4ZZBA

The glic pentameric ligand-gated ion channel locally-closed form complexed to xenon
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Proton-gated ion channel
publication title Structural Basis for Xenon Inhibition in a Cationic Pentameric Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 8105
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4zzbA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4zzbA01
2Y56A 4D01A 4AFGA 4HFIA 4Z90A 5L4EA 2LKHA 2M6BA 4XHEA 4ZZBA 3UU3A 3UQ7A 1OEDE 4ALXA 3WTIA 4HQPA 2PH9A 2ZJUA 5HEGA 1I9BA 2XNVA 3LSVA 2YMDA 3WTJA 2XNUA 2WN9A 4B5DA 4UY2A 5AINA 4COFA 5AFKA 2LM2A 4HFEA 1UX2A 5CO5A 2YKSA 3UU6A 3WTMA 3SH1A 2XQ7A 2XQAA 5J5IA 1OEDC 5AFMA 3SIOA 2WNLA 5AFNA 3UUBA 4QAAA 2LKGA 2Y7YA 3U8NA 5BRXA 2LLYA 4QH5A 2BYSA 4UM1A 5AFMB 4UM3S 2XZ5A 2X00D 5AFJA 3WIPA 4LMJA 3EHZA 3JAEA 2BR7A 2BR8A 3U8MA 4UXUA 3IGQA 3WTLA 3SQ9A 2WZYA 4ZJTA 2BJ0A 5HEUA 5L4HA 2Y54A 5HEOA 3SQ6A 3U8KA 4BFQA 3RHWA 3RQUA 5J5HA 3TLWA 4IREA 2XZ6A 4X5TA 3TLVA 2XQ6A 1UW6A 3WTHA 4TNWA 3JADA 3UQ4A 4NZBA 2XQ4A 4ILCA 4ZR6A 2M6IA 4ZJSA 5KE4A 5KZUA 2BG9A 3ZDHA 2Y58A 2YOEA 5J5FA 5L47A 2PGZA 3C79A 4QABA 5IUXA 5HEJA 4TWDA 2KSRA 4QH4A 2WNCA 3C84A 2UZ6A 3GUAA 4HFBA 3UU4A 4IL9A 3RIFA 4A97A 3RI5A 5J0ZA 2XYSA 4PIRA 3P50A 4AFHA 4Z91A 5LXBA 5HEHA 4FRRA 3P4WA 4LMLA 2VL0A 3TLUA 2C9TA 2ZJVA 5SYOA 2W8GA 3TLTA 4ZZCA 3PEOA 1UV6A 4UM3P 3ZDGA 2BYPA 3ZKRA 2BYQA 4BQTA 2MAWA 3WTOA 2YMEA 4TWFA 5HCMA 2WNJA 5FJVA 2XQ3A 3JAFA 4TNVA 2W8FA 3UU5A 2XQ9A 3TLSA 3WTKA 4F8HA 3PMZA 5LG3A 5BW2A 4HFCA 2BG9B 4ZRUA 3UU8A 4QACA 3U8JA 5CFBA 3EI0A 3RIAA 2XYTA 5TVCA 2BG9C 3T4MA 4ILBA 2QC1B 4UM3A 4DBMA 5BP0A 4WV9A 4ILAA 1OEDA 4EZ1A 2BYRA 2YN6A 4IL4A 2X00A 5AFHA 4AFTA 1OEDB 4NPPA 4TWHA 5JMEA 3WTNA 3RQWA 2XQ5A 3U8LA 4HFHA 4A98A 4HFDA 4ZK1A 2XQ8A 4ZK4A 5AFLA 4XK9A 2BYNA 4QH1A 3EAMA 5HCJA 2BG9E 2Y57A 4LMKA 2XNTA 5J5GA
chains in the Genus database with same CATH superfamily
3RC8A 2XSBA 4O4IE 4XHEA 1R8IA 3QK6A 4DIDB 3X1DA 2K3WA 2ODVA 3PUVF 2IIUA 4UY2A 5AQRB 5HWXA 3FZFB 2V5CA 5JDHA 3L8RA 3BQKA 4U31A 3RKOA 4TN7B 2KWHA 3HKCE 1KF6A 4HN9A 3P8CD 5J2TE 2UXCT 2UXDT 2V26A 2BJ0A 2Y54A 2DHRA 3LG7A 2XAJB 3L09A 4JI4T 4UR9A 4DV5T 4NZBA 4ZR6A 2M6IA 5JDFA 2PGZA 3ONLC 1AJ3A 1WLXA 1LVFA 3HKEE 5J0ZA 1EZ3A 3F2EA 3SWHA 2V6YA 2L9QA 3C51A 4E7SA 1Z8UA 4EEBA 2XQ3A 5L2LA 1D1BA 4YJ3E 5HXEA 5AFHA 2V6YB 1XZYA 2YEVC 2VQFT 4DV0T 4I4TE 4O4HE 2BZBA 4UVCB 4U2ZA 3FZKB 5J5GA 4DVDA 2A2FX 2M67A 1DU2A 1KK7A 3NBXX 1BR1A 4XZCA 1OEDE 4P0AA 3ZT5A 1KEYA 4ZXLA 4AIUA 4HEAA 1XDPA 4JI3T 4CI3B 4GKJT 1HNWT 3SRZA 2X67A 3N9LA 3Q5WA 5J5IA 5FY7A 1MIVA 5C8YE 4QAAA 1E1HB 2A9UA 3R84B 2FJBA 4IDZA 2X00D 1MNDA 3WIPA 3JAEA 2CXLA 4I55E 5M4YA 3I1AA 4HFVA 4ANJA 5KX5E 5FNVE 3AEEA 2V7JA 3M65A 5L3CB 4OHFA 1UGOA 1ZKEA 2KZ7B 5FVKA 3PUAA 4UF0A 3NZPA 2X9WA 4L9IA 4Z91A 1UK5A 4L5GA 3AE6A 2D0UA 1JNRA 2ZLYA 2XPKA 3PEOA 2WCAA 3NKZA 5FXZA 2J4GA 2CPTA 3AE9A 4QWNB 5A1LA 5LXTE 2XAQB 4KMCA 3IA3A 4TV9E 5LG3A 4GYSA 1D1AA 3VR8A 2XYTA 4MFRA 3C50A 1OEDA 4EZ1A 3FZHB 3AE4A 5AQLB 1WYCA 5H6RB 2BG9E 4H63H 3ZC1A 1MMAA 2J47A 4X1YE 2Y8DA 3O1JA 4CXWA 2WDVA 4ISSA 2NP9A 5CA0E 1I9BA 2YMDA 2XNUA 2WN9A 2YKSA 3UU6A 3B57A 2D2SA 4LFCT 5TAOA 5JRCA 2E9XA 2XAGB 2RP4A 4GKKT 3SOLA 4DV6T 2D5UA 2K5BB 2V7LA 4BAYB 3KV4A 4OYJA 1V9DA 5FXVA 4DV4T 2LRLA 3UULA 5F3JA 4YHJA 3AAEB 4YJ2E 4F6RC 3WAKA 2XAFB 2VURA 4ISTA 3JC6C 2VK9A 3O1HA 3P4WA 2W8GA 5FL1A 4NUVA 2V7MA 4ZHQE 3N9PA 5HXHA 2YDQA 2QC1B 4UM3A 3OJAA 3RGLA 3KV5A 1X9BA 2XQ5A 4QH1A 3RYHE 3RRCA 1US7B 4YTPA 4JI6T 2SPCA 2IDOB 2PH9A 2J62A 3K1SA 2UUCT 2XNVA 3WTJA 5AINA 2HHHT 1UX2A 3WTMA 5JDGA 3K8PC 3CX7B 5LBMA 3SIOA 4DBQA 2CLYB 3AB3B 2JMKA 3FZLB 4EIWA 3H37A 3ANWA 3RYFE 4YSYA 3IGQA 2WZYA 2LEHA 2WY2A 4DV2T 2C5IT 3LK3B 4QX7B 3NVOA 2XQ4A 3O1IA 3N2OA 5LGNB 5EK4A 4G2AA 5IHYA 1IJ5A 2UZ6A 2PBIA 2XYSA 4IE6A 3ANWB 1D1CA 3RIUC 4YY3T 2C9TA 3SFEA 2WP9A 4E7ZA 1UV6A 5LBQB 3SS1A 4U7IA 2FBWA 5FY0A 2I59A 3R6NA 3LBXA 4DUZT 3AAAB 1E7PA 4HWHA 2WU2A 3W15B 2Q9QC 3BK9A 4H63V 2W62A 4DMWA 2ZM8A 1WFDA 3SFDA 1QSDA 3PUXF 2Y56A 3Q5EA 4X20E 4HFIA 4Z90A 3OPCA 3JCFA 2UXXB 3RX6A 3ZN1B 2DWKA 1J1JA 4PK6A 4UV8B 4PJNA 2BVLA 4YT0A 3K3QC 2MBGA 2XJ7A 4IDQA 2VKOA 2W67A 1BR4A 3KBTA 2I0MA 5IWAT 3I0QA 2JQ9A 5EZYE 2BKPA 3CX8B 4BFQA 3ZC0A 3RLFF 5LHHB 4X5TA 3P4RA 2IAKA 4DR5T 4HGAA 4OK0A 2CCQA 3QNUA 3N9QA 4TX5A 4GK5E 4EB6E 5LMUT 4AFHA 2UU9T 4WNKA 4I50E 2D0TA 3VRAA 2JQKA 3NRXA 4JI5T 2P9BA 3JAFA 2CHOA 1L0VA 4LF9T 4WYVA 4JI8T 2LSYA 3MXZA 4AQGA 3O9XA 2ACZA 4PJMA 5TVCA 1IBKT 4IDOA 3T4MA 4ILBA 2XQYA 1UUSA 2V1DB 5BMVE 2YU2A 1D0YA 2IUBA 1QLBA 3OTOT 2IC9A 4ZS3A 3EAMA 3UUMA 1YQ4A 1NWMX 3BQIA 3WI3A 3EDUA 4AFGA 4ZI2D 3FB2A 4AQFC 4M1PA 4HTEA 3FXDB 4NIQA 3VR9A 3ZPOA 3ZMSB 2I6HA 1D0XA 5JR9B 2W2UA 3LJCA 1ZP0A 5ABHA 2OA5A 4AISA 4EEDA 3TLWA 4FI5A 2C5JA 5FVLA 4TNWA 4ZI7E 5JDQA 4K0UA 2K9AA 4ZJSA 2X9YA 3RPUA 3DTOA 3T8OA 1LVKA 2KSRA 1NENA 1MMDA 2BS2A 4A97A 3U78A 2YDSA 3CQGB 2JQQA 5J1GA 4LF4T 3P7IA 5AQUB 4JUYA 5FXWA 3P4PA 4TNVA 3NRYA 4EAHA 1HNXT 3ZMTB 2DI4A 3PJAA 4QACA 2WU5A 4ERRA 5CFBA 4CN1A 3LK42 2X0HA 4EOZB 4KHPT 3VRBA 3ETVA 4AKRB 1WYBA 3CQXC 3U8LA 3B13A 2XQ8A 2BDEA 1N34T 2HPJA 5AQSB 3PUSA 4JLEA 5LHIB 2LKHA 5AQPB 2VB6A 3ABVA 2N9DA 3UQ7A 1UURA 1HNZT 2WZIA 3WTIA 4HQPA 5HAXA 3A5XA 2DLRA 2Y48B 2XQAA 1D0ZA 4B3TT 3K3NA 2XAHB 4Q25A 1IBMT 5JH7E 3RF1A 3AE5A 4KHZF 2W63A 4ZEYA 2D9DA 2OV9A 3AXJB 1T8BA 4GIWA 3GN5A 2RA1A 4IREA 1MNEA 3WTHA 4ILCA 2DCFA 2X68A 5AQIB 5KDMC 3V5SA 2XM2A 1H7CA 5JR9C 4DR6T 3UU4A 2JJ9A 2CMRA 2EHOB 4YFSA 2BBJA 4ZZCA 4ZS2A 3UTKA 4MHCA 4BQTA 2W61A 1Y64B 3OYXA 3PJAJ 3GN5B 5JREA 1CHUA 1WCRA 3VKGA 5BW2A 3O4XE 3BQLA 4LF8T 3U8JA 2MPKA 2IHR1 2V8SV 4JI1T 3KV9A 1W0BA 4YSZA 2XTLA 4UVBB 3ONJA 3P4SA 1VRBA 3CK6A 4ZK4A 3CKDA 4UVAB 5LG4A 3I9YA 1I6ZA 2JMHA 1T7SA 4ILUA 3H3AA 4PJLA 4U72A 3LSVA 2QRXA 2BS3A 1XMQT 4KUMB 3K3OA 3EVYA 3RIUA 3AE1A 1Z0PA 4IDNA 2HN2A 2BR7A 3B5MA 5L3BB 4B3MT 1ZHCA 2V7KA 3U8KA 2KLQA 4PW8A 4U74A 4HKAA 4CZZB 3ZMVB 2X0YA 4WBNE 3ZT7A 2PJQA 3IHRA 2ZM0A 2Q9QA 2AXDS 1YKEB 5J2UE 2NWBA 4C90A 5L3DB 4ZI3D 5HEHA 1XWMA 2WDRA 4LMLA 3ZJ1A 4MBQA 5JDLA 3CIRA 4CI2B 4DR1T 4PNIA 4OFZA 3RH3A 3ONXA 2LHNA 3RIAA 5LNKA 2Q9QB 3AA1B 4AKIA 1VCSA 2VL8A 2EHOC 3T1HT 2HPLA 3LFMA 4NUUA 4CXXA 3EUHA 1GQEA 3MA9A 1VOMA 4HFDA 3A8YC 2QVAA 5FXXA 2Y6XA 2A72A 1ZV4X 4DV3T 2WZHA 2XHEB 1FJGT 3PU3A 4ZOLE 2B76A 3FHNA 1T72A 1HX8A 1IJ6A 1KFYA 3G06A 2BKNA 5H6QB 2VVNA 2X0LB 2LM9A 4WW0A 3RYCE 4DO0A 3MJXA 3AAIA 5AQQB 1UW6A 1FMVA 4CI1B 5KE4A 2DNXA 3ZDHA 2YOEA 1N32T 3GUAA 2UUBT 3RIFA 4PIRA 3F31A 3PURA 4H9SE 4JI7T 3ZDGA 3VKHA 3WTOA 5AQFB 5CA1E 2ZM6T 3CPZA 3UUNA 3U3IA 4AQFA 1FEWA 3ZYMA 3UU5A 2DL1A 4O2AE 2R6GF 2W4XA 3KV6A 4P09A 2WSSV 4QKNA 2LE8A 4TWHA 4Z8XA 3WTNA 3RQWA 4XK9A 4MLKA 2VWAA 4O4JE 4QHOA 3HL6A 1HR0T 3OVUA 1N33T 4HWCA 1XNQT 3MACA 4XAXB 5HEGA 1MMNA 4AKGA 4U2YA 5DQWA 2KINB 4UELA 2QGSA 1BR0A 4QH5A 2FJEA 5C3JA 2ES0A 4IE0A 3EHZA 2V7IA 4H9OC 2H89A 1T98A 1W0AA 3AVRA 5HXCA 3PUYF 4O4LE 3QOFA 1OWAA 3N5LA 5DQVA 2Y58A 4OX9T 5L47A 1S35A 1FIOA 5IUXA 4DNDA 3VU7H 3ZCJA 3ZN0B 1XNRT 3AEAA 4KX6A 5LGUB 2CEAA 2MYSA 5SYOA 2E9XD 4P0BA 2LSIA 2ACXA 4KI0F 4QX8B 5L3FB 4X65T 5AQJB 2XASB 4DR2T 5DABA 3FBZA 2VVSA 2LT3A 2XQ9A 2WAUA 1JNZA 5ABGA 3M3ZB 3UU8A 2NTYA 5F5WA 2BG9C 5BP0A 5E0OA 4ADZA 4IIJE 4ILAA 1X79A 5KMGP 2X00A 4NPPA 4HE8A 2YU1A 5IYZE 4EZ4A 5EK3A 4JYAT 4JBWF 4ZI2C 4OYKA 2NW7A 5LYJE 4O8SA 4FJOA 2N1GA 2E2AA 5LOVE 4EYUA 2HN1A 2NTXA 2ZJUA 1MIYA 2JPFA 5FMNA 4COFA 2JIWA 1HCIA 3L39A 4YTMA 3SH1A 2QYWA 2X66A 5JR9A 3PDYA 3CMLA 3H3MA 5AFMB 3S4UA 3ZEFB 5AFJA 2BR8A 1ZEEA 4I0UA 1LKXA 2WMNA 5L3EB 3HA4A 2CBIA 2CXDA 2ODUA 3AE2A 3LK2B 2ZMAA 2PTFA 2HH7A 5AQOB 3UUXB 3P50A 2VKHA 4X64T 2MTQA 4DV7T 4WZXA 2ZJVA 1IAPA 4HWIB 5ABEA 3TLTA 3C4ZA 4JI0T 3ZKRA 2MOZA 2YMEA 3KDSE 4U7YA 4X62T 2H3RA 3N2GE 5HYAA 3MKDA 3WTKA 2BS4A 5JDNA 2CWYA 3PUWF 4LFAT 3EI0A 5JQGE 3RYIE 4GK0E 5GONE 4ASKA 2LSKA 1J5WA 2C0SA 3E08A 4HWFA 5L3GB 4NXMT 5LB7B 3QB5K 5L4EA 5LJMA 4GOUA 4UV9B 2BKOA 2B1EA 2JQHA 3OYZA 3KVAA 4IGUA 1WR6A 3PUZF 2W66A 2XQ7A 3KINB 3Q2MA 1N36T 5AQMB 3C4XA 4TUYE 3PE0A 3ZCIA 2LLYA 2A3DA 1IZNB 2XZ5A 3AA0B 3AXJA 2LHRA 3N2KE 3QUJA 3E0ZA 4H9PC 1KNZA 5FP3A 3C64A 2WM9A 4UXNB 5AQKB 3QB5A 4H9RC 4CXYA 3JADA 2H7VC 3QC9A 4DR4T 3TKLB 1O3XA 4H9QC 5KZUA 5J5FA 2XM1A 4WBOA 4EZHA 3ZT6A 2EHOA 4IDPA 1I94T 1IBLT 3KBUA 3V5UA 4BJMA 3TLUA 2WDQA 2VKJA 4YLHA 1J5ET 2BYQA 2BVMA 5FJVA 3DP7A 1HF8A 4PFPA 1ZOYA 2KT9A 5ABFA 4JEUB 3I0OA 4WV9A 4IL4A 4IHJE 4AFTA 3PUGA 4IE4A 3ZYKA 5LMNT 5LA6E 4LMKA 4D01A 1W09A 3PUQA 5FL0A 3ZMZB 1CUNA 4XBFB 5FKYA 1NEKA 4AQYT 1HFAA 5ABFB 2WWVA 2IC6A 4LF7T 4B5DA 3ZSTA 3N9OA 4X1IE 2CA5A 2YDRA 2PFVA 1WRDA 2Y7YA 2W00A 5F8PA 1UX4A 3ETUA 2KMFA 4LMJA 2AE9A 3FZMB 4H9NC 4UEMA 4L0RA 1SUMB 3PTRB 1VCTA 3CX6B 3RHWA 2XZ6A 3Q9DA 3HR0A 3HKBE 3WAJA 3ZLIA 4DBRA 3CQCB 2C5KT 3C79A 4ZI3C 2E8IA 4TWDA 3AE8A 3AE7A 1XDOA 4X66T 2CRBA 2LRKA 4AXPA 4IL9A 3ESLA 2X51A 5EK2A 4UF0B 4FRRA 2NOXA 1WR0A 2VL0A 2VKDA 1LRZA 4UM3P 2K48A 4QXCB 2NR4A 4YXDA 5BR8T 2IMLA 2MAWA 2NW9A 5HCMA 2W0GA 5FY1A 4CN6A 3UFEA 3FXEB 1MMGA 3AEGA 2K24A 3T1YT 4BA9A 4AI6A 3KVBA 4DUYT 2H7OA 2YN6A 2XY8B 2XSAA 1OEDB 3F57A 3KFWX 1SE7A 3OBVE 4PK5A 3RC3A 1YQ3A 3VHLA 5AFLA 2BYNA 5CJ5A 2YINA 1UCUA 5AQVB 2XUEA 3GWHA 4QXBB 2PG8A 3GA8A 5AFKA 1M7KA 2Z6EA 2CHNA 2WNLA 5DJQC 2LKGA 3U8NA 5BRXA 5JRCB 2WS3A 4A5XA 2E9XB 1HTJF 4LF5T 4UM3S 4V1Av 3MZKB 4EXTA 2BBHA 4LF6T 4YSXA 3U8MA 3WTLA 2WMOA 4G63A 3RQUA 5J5HA 1W9RA 2CE7A 3TLVA 2XQ6A 4EYYR 2FJAA 4KP3C 4U3CA 2BG9A 2LSJA 2KXPB 3CWZB 2CWOA 5CB4E 1U4QA 4EGWA 2IW5B 1KNPA 2DWGA 5LP6E 3RI5A 2WQYA 4EV6A 5LGTB 2F4VT 3DJBA 4CQIA 2FUPA 4PAGA 3JC6D 2EHOD 4NXNT 2WNJA 3HKDE 5HWYA 3AVSA 3I9WA 3Q5XA 4GYRA 4K0KT 1YXRA 3AE3A 3PMZA 5KXJA 2BG9B 4ZRUA 1OXZA 2H88A 4JV5T 3RKGA 2V5DA 4DBMA 2FJDA 2V6XA 3HI2A 2E5VA 3LDQB 4ZK1A 4A98A 1HS7A 5JTGA 1B7TA 4JI2T 1SHZC 2LJLA 4ZZBA 3Q5DA 5LJNA 2WB5A 4O2BE 2UXBT 3AA6B 5HXSA 1HG2A 3N9NA 1UX5A 4PJJA 2LM2A 3UT5E 4HFEA 2WWUA 1HG5A 3P4QA 1OEDC 2QA7A 3AEDA 3IEEA 1M62A 3EABA 3UUBA 5CGMA 1HX1B 5AFUL 4J2CA 3IBPA 5LCYA 4B3RT 3SQ9A 5FYMA 4A56A 2L3LA 4B3ST 1E2AA 1YD8G 5HEUA 2VASA 4KBMB 5L4HA 5HEOA 3AEBA 3PU8A 2L8KA 4DR3T 2N2NA 2WBLA 2UUAT 4QABA 1S94A 2WNCA 5HXRA 3NZQA 5AQNB 4U33A 2E9XC 4AKHA 5LXBA 3EDVA 1Y01A 3FBLA 2KNDA 2NW8A 3MK7C 3E22E 2LOSA 4TWFA 1BR2A 4B6XA 4JEHB 2G0UA 2X9HA 3LBXB 2ZM2A 2OLTA 4DV1T 4I43B 4IE7A 5AQGB 4N78D 2YK0A 2J1DG 3AEFA 3D0TA 5JMEA 3RRWA 4UIGA 4HFHA 2Q9QD 2Y57A 2XNTA 3GMIA 2UXNB 4PK4A 3OKQA 5AQHB 2M6BA 5LHGB 3UU3A 4IT4A 4ALXA 3C98B 3N9MA 3J9X1 2VQET 1SA0E 5C2TA 4C91A 3IF8B 4X1KE 2JRKA 3ZMUB 5CO5A 2GK9A 4PFOA 4LFBT 3C4WA 4TZ4C 3AA7B 5AFMA 2CM0A 5AFNA 2KWIB 3A7MA 1G73A 2BYSA 4UM1A 2CLYC 5ADXL 1FMWA 2RPAA 2CXFA 4UXUA 4ZJTA 1NAFA 1YKHB 3SQ6A 3NWIA 3CVRA 3L3PA 3UFGA 3UQ4A 1MIWA 1G8XA 4DMVA 5AQTB 3J7Yq 5HEJA 4QH4A 3C84A 1QUUA 4HFBA 3AECA 4YTNA 2E5LT 2XZEA 3ZJ2A 4P1NA 2BYPA 4CN4A 4QXHB 4TV8E 4BJNA 2CBJA 1KNRA 4AKLA 3ZSSA 4MALA 5JVDE 1YW0A 5ETWA 3TLSA 2W8FA 3ZYLA 4F8HA 4HFCA 2LOPA 2X9XA 2BYRA 4HWDA 4YHHT 2LSGA 4IE5A 5JDMA 1U5PA 1XMOT 5HCJA 3PV0F 4DR7T
chains in the Genus database with same CATH topology
2Y56A 4D01A 4AFGA 4HFIA 4Z90A 5L4EA 2LKHA 2M6BA 4XHEA 4ZZBA 3UU3A 3UQ7A 1OEDE 4ALXA 3WTIA 4HQPA 2PH9A 2ZJUA 5HEGA 1I9BA 2XNVA 3LSVA 2YMDA 3WTJA 2XNUA 2WN9A 4B5DA 4UY2A 5AINA 4COFA 5AFKA 2LM2A 4HFEA 1UX2A 5CO5A 2YKSA 3UU6A 3WTMA 3SH1A 2XQ7A 2XQAA 5J5IA 1OEDC 5AFMA 3SIOA 2WNLA 5AFNA 3UUBA 4QAAA 2LKGA 2Y7YA 3U8NA 5BRXA 2LLYA 4QH5A 2BYSA 4UM1A 5AFMB 4UM3S 2XZ5A 2X00D 5AFJA 3WIPA 4LMJA 3EHZA 3JAEA 2BR7A 2BR8A 3U8MA 4UXUA 3IGQA 3WTLA 3SQ9A 2WZYA 4ZJTA 2BJ0A 5HEUA 5L4HA 2Y54A 5HEOA 3SQ6A 3U8KA 4BFQA 3RHWA 3RQUA 5J5HA 3TLWA 4IREA 2XZ6A 4X5TA 3TLVA 2XQ6A 1UW6A 3WTHA 4TNWA 3JADA 3UQ4A 4NZBA 2XQ4A 4ILCA 4ZR6A 2M6IA 4ZJSA 5KE4A 5KZUA 2BG9A 3ZDHA 2Y58A 2YOEA 5J5FA 5L47A 2PGZA 3C79A 4QABA 5IUXA 5HEJA 4TWDA 2KSRA 4QH4A 2WNCA 3C84A 2UZ6A 3GUAA 4HFBA 3UU4A 4IL9A 3RIFA 4A97A 3RI5A 5J0ZA 2XYSA 4PIRA 3P50A 4AFHA 4Z91A 5LXBA 5HEHA 4FRRA 3P4WA 4LMLA 2VL0A 3TLUA 2C9TA 2ZJVA 5SYOA 2W8GA 3TLTA 4ZZCA 3PEOA 1UV6A 4UM3P 3ZDGA 2BYPA 3ZKRA 2BYQA 4BQTA 2MAWA 3WTOA 2YMEA 4TWFA 5HCMA 2WNJA 5FJVA 2XQ3A 3JAFA 4TNVA 2W8FA 3UU5A 2XQ9A 3TLSA 3WTKA 4F8HA 3PMZA 5LG3A 5BW2A 4HFCA 2BG9B 4ZRUA 3UU8A 4QACA 3U8JA 5CFBA 3EI0A 3RIAA 2XYTA 5TVCA 2BG9C 3T4MA 4ILBA 2QC1B 4UM3A 4DBMA 5BP0A 4WV9A 4ILAA 1OEDA 4EZ1A 2BYRA 2YN6A 4IL4A 2X00A 5AFHA 4AFTA 1OEDB 4NPPA 4TWHA 5JMEA 3WTNA 3RQWA 2XQ5A 3U8LA 4HFHA 4A98A 4HFDA 4ZK1A 2XQ8A 4ZK4A 5AFLA 4XK9A 2BYNA 4QH1A 3EAMA 5HCJA 2BG9E 2Y57A 4LMKA 2XNTA 5J5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y56 A;  4D01 A;  4AFG A;  4HFI A;  4Z90 A;  5L4E A;  2LKH A;  2M6B A;  4XHE A;  4ZZB A;  3UU3 A;  3UQ7 A;  1OED E;  4ALX A;  3WTI A;  4HQP A;  2PH9 A;  2ZJU A;  5HEG A;  1I9B A;  2XNV A;  3LSV A;  2YMD A;  3WTJ A;  2XNU A;  2WN9 A;  4B5D A;  4UY2 A;  5AIN A;  4COF A;  5AFK A;  2LM2 A;  4HFE A;  1UX2 A;  5CO5 A;  2YKS A;  3UU6 A;  3WTM A;  3SH1 A;  2XQ7 A;  2XQA A;  5J5I A;  1OED C;  5AFM A;  3SIO A;  2WNL A;  5AFN A;  3UUB A;  4QAA A;  2LKG A;  2Y7Y A;  3U8N A;  5BRX A;  2LLY A;  4QH5 A;  2BYS A;  4UM1 A;  5AFM B;  4UM3 S;  2XZ5 A;  2X00 D;  5AFJ A;  3WIP A;  4LMJ A;  3EHZ A;  3JAE A;  2BR7 A;  2BR8 A;  3U8M A;  4UXU A;  3IGQ A;  3WTL A;  3SQ9 A;  2WZY A;  4ZJT A;  2BJ0 A;  5HEU A;  5L4H A;  2Y54 A;  5HEO A;  3SQ6 A;  3U8K A;  4BFQ A;  3RHW A;  3RQU A;  5J5H A;  3TLW A;  4IRE A;  2XZ6 A;  4X5T A;  3TLV A;  2XQ6 A;  1UW6 A;  3WTH A;  4TNW A;  3JAD A;  3UQ4 A;  4NZB A;  2XQ4 A;  4ILC A;  4ZR6 A;  2M6I A;  4ZJS A;  5KE4 A;  5KZU A;  2BG9 A;  3ZDH A;  2Y58 A;  2YOE A;  5J5F A;  5L47 A;  2PGZ A;  3C79 A;  4QAB A;  5IUX A;  5HEJ A;  4TWD A;  2KSR A;  4QH4 A;  2WNC A;  3C84 A;  2UZ6 A;  3GUA A;  4HFB A;  3UU4 A;  4IL9 A;  3RIF A;  4A97 A;  3RI5 A;  5J0Z A;  2XYS A;  4PIR A;  3P50 A;  4AFH A;  4Z91 A;  5LXB A;  5HEH A;  4FRR A;  3P4W A;  4LML A;  2VL0 A;  3TLU A;  2C9T A;  2ZJV A;  5SYO A;  2W8G A;  3TLT A;  4ZZC A;  3PEO A;  1UV6 A;  4UM3 P;  3ZDG A;  2BYP A;  3ZKR A;  2BYQ A;  4BQT A;  2MAW A;  3WTO A;  2YME A;  4TWF A;  5HCM A;  2WNJ A;  5FJV A;  2XQ3 A;  3JAF A;  4TNV A;  2W8F A;  3UU5 A;  2XQ9 A;  3TLS A;  3WTK A;  4F8H A;  3PMZ A;  5LG3 A;  5BW2 A;  4HFC A;  2BG9 B;  4ZRU A;  3UU8 A;  4QAC A;  3U8J A;  5CFB A;  3EI0 A;  3RIA A;  2XYT A;  5TVC A;  2BG9 C;  3T4M A;  4ILB A;  2QC1 B;  4UM3 A;  4DBM A;  5BP0 A;  4WV9 A;  4ILA A;  1OED A;  4EZ1 A;  2BYR A;  2YN6 A;  4IL4 A;  2X00 A;  5AFH A;  4AFT A;  1OED B;  4NPP A;  4TWH A;  5JME A;  3WTN A;  3RQW A;  2XQ5 A;  3U8L A;  4HFH A;  4A98 A;  4HFD A;  4ZK1 A;  2XQ8 A;  4ZK4 A;  5AFL A;  4XK9 A;  2BYN A;  4QH1 A;  3EAM A;  5HCJ A;  2BG9 E;  2Y57 A;  4LMK A;  2XNT A;  5J5G A; 
#chains in the Genus database with same CATH topology
 3RC8 A;  2XSB A;  4O4I E;  4XHE A;  1R8I A;  3QK6 A;  4DID B;  3X1D A;  2K3W A;  2ODV A;  3PUV F;  2IIU A;  4UY2 A;  5AQR B;  5HWX A;  3FZF B;  2V5C A;  5JDH A;  3L8R A;  3BQK A;  4U31 A;  3RKO A;  4TN7 B;  2KWH A;  3HKC E;  1KF6 A;  4HN9 A;  3P8C D;  5J2T E;  2UXC T;  2UXD T;  2V26 A;  2BJ0 A;  2Y54 A;  2DHR A;  3LG7 A;  2XAJ B;  3L09 A;  4JI4 T;  4UR9 A;  4DV5 T;  4NZB A;  4ZR6 A;  2M6I A;  5JDF A;  2PGZ A;  3ONL C;  1AJ3 A;  1WLX A;  1LVF A;  3HKE E;  5J0Z A;  1EZ3 A;  3F2E A;  3SWH A;  2V6Y A;  2L9Q A;  3C51 A;  4E7S A;  1Z8U A;  4EEB A;  2XQ3 A;  5L2L A;  1D1B A;  4YJ3 E;  5HXE A;  5AFH A;  2V6Y B;  1XZY A;  2YEV C;  2VQF T;  4DV0 T;  4I4T E;  4O4H E;  2BZB A;  4UVC B;  4U2Z A;  3FZK B;  5J5G A;  4DVD A;  2A2F X;  2M67 A;  1DU2 A;  1KK7 A;  3NBX X;  1BR1 A;  4XZC A;  1OED E;  4P0A A;  3ZT5 A;  1KEY A;  4ZXL A;  4AIU A;  4HEA A;  1XDP A;  4JI3 T;  4CI3 B;  4GKJ T;  1HNW T;  3SRZ A;  2X67 A;  3N9L A;  3Q5W A;  5J5I A;  5FY7 A;  1MIV A;  5C8Y E;  4QAA A;  1E1H B;  2A9U A;  3R84 B;  2FJB A;  4IDZ A;  2X00 D;  1MND A;  3WIP A;  3JAE A;  2CXL A;  4I55 E;  5M4Y A;  3I1A A;  4HFV A;  4ANJ A;  5KX5 E;  5FNV E;  3AEE A;  2V7J A;  3M65 A;  5L3C B;  4OHF A;  1UGO A;  1ZKE A;  2KZ7 B;  5FVK A;  3PUA A;  4UF0 A;  3NZP A;  2X9W A;  4L9I A;  4Z91 A;  1UK5 A;  4L5G A;  3AE6 A;  2D0U A;  1JNR A;  2ZLY A;  2XPK A;  3PEO A;  2WCA A;  3NKZ A;  5FXZ A;  2J4G A;  2CPT A;  3AE9 A;  4QWN B;  5A1L A;  5LXT E;  2XAQ B;  4KMC A;  3IA3 A;  4TV9 E;  5LG3 A;  4GYS A;  1D1A A;  3VR8 A;  2XYT A;  4MFR A;  3C50 A;  1OED A;  4EZ1 A;  3FZH B;  3AE4 A;  5AQL B;  1WYC A;  5H6R B;  2BG9 E;  4H63 H;  3ZC1 A;  1MMA A;  2J47 A;  4X1Y E;  2Y8D A;  3O1J A;  4CXW A;  2WDV A;  4ISS A;  2NP9 A;  5CA0 E;  1I9B A;  2YMD A;  2XNU A;  2WN9 A;  2YKS A;  3UU6 A;  3B57 A;  2D2S A;  4LFC T;  5TAO A;  5JRC A;  2E9X A;  2XAG B;  2RP4 A;  4GKK T;  3SOL A;  4DV6 T;  2D5U A;  2K5B B;  2V7L A;  4BAY B;  3KV4 A;  4OYJ A;  1V9D A;  5FXV A;  4DV4 T;  2LRL A;  3UUL A;  5F3J A;  4YHJ A;  3AAE B;  4YJ2 E;  4F6R C;  3WAK A;  2XAF B;  2VUR A;  4IST A;  3JC6 C;  2VK9 A;  3O1H A;  3P4W A;  2W8G A;  5FL1 A;  4NUV A;  2V7M A;  4ZHQ E;  3N9P A;  5HXH A;  2YDQ A;  2QC1 B;  4UM3 A;  3OJA A;  3RGL A;  3KV5 A;  1X9B A;  2XQ5 A;  4QH1 A;  3RYH E;  3RRC A;  1US7 B;  4YTP A;  4JI6 T;  2SPC A;  2IDO B;  2PH9 A;  2J62 A;  3K1S A;  2UUC T;  2XNV A;  3WTJ A;  5AIN A;  2HHH T;  1UX2 A;  3WTM A;  5JDG A;  3K8P C;  3CX7 B;  5LBM A;  3SIO A;  4DBQ A;  2CLY B;  3AB3 B;  2JMK A;  3FZL B;  4EIW A;  3H37 A;  3ANW A;  3RYF E;  4YSY A;  3IGQ A;  2WZY A;  2LEH A;  2WY2 A;  4DV2 T;  2C5I T;  3LK3 B;  4QX7 B;  3NVO A;  2XQ4 A;  3O1I A;  3N2O A;  5LGN B;  5EK4 A;  4G2A A;  5IHY A;  1IJ5 A;  2UZ6 A;  2PBI A;  2XYS A;  4IE6 A;  3ANW B;  1D1C A;  3RIU C;  4YY3 T;  2C9T A;  3SFE A;  2WP9 A;  4E7Z A;  1UV6 A;  5LBQ B;  3SS1 A;  4U7I A;  2FBW A;  5FY0 A;  2I59 A;  3R6N A;  3LBX A;  4DUZ T;  3AAA B;  1E7P A;  4HWH A;  2WU2 A;  3W15 B;  2Q9Q C;  3BK9 A;  4H63 V;  2W62 A;  4DMW A;  2ZM8 A;  1WFD A;  3SFD A;  1QSD A;  3PUX F;  2Y56 A;  3Q5E A;  4X20 E;  4HFI A;  4Z90 A;  3OPC A;  3JCF A;  2UXX B;  3RX6 A;  3ZN1 B;  2DWK A;  1J1J A;  4PK6 A;  4UV8 B;  4PJN A;  2BVL A;  4YT0 A;  3K3Q C;  2MBG A;  2XJ7 A;  4IDQ A;  2VKO A;  2W67 A;  1BR4 A;  3KBT A;  2I0M A;  5IWA T;  3I0Q A;  2JQ9 A;  5EZY E;  2BKP A;  3CX8 B;  4BFQ A;  3ZC0 A;  3RLF F;  5LHH B;  4X5T A;  3P4R A;  2IAK A;  4DR5 T;  4HGA A;  4OK0 A;  2CCQ A;  3QNU A;  3N9Q A;  4TX5 A;  4GK5 E;  4EB6 E;  5LMU T;  4AFH A;  2UU9 T;  4WNK A;  4I50 E;  2D0T A;  3VRA A;  2JQK A;  3NRX A;  4JI5 T;  2P9B A;  3JAF A;  2CHO A;  1L0V A;  4LF9 T;  4WYV A;  4JI8 T;  2LSY A;  3MXZ A;  4AQG A;  3O9X A;  2ACZ A;  4PJM A;  5TVC A;  1IBK T;  4IDO A;  3T4M A;  4ILB A;  2XQY A;  1UUS A;  2V1D B;  5BMV E;  2YU2 A;  1D0Y A;  2IUB A;  1QLB A;  3OTO T;  2IC9 A;  4ZS3 A;  3EAM A;  3UUM A;  1YQ4 A;  1NWM X;  3BQI A;  3WI3 A;  3EDU A;  4AFG A;  4ZI2 D;  3FB2 A;  4AQF C;  4M1P A;  4HTE A;  3FXD B;  4NIQ A;  3VR9 A;  3ZPO A;  3ZMS B;  2I6H A;  1D0X A;  5JR9 B;  2W2U A;  3LJC A;  1ZP0 A;  5ABH A;  2OA5 A;  4AIS A;  4EED A;  3TLW A;  4FI5 A;  2C5J A;  5FVL A;  4TNW A;  4ZI7 E;  5JDQ A;  4K0U A;  2K9A A;  4ZJS A;  2X9Y A;  3RPU A;  3DTO A;  3T8O A;  1LVK A;  2KSR A;  1NEN A;  1MMD A;  2BS2 A;  4A97 A;  3U78 A;  2YDS A;  3CQG B;  2JQQ A;  5J1G A;  4LF4 T;  3P7I A;  5AQU B;  4JUY A;  5FXW A;  3P4P A;  4TNV A;  3NRY A;  4EAH A;  1HNX T;  3ZMT B;  2DI4 A;  3PJA A;  4QAC A;  2WU5 A;  4ERR A;  5CFB A;  4CN1 A;  3LK4 2;  2X0H A;  4EOZ B;  4KHP T;  3VRB A;  3ETV A;  4AKR B;  1WYB A;  3CQX C;  3U8L A;  3B13 A;  2XQ8 A;  2BDE A;  1N34 T;  2HPJ A;  5AQS B;  3PUS A;  4JLE A;  5LHI B;  2LKH A;  5AQP B;  2VB6 A;  3ABV A;  2N9D A;  3UQ7 A;  1UUR A;  1HNZ T;  2WZI A;  3WTI A;  4HQP A;  5HAX A;  3A5X A;  2DLR A;  2Y48 B;  2XQA A;  1D0Z A;  4B3T T;  3K3N A;  2XAH B;  4Q25 A;  1IBM T;  5JH7 E;  3RF1 A;  3AE5 A;  4KHZ F;  2W63 A;  4ZEY A;  2D9D A;  2OV9 A;  3AXJ B;  1T8B A;  4GIW A;  3GN5 A;  2RA1 A;  4IRE A;  1MNE A;  3WTH A;  4ILC A;  2DCF A;  2X68 A;  5AQI B;  5KDM C;  3V5S A;  2XM2 A;  1H7C A;  5JR9 C;  4DR6 T;  3UU4 A;  2JJ9 A;  2CMR A;  2EHO B;  4YFS A;  2BBJ A;  4ZZC A;  4ZS2 A;  3UTK A;  4MHC A;  4BQT A;  2W61 A;  1Y64 B;  3OYX A;  3PJA J;  3GN5 B;  5JRE A;  1CHU A;  1WCR A;  3VKG A;  5BW2 A;  3O4X E;  3BQL A;  4LF8 T;  3U8J A;  2MPK A;  2IHR 1;  2V8S V;  4JI1 T;  3KV9 A;  1W0B A;  4YSZ A;  2XTL A;  4UVB B;  3ONJ A;  3P4S A;  1VRB A;  3CK6 A;  4ZK4 A;  3CKD A;  4UVA B;  5LG4 A;  3I9Y A;  1I6Z A;  2JMH A;  1T7S A;  4ILU A;  3H3A A;  4PJL A;  4U72 A;  3LSV A;  2QRX A;  2BS3 A;  1XMQ T;  4KUM B;  3K3O A;  3EVY A;  3RIU A;  3AE1 A;  1Z0P A;  4IDN A;  2HN2 A;  2BR7 A;  3B5M A;  5L3B B;  4B3M T;  1ZHC A;  2V7K A;  3U8K A;  2KLQ A;  4PW8 A;  4U74 A;  4HKA A;  4CZZ B;  3ZMV B;  2X0Y A;  4WBN E;  3ZT7 A;  2PJQ A;  3IHR A;  2ZM0 A;  2Q9Q A;  2AXD S;  1YKE B;  5J2U E;  2NWB A;  4C90 A;  5L3D B;  4ZI3 D;  5HEH A;  1XWM A;  2WDR A;  4LML A;  3ZJ1 A;  4MBQ A;  5JDL A;  3CIR A;  4CI2 B;  4DR1 T;  4PNI A;  4OFZ A;  3RH3 A;  3ONX A;  2LHN A;  3RIA A;  5LNK A;  2Q9Q B;  3AA1 B;  4AKI A;  1VCS A;  2VL8 A;  2EHO C;  3T1H T;  2HPL A;  3LFM A;  4NUU A;  4CXX A;  3EUH A;  1GQE A;  3MA9 A;  1VOM A;  4HFD A;  3A8Y C;  2QVA A;  5FXX A;  2Y6X A;  2A72 A;  1ZV4 X;  4DV3 T;  2WZH A;  2XHE B;  1FJG T;  3PU3 A;  4ZOL E;  2B76 A;  3FHN A;  1T72 A;  1HX8 A;  1IJ6 A;  1KFY A;  3G06 A;  2BKN A;  5H6Q B;  2VVN A;  2X0L B;  2LM9 A;  4WW0 A;  3RYC E;  4DO0 A;  3MJX A;  3AAI A;  5AQQ B;  1UW6 A;  1FMV A;  4CI1 B;  5KE4 A;  2DNX A;  3ZDH A;  2YOE A;  1N32 T;  3GUA A;  2UUB T;  3RIF A;  4PIR A;  3F31 A;  3PUR A;  4H9S E;  4JI7 T;  3ZDG A;  3VKH A;  3WTO A;  5AQF B;  5CA1 E;  2ZM6 T;  3CPZ A;  3UUN A;  3U3I A;  4AQF A;  1FEW A;  3ZYM A;  3UU5 A;  2DL1 A;  4O2A E;  2R6G F;  2W4X A;  3KV6 A;  4P09 A;  2WSS V;  4QKN A;  2LE8 A;  4TWH A;  4Z8X A;  3WTN A;  3RQW A;  4XK9 A;  4MLK A;  2VWA A;  4O4J E;  4QHO A;  3HL6 A;  1HR0 T;  3OVU A;  1N33 T;  4HWC A;  1XNQ T;  3MAC A;  4XAX B;  5HEG A;  1MMN A;  4AKG A;  4U2Y A;  5DQW A;  2KIN B;  4UEL A;  2QGS A;  1BR0 A;  4QH5 A;  2FJE A;  5C3J A;  2ES0 A;  4IE0 A;  3EHZ A;  2V7I A;  4H9O C;  2H89 A;  1T98 A;  1W0A A;  3AVR A;  5HXC A;  3PUY F;  4O4L E;  3QOF A;  1OWA A;  3N5L A;  5DQV A;  2Y58 A;  4OX9 T;  5L47 A;  1S35 A;  1FIO A;  5IUX A;  4DND A;  3VU7 H;  3ZCJ A;  3ZN0 B;  1XNR T;  3AEA A;  4KX6 A;  5LGU B;  2CEA A;  2MYS A;  5SYO A;  2E9X D;  4P0B A;  2LSI A;  2ACX A;  4KI0 F;  4QX8 B;  5L3F B;  4X65 T;  5AQJ B;  2XAS B;  4DR2 T;  5DAB A;  3FBZ A;  2VVS A;  2LT3 A;  2XQ9 A;  2WAU A;  1JNZ A;  5ABG A;  3M3Z B;  3UU8 A;  2NTY A;  5F5W A;  2BG9 C;  5BP0 A;  5E0O A;  4ADZ A;  4IIJ E;  4ILA A;  1X79 A;  5KMG P;  2X00 A;  4NPP A;  4HE8 A;  2YU1 A;  5IYZ E;  4EZ4 A;  5EK3 A;  4JYA T;  4JBW F;  4ZI2 C;  4OYK A;  2NW7 A;  5LYJ E;  4O8S A;  4FJO A;  2N1G A;  2E2A A;  5LOV E;  4EYU A;  2HN1 A;  2NTX A;  2ZJU A;  1MIY A;  2JPF A;  5FMN A;  4COF A;  2JIW A;  1HCI A;  3L39 A;  4YTM A;  3SH1 A;  2QYW A;  2X66 A;  5JR9 A;  3PDY A;  3CML A;  3H3M A;  5AFM B;  3S4U A;  3ZEF B;  5AFJ A;  2BR8 A;  1ZEE A;  4I0U A;  1LKX A;  2WMN A;  5L3E B;  3HA4 A;  2CBI A;  2CXD A;  2ODU A;  3AE2 A;  3LK2 B;  2ZMA A;  2PTF A;  2HH7 A;  5AQO B;  3UUX B;  3P50 A;  2VKH A;  4X64 T;  2MTQ A;  4DV7 T;  4WZX A;  2ZJV A;  1IAP A;  4HWI B;  5ABE A;  3TLT A;  3C4Z A;  4JI0 T;  3ZKR A;  2MOZ A;  2YME A;  3KDS E;  4U7Y A;  4X62 T;  2H3R A;  3N2G E;  5HYA A;  3MKD A;  3WTK A;  2BS4 A;  5JDN A;  2CWY A;  3PUW F;  4LFA T;  3EI0 A;  5JQG E;  3RYI E;  4GK0 E;  5GON E;  4ASK A;  2LSK A;  1J5W A;  2C0S A;  3E08 A;  4HWF A;  5L3G B;  4NXM T;  5LB7 B;  3QB5 K;  5L4E A;  5LJM A;  4GOU A;  4UV9 B;  2BKO A;  2B1E A;  2JQH A;  3OYZ A;  3KVA A;  4IGU A;  1WR6 A;  3PUZ F;  2W66 A;  2XQ7 A;  3KIN B;  3Q2M A;  1N36 T;  5AQM B;  3C4X A;  4TUY E;  3PE0 A;  3ZCI A;  2LLY A;  2A3D A;  1IZN B;  2XZ5 A;  3AA0 B;  3AXJ A;  2LHR A;  3N2K E;  3QUJ A;  3E0Z A;  4H9P C;  1KNZ A;  5FP3 A;  3C64 A;  2WM9 A;  4UXN B;  5AQK B;  3QB5 A;  4H9R C;  4CXY A;  3JAD A;  2H7V C;  3QC9 A;  4DR4 T;  3TKL B;  1O3X A;  4H9Q C;  5KZU A;  5J5F A;  2XM1 A;  4WBO A;  4EZH A;  3ZT6 A;  2EHO A;  4IDP A;  1I94 T;  1IBL T;  3KBU A;  3V5U A;  4BJM A;  3TLU A;  2WDQ A;  2VKJ A;  4YLH A;  1J5E T;  2BYQ A;  2BVM A;  5FJV A;  3DP7 A;  1HF8 A;  4PFP A;  1ZOY A;  2KT9 A;  5ABF A;  4JEU B;  3I0O A;  4WV9 A;  4IL4 A;  4IHJ E;  4AFT A;  3PUG A;  4IE4 A;  3ZYK A;  5LMN T;  5LA6 E;  4LMK A;  4D01 A;  1W09 A;  3PUQ A;  5FL0 A;  3ZMZ B;  1CUN A;  4XBF B;  5FKY A;  1NEK A;  4AQY T;  1HFA A;  5ABF B;  2WWV A;  2IC6 A;  4LF7 T;  4B5D A;  3ZST A;  3N9O A;  4X1I E;  2CA5 A;  2YDR A;  2PFV A;  1WRD A;  2Y7Y A;  2W00 A;  5F8P A;  1UX4 A;  3ETU A;  2KMF A;  4LMJ A;  2AE9 A;  3FZM B;  4H9N C;  4UEM A;  4L0R A;  1SUM B;  3PTR B;  1VCT A;  3CX6 B;  3RHW A;  2XZ6 A;  3Q9D A;  3HR0 A;  3HKB E;  3WAJ A;  3ZLI A;  4DBR A;  3CQC B;  2C5K T;  3C79 A;  4ZI3 C;  2E8I A;  4TWD A;  3AE8 A;  3AE7 A;  1XDO A;  4X66 T;  2CRB A;  2LRK A;  4AXP A;  4IL9 A;  3ESL A;  2X51 A;  5EK2 A;  4UF0 B;  4FRR A;  2NOX A;  1WR0 A;  2VL0 A;  2VKD A;  1LRZ A;  4UM3 P;  2K48 A;  4QXC B;  2NR4 A;  4YXD A;  5BR8 T;  2IML A;  2MAW A;  2NW9 A;  5HCM A;  2W0G A;  5FY1 A;  4CN6 A;  3UFE A;  3FXE B;  1MMG A;  3AEG A;  2K24 A;  3T1Y T;  4BA9 A;  4AI6 A;  3KVB A;  4DUY T;  2H7O A;  2YN6 A;  2XY8 B;  2XSA A;  1OED B;  3F57 A;  3KFW X;  1SE7 A;  3OBV E;  4PK5 A;  3RC3 A;  1YQ3 A;  3VHL A;  5AFL A;  2BYN A;  5CJ5 A;  2YIN A;  1UCU A;  5AQV B;  2XUE A;  3GWH A;  4QXB B;  2PG8 A;  3GA8 A;  5AFK A;  1M7K A;  2Z6E A;  2CHN A;  2WNL A;  5DJQ C;  2LKG A;  3U8N A;  5BRX A;  5JRC B;  2WS3 A;  4A5X A;  2E9X B;  1HTJ F;  4LF5 T;  4UM3 S;  4V1A v;  3MZK B;  4EXT A;  2BBH A;  4LF6 T;  4YSX A;  3U8M A;  3WTL A;  2WMO A;  4G63 A;  3RQU A;  5J5H A;  1W9R A;  2CE7 A;  3TLV A;  2XQ6 A;  4EYY R;  2FJA A;  4KP3 C;  4U3C A;  2BG9 A;  2LSJ A;  2KXP B;  3CWZ B;  2CWO A;  5CB4 E;  1U4Q A;  4EGW A;  2IW5 B;  1KNP A;  2DWG A;  5LP6 E;  3RI5 A;  2WQY A;  4EV6 A;  5LGT B;  2F4V T;  3DJB A;  4CQI A;  2FUP A;  4PAG A;  3JC6 D;  2EHO D;  4NXN T;  2WNJ A;  3HKD E;  5HWY A;  3AVS A;  3I9W A;  3Q5X A;  4GYR A;  4K0K T;  1YXR A;  3AE3 A;  3PMZ A;  5KXJ A;  2BG9 B;  4ZRU A;  1OXZ A;  2H88 A;  4JV5 T;  3RKG A;  2V5D A;  4DBM A;  2FJD A;  2V6X A;  3HI2 A;  2E5V A;  3LDQ B;  4ZK1 A;  4A98 A;  1HS7 A;  5JTG A;  1B7T A;  4JI2 T;  1SHZ C;  2LJL A;  4ZZB A;  3Q5D A;  5LJN A;  2WB5 A;  4O2B E;  2UXB T;  3AA6 B;  5HXS A;  1HG2 A;  3N9N A;  1UX5 A;  4PJJ A;  2LM2 A;  3UT5 E;  4HFE A;  2WWU A;  1HG5 A;  3P4Q A;  1OED C;  2QA7 A;  3AED A;  3IEE A;  1M62 A;  3EAB A;  3UUB A;  5CGM A;  1HX1 B;  5AFU L;  4J2C A;  3IBP A;  5LCY A;  4B3R T;  3SQ9 A;  5FYM A;  4A56 A;  2L3L A;  4B3S T;  1E2A A;  1YD8 G;  5HEU A;  2VAS A;  4KBM B;  5L4H A;  5HEO A;  3AEB A;  3PU8 A;  2L8K A;  4DR3 T;  2N2N A;  2WBL A;  2UUA T;  4QAB A;  1S94 A;  2WNC A;  5HXR A;  3NZQ A;  5AQN B;  4U33 A;  2E9X C;  4AKH A;  5LXB A;  3EDV A;  1Y01 A;  3FBL A;  2KND A;  2NW8 A;  3MK7 C;  3E22 E;  2LOS A;  4TWF A;  1BR2 A;  4B6X A;  4JEH B;  2G0U A;  2X9H A;  3LBX B;  2ZM2 A;  2OLT A;  4DV1 T;  4I43 B;  4IE7 A;  5AQG B;  4N78 D;  2YK0 A;  2J1D G;  3AEF A;  3D0T A;  5JME A;  3RRW A;  4UIG A;  4HFH A;  2Q9Q D;  2Y57 A;  2XNT A;  3GMI A;  2UXN B;  4PK4 A;  3OKQ A;  5AQH B;  2M6B A;  5LHG B;  3UU3 A;  4IT4 A;  4ALX A;  3C98 B;  3N9M A;  3J9X 1;  2VQE T;  1SA0 E;  5C2T A;  4C91 A;  3IF8 B;  4X1K E;  2JRK A;  3ZMU B;  5CO5 A;  2GK9 A;  4PFO A;  4LFB T;  3C4W A;  4TZ4 C;  3AA7 B;  5AFM A;  2CM0 A;  5AFN A;  2KWI B;  3A7M A;  1G73 A;  2BYS A;  4UM1 A;  2CLY C;  5ADX L;  1FMW A;  2RPA A;  2CXF A;  4UXU A;  4ZJT A;  1NAF A;  1YKH B;  3SQ6 A;  3NWI A;  3CVR A;  3L3P A;  3UFG A;  3UQ4 A;  1MIW A;  1G8X A;  4DMV A;  5AQT B;  3J7Y q;  5HEJ A;  4QH4 A;  3C84 A;  1QUU A;  4HFB A;  3AEC A;  4YTN A;  2E5L T;  2XZE A;  3ZJ2 A;  4P1N A;  2BYP A;  4CN4 A;  4QXH B;  4TV8 E;  4BJN A;  2CBJ A;  1KNR A;  4AKL A;  3ZSS A;  4MAL A;  5JVD E;  1YW0 A;  5ETW A;  3TLS A;  2W8F A;  3ZYL A;  4F8H A;  4HFC A;  2LOP A;  2X9X A;  2BYR A;  4HWD A;  4YHH T;  2LSG A;  4IE5 A;  5JDM A;  1U5P A;  1XMO T;  5HCJ A;  3PV0 F;  4DR7 T; 
#chains in the Genus database with same CATH homology
 2Y56 A;  4D01 A;  4AFG A;  4HFI A;  4Z90 A;  5L4E A;  2LKH A;  2M6B A;  4XHE A;  4ZZB A;  3UU3 A;  3UQ7 A;  1OED E;  4ALX A;  3WTI A;  4HQP A;  2PH9 A;  2ZJU A;  5HEG A;  1I9B A;  2XNV A;  3LSV A;  2YMD A;  3WTJ A;  2XNU A;  2WN9 A;  4B5D A;  4UY2 A;  5AIN A;  4COF A;  5AFK A;  2LM2 A;  4HFE A;  1UX2 A;  5CO5 A;  2YKS A;  3UU6 A;  3WTM A;  3SH1 A;  2XQ7 A;  2XQA A;  5J5I A;  1OED C;  5AFM A;  3SIO A;  2WNL A;  5AFN A;  3UUB A;  4QAA A;  2LKG A;  2Y7Y A;  3U8N A;  5BRX A;  2LLY A;  4QH5 A;  2BYS A;  4UM1 A;  5AFM B;  4UM3 S;  2XZ5 A;  2X00 D;  5AFJ A;  3WIP A;  4LMJ A;  3EHZ A;  3JAE A;  2BR7 A;  2BR8 A;  3U8M A;  4UXU A;  3IGQ A;  3WTL A;  3SQ9 A;  2WZY A;  4ZJT A;  2BJ0 A;  5HEU A;  5L4H A;  2Y54 A;  5HEO A;  3SQ6 A;  3U8K A;  4BFQ A;  3RHW A;  3RQU A;  5J5H A;  3TLW A;  4IRE A;  2XZ6 A;  4X5T A;  3TLV A;  2XQ6 A;  1UW6 A;  3WTH A;  4TNW A;  3JAD A;  3UQ4 A;  4NZB A;  2XQ4 A;  4ILC A;  4ZR6 A;  2M6I A;  4ZJS A;  5KE4 A;  5KZU A;  2BG9 A;  3ZDH A;  2Y58 A;  2YOE A;  5J5F A;  5L47 A;  2PGZ A;  3C79 A;  4QAB A;  5IUX A;  5HEJ A;  4TWD A;  2KSR A;  4QH4 A;  2WNC A;  3C84 A;  2UZ6 A;  3GUA A;  4HFB A;  3UU4 A;  4IL9 A;  3RIF A;  4A97 A;  3RI5 A;  5J0Z A;  2XYS A;  4PIR A;  3P50 A;  4AFH A;  4Z91 A;  5LXB A;  5HEH A;  4FRR A;  3P4W A;  4LML A;  2VL0 A;  3TLU A;  2C9T A;  2ZJV A;  5SYO A;  2W8G A;  3TLT A;  4ZZC A;  3PEO A;  1UV6 A;  4UM3 P;  3ZDG A;  2BYP A;  3ZKR A;  2BYQ A;  4BQT A;  2MAW A;  3WTO A;  2YME A;  4TWF A;  5HCM A;  2WNJ A;  5FJV A;  2XQ3 A;  3JAF A;  4TNV A;  2W8F A;  3UU5 A;  2XQ9 A;  3TLS A;  3WTK A;  4F8H A;  3PMZ A;  5LG3 A;  5BW2 A;  4HFC A;  2BG9 B;  4ZRU A;  3UU8 A;  4QAC A;  3U8J A;  5CFB A;  3EI0 A;  3RIA A;  2XYT A;  5TVC A;  2BG9 C;  3T4M A;  4ILB A;  2QC1 B;  4UM3 A;  4DBM A;  5BP0 A;  4WV9 A;  4ILA A;  1OED A;  4EZ1 A;  2BYR A;  2YN6 A;  4IL4 A;  2X00 A;  5AFH A;  4AFT A;  1OED B;  4NPP A;  4TWH A;  5JME A;  3WTN A;  3RQW A;  2XQ5 A;  3U8L A;  4HFH A;  4A98 A;  4HFD A;  4ZK1 A;  2XQ8 A;  4ZK4 A;  5AFL A;  4XK9 A;  2BYN A;  4QH1 A;  3EAM A;  5HCJ A;  2BG9 E;  2Y57 A;  4LMK A;  2XNT A;  5J5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...