3ZJ2A 2XQ6A 1UW6A 3SWHA 4IE7A 3UU8A 1QUUA 4NXNT 5BR8T 3N9OA 3ZMZB 3RPUA 3HL6A 2XM2A 3ZMTB 2Q9QA 2J4GA 3NKZA 3RGLA 2UUCT 2IMLA 2XUEA 3ABVA 2Q9QD 2CRBA 1XNRT 2NWBA 1XDOA 1LVFA 1OWAA 5FXXA 2QGSA 5SYOA 3UUMA 4IL9A 2DWGA 2C0SA 3ZYMA 3ETVA 1GQEA 4AIUA 4HFDA 2Y54A 1YD8G 4ANJA 2HPLA 4X66T 3I9WA 5FY0A 5AQHB 5J5GA 2PGZA 4G2AA 4P09A 3C4XA 2XSAA 2BBHA 3AXJB 5L3BB 4DR3T 2LOPA 5KXJA 3QOFA 3O1JA 5DQWA 3PURA 2CBIA 4AFTA 2PJQA 3MJXA 5AQTB 1J5WA 3N9LA 4QKNA 4WZXA 2XHEB 3AECA 4FJOA 4EEDA 2BZBA 1WYBA 2CLYC 4ISSA 5J1GA 5F5WA 4ZK1A 2UXCT 3ZCJA 4IE4A 5LYJE 3ZSTA 4DV6T 1IJ6A 4QH5A 3L3PA 1UURA 4EB6E 4HWCA 2Z6EA 2Y58A 2WWUA 2XY8B 5J2TE 2VL0A 1E1HB 2KWIB 2CEAA 3L39A 3NZQA 4O4LE 3ZT6A 5EK4A 4YJ2E 1HTJF 4EZ4A 4DBMA 1YKHB 2LKHA 5TVCA 3J9X1 3FZKB 5AFNA 3RIFA 2FJDA 2MBGA 2X67A 2XM1A 3JAEA 5AQFB 2LHNA 5FNVE 4LFBT 3K3NA 1MNDA 1ZKEA 2X66A 3AEBA 3KDSE 1E7PA 4U31A 4PNIA 2PH9A 4I50E 4JI0T 1SHZC 2BG9A 1XNQT 2XQ3A 4UXNB 4CI2B 3TLWA 3WTMA 1HX1B 2XAQB 4UV9B 3LG7A 2LSYA 3DP7A 4HWHA 2WDQA 2UXXB 5ABFB 2SPCA 2V6YB 3WTOA 3ZEFB 4AFGA 4ZHQE 3SIOA 4F8HA 3ONXA 2YINA 3WIPA 3SH1A 3CWZB 2A3DA 1FEWA 2LSKA 1WYCA 3PUSA 5FL1A 2LT3A 3PV0F 4L9IA 1IBMT 3OTOT 1FMVA 3LSVA 5JRCB 5LGUB 3UU3A 4JUYA 3I0OA 3HKEE 4AQYT 4UM3A 3FZLB 3AVRA 4DR6T 3WAJA 3HKBE 3CK6A 2CBJA 4C91A 4X65T 1J1JA 2KSRA 5LCYA 4UXUA 5LNKA 5J5IA 4P0BA 4QXCB 5JDNA 2E8IA 3VRBA 5HEHA 4BA9A 3QNUA 3LBXB 3P8CD 1U5PA 3EI0A 3QB5K 3MACA 3P7IA 2DNXA 4TV9E 2RP4A 4UM3S 4HQPA 3IGQA 2VURA 2BBJA 3ZC0A 1WLXA 1VCSA 1Z8UA 4JI7T 4NZBA 1D1AA 3KVBA 2XAFB 4CI1B 2L9QA 3NZPA 4I4TE 1M62A 3A7MA 4F6RC 2WB5A 1W0AA 4YFSA 1KEYA 2LSGA 3CX8B 3RHWA 5LHGB 2I59A 5CA1E 4PJLA 3AE1A 2XASB 3HI2A 3T1HT 5E0OA 4AKRB 4IDPA 4ZXLA 4I43B 3QK6A 3O1IA 4BQTA 5FY1A 3EHZA 2H89A 5DQVA 4H9SE 1HF8A 2XQAA 5LGTB 2KMFA 4DO0A 4H9OC 3CX7B 3P4RA 2UUAT 4ZI2C 1YW0A 3WTIA 2IIUA 1KNPA 4LF7T 4DMVA 2JPFA 3PE0A 1LKXA 4U72A 2XNVA 1ZP0A 3C4WA 5ABGA 3ZDGA 4U74A 4JEUB 4PK4A 4AQFC 3N2GE 1JNZA 2BKOA 2YU1A 2ZM8A 5AQRB 3WTJA 3AXJA 3UU4A 2Y8DA 4YY3T 4CXXA 4PJMA 4HFEA 4GYRA 1MIVA 5FP3A 2LSIA 2KWHA 2XZEA 3PDYA 1YKEB 3RRCA 5C8YE 3IA3A 4ZRUA 3UFGA 4TN7B 3LDQB 3UUXB 4WV9A 2FJAA 1D1CA 1Y64B 3EDUA 1BR0A 4U2YA 4COFA 3ZLIA 3AEAA 3WTLA 2Y7YA 3R84B 2X68A 2NW7A 3AE8A 3RH3A 5AQPB 4HE8A 1H7CA 1LRZA 2WDVA 2XQYA 4O2AE 4EV6A 5LG3A 2OA5A 1HCIA 2W0GA 1YQ3A 3UUNA 3AAAB 2VKOA 3KBTA 4B6XA 2HN2A 2DWKA 5FXVA 3OKQA 4QH4A 5LJMA 3EABA 3GWHA 4DR2T 1UX4A 1ZEEA 4HFVA 4AKHA 2H7VC 2QYWA 4GOUA 4QX7B 4YSXA 4UEMA 4EEBA 3Q5DA 4XBFB 2WAUA 2LM2A 2K3WA 2A2FX 1I9BA 3EVYA 4EAHA 3OBVE 1T8BA 4PFPA 2VK9A 3L09A 1IBKT 1MIWA 5F8PA 5KX5E 3RIAA 2XNUA 2N1GA 5HXRA 3A8YC 3UU6A 3OVUA 3AA6B 5AQIB 2E5LT 4QABA 4ZEYA 1ZHCA 2BYQA 3UQ4A 1SA0E 2YDRA 4EYUA 5HEUA 5HWYA 2M67A 3E22E 2UXNB 1HNXT 4LFCT 4JI6T 2A9UA 2YEVC 3WAKA 4YT0A 4DIDB 5AFJA 3MKDA 2LE8A 3BQKA 2VKHA 1IBLT 2WU5A 1UGOA 5HWXA 3ZJ1A 4TNWA 5ABFA 3LK3B 3ONJA 1BR2A 3V5UA 2V6YA 2FJBA 3FZHB 2AXDS 4TV8E 3MK7C 2X0HA 4XK9A 3N9NA 3KV4A 5KZUA 3K8PC 4NIQA 3E08A 2JQHA 5JR9B 3ANWA 2QRXA 5CGMA 5JRCA 3AEGA 3H3AA 3CQGB 2XQ7A 5AFMB 4HWFA 3HA4A 4AQFA 4PAGA 3E0ZA 2X0LB 1EZ3A 4DV4T 3RC3A 2W00A 4AISA 3PU8A 5EK2A 3OJAA 3ZPOA 4BFQA 3ESLA 2CCQA 4HFCA 3IBPA 2MOZA 2WN9A 1KFYA 1M7KA 5L3EB 2JIWA 1NENA 4PIRA 3IEEA 5ETWA 1O3XA 5L3DB 4QHOA 2Y57A 3I0QA 2H88A 4I55E 3M65A 3AE3A 5CO5A 1OEDB 5AFLA 2WNLA 2CMRA 4N78D 4QH1A 1T98A 3R6NA 2WNJA 2IDOB 4JI5T 5H6QB 3TLSA 3UTKA 2E5VA 3RKOA 4Q25A 2JQKA 3QC9A 3ONLC 5L4HA 5AQUB 4YTMA 4ZOLE 2K9AA 3IF8B 5LGNB 3B5MA 4PJJA 3H37A 3ZYKA 1IZNB 2PFVA 2LKGA 3WI3A 3AVSA 3LK2B 2ZJUA 3PJAJ 2XYTA 4K0UA 1L0VA 1QSDA 1HFAA 4LF6T 2HH7A 3SQ6A 4EGWA 1UX5A 2VKDA 2XAHB 3U8JA 5JMEA 4LFAT 4DV2T 2GK9A 2XAGB 3EAMA 2LEHA 2ZM6T 1WCRA 3VU7H 3ZMSB 2L8KA 5LOVE 4U7YA 4OK0A 3PUXF 4A97A 1MMDA 2W63A 1YQ4A 4YSZA 1QLBA 3ZC1A 4IDOA 3T4MA 5AQOB 3O4XE 1T72A 2X51A 1VOMA 2D9DA 1UUSA 2X0YA 3ZT7A 4LF5T 2WU2A 3N5LA 5IHYA 4ALXA 2K48A 2NW8A 3AE5A 4ZI3C 3GN5B 5JDQA 1T7SA 2XQ9A 2D5UA 1OEDC 4I0UA 1UK5A 4NXMT 2V26A 3LJCA 4QACA 3AE2A 5LMNT 4U7IA 4WNKA 3C50A 3PUWF 2IHR1 3PUVF 4TWFA 5BRXA 1US7B 4HN9A 1KK7A 3JADA 4MFRA 5L2LA 2YKSA 2VWAA 4HFHA 3AAEB 3KV9A 4X1YE 5FXWA 3ZN0B 3UFEA 2BG9E 2WM9A 4CI3B 3RKGA 5HXCA 4DBQA 4ILUA 4X64T 2W8FA 4PK5A 4OFZA 3SS1A 2BYRA 4JI4T 4GIWA 2YOEA 2BJ0A 2C5IT 3C84A 2L3LA 1KF6A 2JQ9A 4IE5A 2BVLA 3W15B 3ZMUB 3EDVA 4DR5T 5J2UE 3VHLA 2XYSA 4XHEA 4OHFA 5HEJA 4UY2A 2IC6A 3C51A 4KUMB 4B3MT 2WP9A 3PUAA 1W09A 2UU9T 3VKHA 3AA1B 1CHUA 2J1DG 2VB6A 1HNZT 3N2OA 4DV7T 4HTEA 2JQQA 2JMKA 2UUBT 5LBQB 4A98A 1I6ZA 3DTOA 4AI6A 1FIOA 4JI3T 4U3CA 4DR7T 2W8GA 1NEKA 3UULA 4B3ST 4EZHA 2DLRA 5AQNB 2IAKA 3MA9A 4OYJA 4B3TT 4EXTA 2CWYA 4PJNA 2V8SV 3K1SA 2UXBT 3PUGA 5BW2A 1FMWA 3PU3A 5JDGA 4BJNA 2X00A 4Z8XA 2NW9A 4WBOA 4TWDA 4DBRA 3B13A 4DVDA 1VCTA 4K0KT 2WZYA 4C90A 4G63A 5EZYE 2X00D 3RX6A 4MHCA 2NR4A 2J62A 4YLHA 3KINB 4JI2T 4ILBA 2DHRA 3NVOA 4KP3C 3U78A 4QXBB 5LBMA 2KLQA 4ZJSA 3LFMA 4JI1T 2XNTA 2BYNA 2CXFA 2Y56A 5LMUT 1KNRA 3AE9A 4UM1A 4IE0A 1UCUA 1MMAA 5J0ZA 4YSYA 3AE7A 3UQ7A 3BQLA 4AFHA 3RC8A 4JEHB 3L8RA 1LVKA 5KMGP 3TLVA 2ACXA 5AQSB 4DV1T 1OEDA 4ZI3D 2H7OA 2Y6XA 4TWHA 5FVLA 5KDMC 4DR1T 3JAFA 1HS7A 2MYSA 2N9DA 2AE9A 1YXRA 2KT9A 2YMDA 4QWNB 4CN1A 4HFBA 3P4WA 2RPAA 4YXDA 2W66A 2D0TA 4IL4A 2I0MA 5C3JA 2UZ6A 5KE4A 4O4HE 3ZMVB 2V7MA 5JDFA 3UUBA 2K24A 3U3IA 4CXWA 3WTKA 4MALA 3NRXA 2C5JA 2QC1B 5FJVA 3AB3B 2BS3A 3I9YA 2HN1A 3FXDB 4A5XA 5L3GB 3PJAA 5ABHA 2NTXA 1WR6A 4AXPA 5H6RB 4DNDA 3T8OA 2JRKA 5HCJA 5M4YA 3AA0B 3HKDE 2WZHA 4IIJE 2W2UA 3FHNA 2BKPA 2ZMAA 1X9BA 2C9TA 4KI0F 1E2AA 3AEDA 5LA6E 3K3QC 4NUUA 3RYFE 3X1DA 3VKGA 2BG9B 3A5XA 3GN5A 5L4EA 2Y48B 2FUPA 3CIRA 3UT5E 4ZK4A 4U33A 3T1YT 4TZ4C 2WCAA 3ZDHA 4ILCA 4H9NC 4OYKA 4AKIA 1UV6A 4NPPA 2MTQA 4FI5A 3C64A 4MBQA 5JVDE 5CA0E 4BJMA 2DCFA 3M3ZB 1HG5A 4HFIA 3UU5A 2CHOA 3F57A 5C2TA 4XAXB 1Z0PA 4HEAA 3GUAA 4PFOA 5L3CB 2ACZA 5JREA 3C79A 4LMLA 3LK42 1D0XA 5FL0A 2ZLYA 2CXDA 3NWIA 2VVNA 4L5GA 1N34T 2FJEA 2RA1A 4H63V 3Q9DA 4Z91A 5AQQB 2XJ7A 3OYZA 2BS2A 2P9BA 3SOLA 5AQLB 1HNWT 2WZIA 2LRKA 4HWIB 3U8MA 5LHIB 1D1BA 3V5SA 5F3JA 4QX8B 4X62T 2YMEA 3VRAA 5JH7E 2HPJA 1G8XA 4V1Av 5HEGA 3HKCE 2YK0A 2V7LA 2OLTA 5AQKB 3O1HA 3N2KE 1XZYA 1D0YA 2IUBA 3LBXA 1XDPA 2V7KA 4X1IE 2I6HA 4YJ3E 3HR0A 4LMJA 5AQJB 4HWDA 2BKNA 2WQYA 3JCFA 1S35A 1SUMB 2WY2A 2XAJB 1MNEA 4ADZA 2BR8A 4DV0T 5JDHA 5TAOA 5CB4E 2H3RA 2WNCA 2BYPA 2YDSA 5AINA 3KVAA 5IYZE 2KNDA 3H3MA 4E7SA 3DJBA 2XQ4A 2X9HA 1FJGT 3F31A 5DJQC 4IHJE 2V5CA 2VL8A 4TX5A 2A72A 4UVAB 3ZT5A 4QXHB 2F4VT 2E9XB 3SFEA 3NBXX 3RQUA 2D2SA 1Y01A 2BS4A 4GK0E 4O8SA 5JDMA 5JR9C 4IREA 2W67A 1KNZA 3CQXC 3MXZA 3G06A 3RIUC 3AA7B 4NUVA 4O4JE 4EYYR 2V7IA 2EHOB 3IHRA 3B57A 4JYAT 3PUQA 4KBMB 2QVAA 2B76A 4YHHT 2WMNA 2WWVA 3AEFA 4CXYA 4YHJA 5HXEA 4X20E 1U4QA 4LF8T 3N9QA 1SE7A 2J47A 2M6BA 2UXDT 3FZMB 2VQFT 2CPTA 3ZKRA 4TUYE 3AE4A 4B3RT 2VVSA 2IC9A 5LXTE 2B1EA 2DL1A 4YTPA 3FXEB 4UELA 3JC6C 3S4UA 2CXLA 4H63H 2BVMA 1ZV4X 4O4IE 4QAAA 2LHRA 4GKJT 3CKDA 4FRRA 4Z90A 4BAYB 3ZYLA 2BYSA 2NP9A 4ISTA 4H9QC 3RRWA 5FXZA 2WSSV 2HHHT 2PTFA 2WBLA 3NRYA 4A56A 5HXHA 3SQ9A 2OV9A 5AFKA 2E9XC 4CQIA 1B7TA 4ILAA 4D01A 3AE6A 5EK3A 4JV5T 2K5BB 2JJ9A 2IW5B 4OX9T 5JQGE 3J7Yq 1R8IA 4KHPT 1WRDA 1AJ3A 3RQWA 3ZN1B 1N36T 2EHOC 2V6XA 4ZI7E 3OYXA 3RLFF 4WW0A 5AQMB 5GONE 2E2AA 4PW8A 5FY7A 4JBWF 5FMNA 1HX8A 4UF0B 5L47A 3C4ZA 3F2EA 5DABA 4IT4A 3D0TA 3SFDA 3ANWB 3PUYF 5ADXL 1DU2A 2V7JA 2XPKA 1I94T 2WDRA 5LHHB 1MMGA 4KMCA 3K3OA 3N9PA 2ZM0A 3Q5EA 3ETUA 2NTYA 2CM0A 5AFUL 3AAIA 2DI4A 3RI5A 2KINB 2Q9QB 4UIGA 5BMVE 5HAXA 5LXBA 5JR9A
chains in the Genus database with same CATH topology
5JMEA 4ILBA 2BYSA 2W8FA 3EAMA 2LM2A 3U8KA 2VL0A 4UM3A 5SYOA 5AFMA 4IL9A 2BYRA 1I9BA 4ZJSA 5HCJA 2XNTA 2XNVA 2BYNA 2YOEA 4Z91A 3RQUA 2BJ0A 2Y56A 3ZDGA 2BR7A 4TNVA 3C84A 4HFDA 3PMZA 4BFQA 2KSRA 3SQ9A 4A97A 2Y54A 5AFKA 5J5FA 4UXUA 4UM1A 3WTNA 4HFCA 4DBMA 4ZR6A 2LKHA 2WN9A 5TVCA 3WTJA 4ILAA 4IREA 2XYSA 3RIAA 5J5IA 3UU4A 5J5GA 4XHEA 3TLTA 2PGZA 3U8MA 4EZ1A 5HEJA 5J0ZA 2XNUA 5AFNA 3RIFA 4UY2A 4D01A 2C9TA 4HFEA 4PIRA 3UQ7A 4AFHA 5HEHA 2YMEA 3T4MA 5CFBA 3UU6A 2BG9B 3TLVA 2Y57A 3JAEA 4ZZCA 2XZ6A 4QABA 3TLUA 3EI0A 1OEDA 4ZZBA 5L4EA 5HEGA 2BYQA 3UQ4A 4UM3S 4ZRUA 2XQ5A 4TWHA 4HQPA 5HEUA 4ALXA 2M6IA 3IGQA 2PH9A 3JAFA 4A98A 4LMKA 4WV9A 3RQWA 5CO5A 2XZ5A 4ZK4A 1OEDB 5AFLA 3P50A 4NZBA 2BG9A 2WNLA 3PEOA 2YMDA 5BP0A 4COFA 2XQ3A 5AFJA 4QH1A 2W8GA 2XQ9A 3WTLA 2WNJA 4HFBA 1OEDC 3P4WA 2MAWA 1UX2A 2Y7YA 4AFTA 5AFHA 4TNWA 3TLWA 3TLSA 3ZDHA 4LMJA 4ILCA 3WTMA 4QACA 3U8NA 5L47A 1UV6A 4ZJTA 4NPPA 2M6BA 4IL4A 4X5TA 4XK9A 2BG9C 2UZ6A 5KE4A 4TWFA 2LLYA 5LG3A 3RHWA 5L4HA 5KZUA 5HCMA 4HFIA 3UU5A 5BRXA 3ZKRA 5IUXA 3UUBA 2ZJVA 2XQ6A 5BW2A 1UW6A 2BR8A 5J5HA 3WTOA 4UM3P 4AFGA 3U8LA 4ZK1A 3UU8A 3WTKA 2X00A 3JADA 2WNCA 2LKGA 2BYPA 4TWDA 3SIOA 4BQTA 4F8HA 5AINA 1OEDE 3GUAA 2ZJUA 2YKSA 4QH4A 2WZYA 3WIPA 3EHZA 2YN6A 3SH1A 4HFHA 2XQ8A 2XQAA 2QC1B 2XYTA 2XQ4A 5HEOA 3C79A 5FJVA 2X00D 2XQ7A 5AFMB 4LMLA 4QAAA 3RI5A 4QH5A 3WTHA 3SQ6A 4B5DA 2BG9E 3LSVA 3WTIA 2Y58A 3UU3A 5LXBA 4FRRA 4Z90A 3U8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JME A;  4ILB A;  2BYS A;  2W8F A;  3EAM A;  2LM2 A;  3U8K A;  2VL0 A;  4UM3 A;  5SYO A;  5AFM A;  4IL9 A;  2BYR A;  1I9B A;  4ZJS A;  5HCJ A;  2XNT A;  2XNV A;  2BYN A;  2YOE A;  4Z91 A;  3RQU A;  2BJ0 A;  2Y56 A;  3ZDG A;  2BR7 A;  4TNV A;  3C84 A;  4HFD A;  3PMZ A;  4BFQ A;  2KSR A;  3SQ9 A;  4A97 A;  2Y54 A;  5AFK A;  5J5F A;  4UXU A;  4UM1 A;  3WTN A;  4HFC A;  4DBM A;  4ZR6 A;  2LKH A;  2WN9 A;  5TVC A;  3WTJ A;  4ILA A;  4IRE A;  2XYS A;  3RIA A;  5J5I A;  3UU4 A;  5J5G A;  4XHE A;  3TLT A;  2PGZ A;  3U8M A;  4EZ1 A;  5HEJ A;  5J0Z A;  2XNU A;  5AFN A;  3RIF A;  4UY2 A;  4D01 A;  2C9T A;  4HFE A;  4PIR A;  3UQ7 A;  4AFH A;  5HEH A;  2YME A;  3T4M A;  5CFB A;  3UU6 A;  2BG9 B;  3TLV A;  2Y57 A;  3JAE A;  4ZZC A;  2XZ6 A;  4QAB A;  3TLU A;  3EI0 A;  1OED A;  4ZZB A;  5L4E A;  5HEG A;  2BYQ A;  3UQ4 A;  4UM3 S;  4ZRU A;  2XQ5 A;  4TWH A;  4HQP A;  5HEU A;  4ALX A;  2M6I A;  3IGQ A;  2PH9 A;  3JAF A;  4A98 A;  4LMK A;  4WV9 A;  3RQW A;  5CO5 A;  2XZ5 A;  4ZK4 A;  1OED B;  5AFL A;  3P50 A;  4NZB A;  2BG9 A;  2WNL A;  3PEO A;  2YMD A;  5BP0 A;  4COF A;  2XQ3 A;  5AFJ A;  4QH1 A;  2W8G A;  2XQ9 A;  3WTL A;  2WNJ A;  4HFB A;  1OED C;  3P4W A;  2MAW A;  1UX2 A;  2Y7Y A;  4AFT A;  5AFH A;  4TNW A;  3TLW A;  3TLS A;  3ZDH A;  4LMJ A;  4ILC A;  3WTM A;  4QAC A;  3U8N A;  5L47 A;  1UV6 A;  4ZJT A;  4NPP A;  2M6B A;  4IL4 A;  4X5T A;  4XK9 A;  2BG9 C;  2UZ6 A;  5KE4 A;  4TWF A;  2LLY A;  5LG3 A;  3RHW A;  5L4H A;  5KZU A;  5HCM A;  4HFI A;  3UU5 A;  5BRX A;  3ZKR A;  5IUX A;  3UUB A;  2ZJV A;  2XQ6 A;  5BW2 A;  1UW6 A;  2BR8 A;  5J5H A;  3WTO A;  4UM3 P;  4AFG A;  3U8L A;  4ZK1 A;  3UU8 A;  3WTK A;  2X00 A;  3JAD A;  2WNC A;  2LKG A;  2BYP A;  4TWD A;  3SIO A;  4BQT A;  4F8H A;  5AIN A;  1OED E;  3GUA A;  2ZJU A;  2YKS A;  4QH4 A;  2WZY A;  3WIP A;  3EHZ A;  2YN6 A;  3SH1 A;  4HFH A;  2XQ8 A;  2XQA A;  2QC1 B;  2XYT A;  2XQ4 A;  5HEO A;  3C79 A;  5FJV A;  2X00 D;  2XQ7 A;  5AFM B;  4LML A;  4QAA A;  3RI5 A;  4QH5 A;  3WTH A;  3SQ6 A;  4B5D A;  2BG9 E;  3LSV A;  3WTI A;  2Y58 A;  3UU3 A;  5LXB A;  4FRR A;  4Z90 A;  3U8J A; 
#chains in the Genus database with same CATH topology
 3KV6 A;  1NAF A;  1CUN A;  2W62 A;  5AFM A;  1HR0 T;  4GYS A;  3RIU A;  4LF9 T;  4HGA A;  4TNV A;  3P4Q A;  3PMZ A;  3O9X A;  4DR4 T;  4H9P C;  5LB7 B;  3WTN A;  4HKA A;  2ZM2 A;  2PBI A;  4DV5 T;  3TLT A;  2KZ7 B;  4UVC B;  4P0A A;  1X79 A;  4KHZ F;  3RYI E;  5A1L A;  4JLE A;  5FKY A;  3GMI A;  4IDZ A;  5AQV B;  5JDL A;  2XZ6 A;  5LG4 A;  4MLK A;  3TLU A;  4CN4 A;  1IJ5 A;  3N9M A;  2XQ5 A;  5L3F B;  2M6I A;  4PK6 A;  3CVR A;  4AKL A;  4ERR A;  2MAW A;  4UV8 B;  1W9R A;  2ODV A;  1BR1 A;  3VR8 A;  5HXS A;  3U8N A;  5IWA T;  1V9D A;  4ZJT A;  2V1D B;  2JMH A;  4WYV A;  3P4S A;  4U2Z A;  4ZS3 A;  4CN6 A;  5HCM A;  5IUX A;  1N33 T;  2ZJV A;  5J5H A;  2QA7 A;  2V5D A;  3P4P A;  2NOX A;  3U8L A;  3JC6 D;  4AKG A;  3KV5 A;  1W0B A;  3OPC A;  3Q5X A;  2X9X A;  1OED E;  2X9W A;  2XQ8 A;  1WR0 A;  3AEE A;  5HEO A;  2XSB A;  4AQG A;  5CJ5 A;  3Q2M A;  4GK5 E;  3MZK B;  3WTH A;  2G0U A;  1XMO T;  4ASK A;  3QB5 A;  4UR9 A;  3TKL B;  3FZF B;  2E9X A;  5LP6 E;  1BR4 A;  5AQG B;  2Q9Q C;  3BK9 A;  4EIW A;  2E9X D;  3ZCI A;  4IGU A;  4IE6 A;  3C98 B;  1WFD A;  2D0U A;  1OXZ A;  4H9R C;  2MPK A;  4ZR6 A;  2KXP B;  2LRL A;  4EZ1 A;  3ZSS A;  2W61 A;  5ABE A;  2EHO A;  3CX6 B;  2N2N A;  1D0Z A;  2VQE T;  1ZOY A;  3RYC E;  5LJN A;  2EHO D;  2LJL A;  2CE7 A;  4KX6 A;  4J2C A;  4JI8 T;  1NWM X;  2LM9 A;  2XZ5 A;  3CQC B;  3PTR B;  1VRB A;  1HG2 A;  1G73 A;  5BP0 A;  3PUZ F;  4CZZ B;  2CHN A;  4ZS2 A;  1UX2 A;  5AFH A;  5JTG A;  4DV3 T;  2VAS A;  2CWO A;  4O2B E;  4DUZ T;  1N32 T;  4X5T A;  4YTN A;  2LLY A;  2WS3 A;  4IDN A;  1JNR A;  3KBU A;  4UM3 P;  2XTL A;  3VR9 A;  2LOS A;  3RYH E;  3GA8 A;  2YN6 A;  3BQI A;  5FYM A;  2LSJ A;  2BDE A;  4B5D A;  2YU2 A;  4M1P A;  2FBW A;  3KFW X;  4IDQ A;  4EOZ B;  1MMN A;  5HYA A;  2CA5 A;  3RF1 A;  2PG8 A;  3U8K A;  4DMW A;  2VKJ A;  2ES0 A;  4WBN E;  1J5E T;  1S94 A;  3CPZ A;  4L0R A;  4LF4 T;  2BR7 A;  4E7Z A;  3EUH A;  5J5F A;  3FB2 A;  4GKK T;  2X9Y A;  2ODU A;  3SRZ A;  5CFB A;  4ZZC A;  4P1N A;  3I1A A;  4ZZB A;  1XWM A;  2YDQ A;  3FBZ A;  3FBL A;  4LMK A;  1IAP A;  3P50 A;  1XMQ T;  3PEO A;  3Q5W A;  4XZC A;  2C5K T;  4UF0 A;  4UVB B;  4DUY T;  1MIY A;  4X1K E;  4ZI2 D;  2WMO A;  5FVK A;  2BG9 C;  2CLY B;  2R6G F;  2W4X A;  3CML A;  3QUJ A;  3ZJ2 A;  2XQ6 A;  1UW6 A;  3SWH A;  4IE7 A;  3UU8 A;  1QUU A;  4NXN T;  5BR8 T;  3N9O A;  3ZMZ B;  3RPU A;  3HL6 A;  2XM2 A;  3ZMT B;  2Q9Q A;  2J4G A;  3NKZ A;  3RGL A;  2UUC T;  2IML A;  2XUE A;  3ABV A;  2Q9Q D;  2CRB A;  1XNR T;  2NWB A;  1XDO A;  1LVF A;  1OWA A;  5FXX A;  2QGS A;  5SYO A;  3UUM A;  4IL9 A;  2DWG A;  2C0S A;  3ZYM A;  3ETV A;  1GQE A;  4AIU A;  4HFD A;  2Y54 A;  1YD8 G;  4ANJ A;  2HPL A;  4X66 T;  3I9W A;  5FY0 A;  5AQH B;  5J5G A;  2PGZ A;  4G2A A;  4P09 A;  3C4X A;  2XSA A;  2BBH A;  3AXJ B;  5L3B B;  4DR3 T;  2LOP A;  5KXJ A;  3QOF A;  3O1J A;  5DQW A;  3PUR A;  2CBI A;  4AFT A;  2PJQ A;  3MJX A;  5AQT B;  1J5W A;  3N9L A;  4QKN A;  4WZX A;  2XHE B;  3AEC A;  4FJO A;  4EED A;  2BZB A;  1WYB A;  2CLY C;  4ISS A;  5J1G A;  5F5W A;  4ZK1 A;  2UXC T;  3ZCJ A;  4IE4 A;  5LYJ E;  3ZST A;  4DV6 T;  1IJ6 A;  4QH5 A;  3L3P A;  1UUR A;  4EB6 E;  4HWC A;  2Z6E A;  2Y58 A;  2WWU A;  2XY8 B;  5J2T E;  2VL0 A;  1E1H B;  2KWI B;  2CEA A;  3L39 A;  3NZQ A;  4O4L E;  3ZT6 A;  5EK4 A;  4YJ2 E;  1HTJ F;  4EZ4 A;  4DBM A;  1YKH B;  2LKH A;  5TVC A;  3J9X 1;  3FZK B;  5AFN A;  3RIF A;  2FJD A;  2MBG A;  2X67 A;  2XM1 A;  3JAE A;  5AQF B;  2LHN A;  5FNV E;  4LFB T;  3K3N A;  1MND A;  1ZKE A;  2X66 A;  3AEB A;  3KDS E;  1E7P A;  4U31 A;  4PNI A;  2PH9 A;  4I50 E;  4JI0 T;  1SHZ C;  2BG9 A;  1XNQ T;  2XQ3 A;  4UXN B;  4CI2 B;  3TLW A;  3WTM A;  1HX1 B;  2XAQ B;  4UV9 B;  3LG7 A;  2LSY A;  3DP7 A;  4HWH A;  2WDQ A;  2UXX B;  5ABF B;  2SPC A;  2V6Y B;  3WTO A;  3ZEF B;  4AFG A;  4ZHQ E;  3SIO A;  4F8H A;  3ONX A;  2YIN A;  3WIP A;  3SH1 A;  3CWZ B;  2A3D A;  1FEW A;  2LSK A;  1WYC A;  3PUS A;  5FL1 A;  2LT3 A;  3PV0 F;  4L9I A;  1IBM T;  3OTO T;  1FMV A;  3LSV A;  5JRC B;  5LGU B;  3UU3 A;  4JUY A;  3I0O A;  3HKE E;  4AQY T;  4UM3 A;  3FZL B;  3AVR A;  4DR6 T;  3WAJ A;  3HKB E;  3CK6 A;  2CBJ A;  4C91 A;  4X65 T;  1J1J A;  2KSR A;  5LCY A;  4UXU A;  5LNK A;  5J5I A;  4P0B A;  4QXC B;  5JDN A;  2E8I A;  3VRB A;  5HEH A;  4BA9 A;  3QNU A;  3LBX B;  3P8C D;  1U5P A;  3EI0 A;  3QB5 K;  3MAC A;  3P7I A;  2DNX A;  4TV9 E;  2RP4 A;  4UM3 S;  4HQP A;  3IGQ A;  2VUR A;  2BBJ A;  3ZC0 A;  1WLX A;  1VCS A;  1Z8U A;  4JI7 T;  4NZB A;  1D1A A;  3KVB A;  2XAF B;  4CI1 B;  2L9Q A;  3NZP A;  4I4T E;  1M62 A;  3A7M A;  4F6R C;  2WB5 A;  1W0A A;  4YFS A;  1KEY A;  2LSG A;  3CX8 B;  3RHW A;  5LHG B;  2I59 A;  5CA1 E;  4PJL A;  3AE1 A;  2XAS B;  3HI2 A;  3T1H T;  5E0O A;  4AKR B;  4IDP A;  4ZXL A;  4I43 B;  3QK6 A;  3O1I A;  4BQT A;  5FY1 A;  3EHZ A;  2H89 A;  5DQV A;  4H9S E;  1HF8 A;  2XQA A;  5LGT B;  2KMF A;  4DO0 A;  4H9O C;  3CX7 B;  3P4R A;  2UUA T;  4ZI2 C;  1YW0 A;  3WTI A;  2IIU A;  1KNP A;  4LF7 T;  4DMV A;  2JPF A;  3PE0 A;  1LKX A;  4U72 A;  2XNV A;  1ZP0 A;  3C4W A;  5ABG A;  3ZDG A;  4U74 A;  4JEU B;  4PK4 A;  4AQF C;  3N2G E;  1JNZ A;  2BKO A;  2YU1 A;  2ZM8 A;  5AQR B;  3WTJ A;  3AXJ A;  3UU4 A;  2Y8D A;  4YY3 T;  4CXX A;  4PJM A;  4HFE A;  4GYR A;  1MIV A;  5FP3 A;  2LSI A;  2KWH A;  2XZE A;  3PDY A;  1YKE B;  3RRC A;  5C8Y E;  3IA3 A;  4ZRU A;  3UFG A;  4TN7 B;  3LDQ B;  3UUX B;  4WV9 A;  2FJA A;  1D1C A;  1Y64 B;  3EDU A;  1BR0 A;  4U2Y A;  4COF A;  3ZLI A;  3AEA A;  3WTL A;  2Y7Y A;  3R84 B;  2X68 A;  2NW7 A;  3AE8 A;  3RH3 A;  5AQP B;  4HE8 A;  1H7C A;  1LRZ A;  2WDV A;  2XQY A;  4O2A E;  4EV6 A;  5LG3 A;  2OA5 A;  1HCI A;  2W0G A;  1YQ3 A;  3UUN A;  3AAA B;  2VKO A;  3KBT A;  4B6X A;  2HN2 A;  2DWK A;  5FXV A;  3OKQ A;  4QH4 A;  5LJM A;  3EAB A;  3GWH A;  4DR2 T;  1UX4 A;  1ZEE A;  4HFV A;  4AKH A;  2H7V C;  2QYW A;  4GOU A;  4QX7 B;  4YSX A;  4UEM A;  4EEB A;  3Q5D A;  4XBF B;  2WAU A;  2LM2 A;  2K3W A;  2A2F X;  1I9B A;  3EVY A;  4EAH A;  3OBV E;  1T8B A;  4PFP A;  2VK9 A;  3L09 A;  1IBK T;  1MIW A;  5F8P A;  5KX5 E;  3RIA A;  2XNU A;  2N1G A;  5HXR A;  3A8Y C;  3UU6 A;  3OVU A;  3AA6 B;  5AQI B;  2E5L T;  4QAB A;  4ZEY A;  1ZHC A;  2BYQ A;  3UQ4 A;  1SA0 E;  2YDR A;  4EYU A;  5HEU A;  5HWY A;  2M67 A;  3E22 E;  2UXN B;  1HNX T;  4LFC T;  4JI6 T;  2A9U A;  2YEV C;  3WAK A;  4YT0 A;  4DID B;  5AFJ A;  3MKD A;  2LE8 A;  3BQK A;  2VKH A;  1IBL T;  2WU5 A;  1UGO A;  5HWX A;  3ZJ1 A;  4TNW A;  5ABF A;  3LK3 B;  3ONJ A;  1BR2 A;  3V5U A;  2V6Y A;  2FJB A;  3FZH B;  2AXD S;  4TV8 E;  3MK7 C;  2X0H A;  4XK9 A;  3N9N A;  3KV4 A;  5KZU A;  3K8P C;  4NIQ A;  3E08 A;  2JQH A;  5JR9 B;  3ANW A;  2QRX A;  5CGM A;  5JRC A;  3AEG A;  3H3A A;  3CQG B;  2XQ7 A;  5AFM B;  4HWF A;  3HA4 A;  4AQF A;  4PAG A;  3E0Z A;  2X0L B;  1EZ3 A;  4DV4 T;  3RC3 A;  2W00 A;  4AIS A;  3PU8 A;  5EK2 A;  3OJA A;  3ZPO A;  4BFQ A;  3ESL A;  2CCQ A;  4HFC A;  3IBP A;  2MOZ A;  2WN9 A;  1KFY A;  1M7K A;  5L3E B;  2JIW A;  1NEN A;  4PIR A;  3IEE A;  5ETW A;  1O3X A;  5L3D B;  4QHO A;  2Y57 A;  3I0Q A;  2H88 A;  4I55 E;  3M65 A;  3AE3 A;  5CO5 A;  1OED B;  5AFL A;  2WNL A;  2CMR A;  4N78 D;  4QH1 A;  1T98 A;  3R6N A;  2WNJ A;  2IDO B;  4JI5 T;  5H6Q B;  3TLS A;  3UTK A;  2E5V A;  3RKO A;  4Q25 A;  2JQK A;  3QC9 A;  3ONL C;  5L4H A;  5AQU B;  4YTM A;  4ZOL E;  2K9A A;  3IF8 B;  5LGN B;  3B5M A;  4PJJ A;  3H37 A;  3ZYK A;  1IZN B;  2PFV A;  2LKG A;  3WI3 A;  3AVS A;  3LK2 B;  2ZJU A;  3PJA J;  2XYT A;  4K0U A;  1L0V A;  1QSD A;  1HFA A;  4LF6 T;  2HH7 A;  3SQ6 A;  4EGW A;  1UX5 A;  2VKD A;  2XAH B;  3U8J A;  5JME A;  4LFA T;  4DV2 T;  2GK9 A;  2XAG B;  3EAM A;  2LEH A;  2ZM6 T;  1WCR A;  3VU7 H;  3ZMS B;  2L8K A;  5LOV E;  4U7Y A;  4OK0 A;  3PUX F;  4A97 A;  1MMD A;  2W63 A;  1YQ4 A;  4YSZ A;  1QLB A;  3ZC1 A;  4IDO A;  3T4M A;  5AQO B;  3O4X E;  1T72 A;  2X51 A;  1VOM A;  2D9D A;  1UUS A;  2X0Y A;  3ZT7 A;  4LF5 T;  2WU2 A;  3N5L A;  5IHY A;  4ALX A;  2K48 A;  2NW8 A;  3AE5 A;  4ZI3 C;  3GN5 B;  5JDQ A;  1T7S A;  2XQ9 A;  2D5U A;  1OED C;  4I0U A;  1UK5 A;  4NXM T;  2V26 A;  3LJC A;  4QAC A;  3AE2 A;  5LMN T;  4U7I A;  4WNK A;  3C50 A;  3PUW F;  2IHR 1;  3PUV F;  4TWF A;  5BRX A;  1US7 B;  4HN9 A;  1KK7 A;  3JAD A;  4MFR A;  5L2L A;  2YKS A;  2VWA A;  4HFH A;  3AAE B;  3KV9 A;  4X1Y E;  5FXW A;  3ZN0 B;  3UFE A;  2BG9 E;  2WM9 A;  4CI3 B;  3RKG A;  5HXC A;  4DBQ A;  4ILU A;  4X64 T;  2W8F A;  4PK5 A;  4OFZ A;  3SS1 A;  2BYR A;  4JI4 T;  4GIW A;  2YOE A;  2BJ0 A;  2C5I T;  3C84 A;  2L3L A;  1KF6 A;  2JQ9 A;  4IE5 A;  2BVL A;  3W15 B;  3ZMU B;  3EDV A;  4DR5 T;  5J2U E;  3VHL A;  2XYS A;  4XHE A;  4OHF A;  5HEJ A;  4UY2 A;  2IC6 A;  3C51 A;  4KUM B;  4B3M T;  2WP9 A;  3PUA A;  1W09 A;  2UU9 T;  3VKH A;  3AA1 B;  1CHU A;  2J1D G;  2VB6 A;  1HNZ T;  3N2O A;  4DV7 T;  4HTE A;  2JQQ A;  2JMK A;  2UUB T;  5LBQ B;  4A98 A;  1I6Z A;  3DTO A;  4AI6 A;  1FIO A;  4JI3 T;  4U3C A;  4DR7 T;  2W8G A;  1NEK A;  3UUL A;  4B3S T;  4EZH A;  2DLR A;  5AQN B;  2IAK A;  3MA9 A;  4OYJ A;  4B3T T;  4EXT A;  2CWY A;  4PJN A;  2V8S V;  3K1S A;  2UXB T;  3PUG A;  5BW2 A;  1FMW A;  3PU3 A;  5JDG A;  4BJN A;  2X00 A;  4Z8X A;  2NW9 A;  4WBO A;  4TWD A;  4DBR A;  3B13 A;  4DVD A;  1VCT A;  4K0K T;  2WZY A;  4C90 A;  4G63 A;  5EZY E;  2X00 D;  3RX6 A;  4MHC A;  2NR4 A;  2J62 A;  4YLH A;  3KIN B;  4JI2 T;  4ILB A;  2DHR A;  3NVO A;  4KP3 C;  3U78 A;  4QXB B;  5LBM A;  2KLQ A;  4ZJS A;  3LFM A;  4JI1 T;  2XNT A;  2BYN A;  2CXF A;  2Y56 A;  5LMU T;  1KNR A;  3AE9 A;  4UM1 A;  4IE0 A;  1UCU A;  1MMA A;  5J0Z A;  4YSY A;  3AE7 A;  3UQ7 A;  3BQL A;  4AFH A;  3RC8 A;  4JEH B;  3L8R A;  1LVK A;  5KMG P;  3TLV A;  2ACX A;  5AQS B;  4DV1 T;  1OED A;  4ZI3 D;  2H7O A;  2Y6X A;  4TWH A;  5FVL A;  5KDM C;  4DR1 T;  3JAF A;  1HS7 A;  2MYS A;  2N9D A;  2AE9 A;  1YXR A;  2KT9 A;  2YMD A;  4QWN B;  4CN1 A;  4HFB A;  3P4W A;  2RPA A;  4YXD A;  2W66 A;  2D0T A;  4IL4 A;  2I0M A;  5C3J A;  2UZ6 A;  5KE4 A;  4O4H E;  3ZMV B;  2V7M A;  5JDF A;  3UUB A;  2K24 A;  3U3I A;  4CXW A;  3WTK A;  4MAL A;  3NRX A;  2C5J A;  2QC1 B;  5FJV A;  3AB3 B;  2BS3 A;  3I9Y A;  2HN1 A;  3FXD B;  4A5X A;  5L3G B;  3PJA A;  5ABH A;  2NTX A;  1WR6 A;  4AXP A;  5H6R B;  4DND A;  3T8O A;  2JRK A;  5HCJ A;  5M4Y A;  3AA0 B;  3HKD E;  2WZH A;  4IIJ E;  2W2U A;  3FHN A;  2BKP A;  2ZMA A;  1X9B A;  2C9T A;  4KI0 F;  1E2A A;  3AED A;  5LA6 E;  3K3Q C;  4NUU A;  3RYF E;  3X1D A;  3VKG A;  2BG9 B;  3A5X A;  3GN5 A;  5L4E A;  2Y48 B;  2FUP A;  3CIR A;  3UT5 E;  4ZK4 A;  4U33 A;  3T1Y T;  4TZ4 C;  2WCA A;  3ZDH A;  4ILC A;  4H9N C;  4OYK A;  4AKI A;  1UV6 A;  4NPP A;  2MTQ A;  4FI5 A;  3C64 A;  4MBQ A;  5JVD E;  5CA0 E;  4BJM A;  2DCF A;  3M3Z B;  1HG5 A;  4HFI A;  3UU5 A;  2CHO A;  3F57 A;  5C2T A;  4XAX B;  1Z0P A;  4HEA A;  3GUA A;  4PFO A;  5L3C B;  2ACZ A;  5JRE A;  3C79 A;  4LML A;  3LK4 2;  1D0X A;  5FL0 A;  2ZLY A;  2CXD A;  3NWI A;  2VVN A;  4L5G A;  1N34 T;  2FJE A;  2RA1 A;  4H63 V;  3Q9D A;  4Z91 A;  5AQQ B;  2XJ7 A;  3OYZ A;  2BS2 A;  2P9B A;  3SOL A;  5AQL B;  1HNW T;  2WZI A;  2LRK A;  4HWI B;  3U8M A;  5LHI B;  1D1B A;  3V5S A;  5F3J A;  4QX8 B;  4X62 T;  2YME A;  3VRA A;  5JH7 E;  2HPJ A;  1G8X A;  4V1A v;  5HEG A;  3HKC E;  2YK0 A;  2V7L A;  2OLT A;  5AQK B;  3O1H A;  3N2K E;  1XZY A;  1D0Y A;  2IUB A;  3LBX A;  1XDP A;  2V7K A;  4X1I E;  2I6H A;  4YJ3 E;  3HR0 A;  4LMJ A;  5AQJ B;  4HWD A;  2BKN A;  2WQY A;  3JCF A;  1S35 A;  1SUM B;  2WY2 A;  2XAJ B;  1MNE A;  4ADZ A;  2BR8 A;  4DV0 T;  5JDH A;  5TAO A;  5CB4 E;  2H3R A;  2WNC A;  2BYP A;  2YDS A;  5AIN A;  3KVA A;  5IYZ E;  2KND A;  3H3M A;  4E7S A;  3DJB A;  2XQ4 A;  2X9H A;  1FJG T;  3F31 A;  5DJQ C;  4IHJ E;  2V5C A;  2VL8 A;  4TX5 A;  2A72 A;  4UVA B;  3ZT5 A;  4QXH B;  2F4V T;  2E9X B;  3SFE A;  3NBX X;  3RQU A;  2D2S A;  1Y01 A;  2BS4 A;  4GK0 E;  4O8S A;  5JDM A;  5JR9 C;  4IRE A;  2W67 A;  1KNZ A;  3CQX C;  3MXZ A;  3G06 A;  3RIU C;  3AA7 B;  4NUV A;  4O4J E;  4EYY R;  2V7I A;  2EHO B;  3IHR A;  3B57 A;  4JYA T;  3PUQ A;  4KBM B;  2QVA A;  2B76 A;  4YHH T;  2WMN A;  2WWV A;  3AEF A;  4CXY A;  4YHJ A;  5HXE A;  4X20 E;  1U4Q A;  4LF8 T;  3N9Q A;  1SE7 A;  2J47 A;  2M6B A;  2UXD T;  3FZM B;  2VQF T;  2CPT A;  3ZKR A;  4TUY E;  3AE4 A;  4B3R T;  2VVS A;  2IC9 A;  5LXT E;  2B1E A;  2DL1 A;  4YTP A;  3FXE B;  4UEL A;  3JC6 C;  3S4U A;  2CXL A;  4H63 H;  2BVM A;  1ZV4 X;  4O4I E;  4QAA A;  2LHR A;  4GKJ T;  3CKD A;  4FRR A;  4Z90 A;  4BAY B;  3ZYL A;  2BYS A;  2NP9 A;  4IST A;  4H9Q C;  3RRW A;  5FXZ A;  2WSS V;  2HHH T;  2PTF A;  2WBL A;  3NRY A;  4A56 A;  5HXH A;  3SQ9 A;  2OV9 A;  5AFK A;  2E9X C;  4CQI A;  1B7T A;  4ILA A;  4D01 A;  3AE6 A;  5EK3 A;  4JV5 T;  2K5B B;  2JJ9 A;  2IW5 B;  4OX9 T;  5JQG E;  3J7Y q;  1R8I A;  4KHP T;  1WRD A;  1AJ3 A;  3RQW A;  3ZN1 B;  1N36 T;  2EHO C;  2V6X A;  4ZI7 E;  3OYX A;  3RLF F;  4WW0 A;  5AQM B;  5GON E;  2E2A A;  4PW8 A;  5FY7 A;  4JBW F;  5FMN A;  1HX8 A;  4UF0 B;  5L47 A;  3C4Z A;  3F2E A;  5DAB A;  4IT4 A;  3D0T A;  3SFD A;  3ANW B;  3PUY F;  5ADX L;  1DU2 A;  2V7J A;  2XPK A;  1I94 T;  2WDR A;  5LHH B;  1MMG A;  4KMC A;  3K3O A;  3N9P A;  2ZM0 A;  3Q5E A;  3ETU A;  2NTY A;  2CM0 A;  5AFU L;  3AAI A;  2DI4 A;  3RI5 A;  2KIN B;  2Q9Q B;  4UIG A;  5BMV E;  5HAX A;  5LXB A;  5JR9 A; 
#chains in the Genus database with same CATH homology
 5JME A;  4ILB A;  2BYS A;  2W8F A;  3EAM A;  2LM2 A;  3U8K A;  2VL0 A;  4UM3 A;  5SYO A;  5AFM A;  4IL9 A;  2BYR A;  1I9B A;  4ZJS A;  5HCJ A;  2XNT A;  2XNV A;  2BYN A;  2YOE A;  4Z91 A;  3RQU A;  2BJ0 A;  2Y56 A;  3ZDG A;  2BR7 A;  4TNV A;  3C84 A;  4HFD A;  3PMZ A;  4BFQ A;  2KSR A;  3SQ9 A;  4A97 A;  2Y54 A;  5AFK A;  5J5F A;  4UXU A;  4UM1 A;  3WTN A;  4HFC A;  4DBM A;  4ZR6 A;  2LKH A;  2WN9 A;  5TVC A;  3WTJ A;  4ILA A;  4IRE A;  2XYS A;  3RIA A;  5J5I A;  3UU4 A;  5J5G A;  4XHE A;  3TLT A;  2PGZ A;  3U8M A;  4EZ1 A;  5HEJ A;  5J0Z A;  2XNU A;  5AFN A;  3RIF A;  4UY2 A;  4D01 A;  2C9T A;  4HFE A;  4PIR A;  3UQ7 A;  4AFH A;  5HEH A;  2YME A;  3T4M A;  5CFB A;  3UU6 A;  2BG9 B;  3TLV A;  2Y57 A;  3JAE A;  4ZZC A;  2XZ6 A;  4QAB A;  3TLU A;  3EI0 A;  1OED A;  4ZZB A;  5L4E A;  5HEG A;  2BYQ A;  3UQ4 A;  4UM3 S;  4ZRU A;  2XQ5 A;  4TWH A;  4HQP A;  5HEU A;  4ALX A;  2M6I A;  3IGQ A;  2PH9 A;  3JAF A;  4A98 A;  4LMK A;  4WV9 A;  3RQW A;  5CO5 A;  2XZ5 A;  4ZK4 A;  1OED B;  5AFL A;  3P50 A;  4NZB A;  2BG9 A;  2WNL A;  3PEO A;  2YMD A;  5BP0 A;  4COF A;  2XQ3 A;  5AFJ A;  4QH1 A;  2W8G A;  2XQ9 A;  3WTL A;  2WNJ A;  4HFB A;  1OED C;  3P4W A;  2MAW A;  1UX2 A;  2Y7Y A;  4AFT A;  5AFH A;  4TNW A;  3TLW A;  3TLS A;  3ZDH A;  4LMJ A;  4ILC A;  3WTM A;  4QAC A;  3U8N A;  5L47 A;  1UV6 A;  4ZJT A;  4NPP A;  2M6B A;  4IL4 A;  4X5T A;  4XK9 A;  2BG9 C;  2UZ6 A;  5KE4 A;  4TWF A;  2LLY A;  5LG3 A;  3RHW A;  5L4H A;  5KZU A;  5HCM A;  4HFI A;  3UU5 A;  5BRX A;  3ZKR A;  5IUX A;  3UUB A;  2ZJV A;  2XQ6 A;  5BW2 A;  1UW6 A;  2BR8 A;  5J5H A;  3WTO A;  4UM3 P;  4AFG A;  3U8L A;  4ZK1 A;  3UU8 A;  3WTK A;  2X00 A;  3JAD A;  2WNC A;  2LKG A;  2BYP A;  4TWD A;  3SIO A;  4BQT A;  4F8H A;  5AIN A;  1OED E;  3GUA A;  2ZJU A;  2YKS A;  4QH4 A;  2WZY A;  3WIP A;  3EHZ A;  2YN6 A;  3SH1 A;  4HFH A;  2XQ8 A;  2XQA A;  2QC1 B;  2XYT A;  2XQ4 A;  5HEO A;  3C79 A;  5FJV A;  2X00 D;  2XQ7 A;  5AFM B;  4LML A;  4QAA A;  3RI5 A;  4QH5 A;  3WTH A;  3SQ6 A;  4B5D A;  2BG9 E;  3LSV A;  3WTI A;  2Y58 A;  3UU3 A;  5LXB A;  4FRR A;  4Z90 A;  3U8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...