4ZZBA

The glic pentameric ligand-gated ion channel locally-closed form complexed to xenon
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural Basis for Xenon Inhibition in a Cationic Pentameric Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 8105
molecule tags Transport protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4zzbA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4zzbA01
4B5DA 4BQTA 5CO5A 3UU8A 2XQ8A 4UXUA 4AFHA 2BG9A 3RHWA 5HEUA 5AFKA 3WTNA 3RQWA 4F8HA 1UW6A 5AFNA 3LSVA 2VL0A 2UZ6A 5J5HA 2X00D 4FRRA 2BG9B 2BYSA 3UU3A 4TWDA 2LLYA 2ZJVA 2Y54A 4QH5A 3WIPA 4TNVA 3EI0A 2YMDA 5AFJA 5BW2A 4HFEA 3U8MA 3RQUA 5AFHA 4ILBA 2W8GA 5KZUA 4ZK4A 2XQ7A 2M6IA 4UM3A 3U8KA 4HFDA 2Y58A 2Y56A 2Y7YA 2YMEA 3RIFA 4NPPA 3WTIA 2XQ6A 4DBMA 5LG3A 5J5GA 2XNTA 3WTOA 4QABA 4ALXA 1OEDE 2BYQA 4ZK1A 4ILCA 2WNJA 4BFQA 4AFGA 4ZZBA 5KE4A 4UM3P 3PMZA 2Y57A 5AFMA 4QH1A 2ZJUA 4QH4A 5HEOA 5HEHA 3SH1A 4IL9A 3UQ7A 5AFMB 2M6BA 5J5IA 3JAEA 3RI5A 2W8FA 2BYNA 3ZDHA 4Z90A 5BP0A 4NZBA 5L4EA 3WTKA 5AFLA 2WNCA 3JAFA 4IREA 3SQ6A 3GUAA 4UM1A 4D01A 5BRXA 2WN9A 5L4HA 4ZR6A 2XQ3A 2BG9E 2XYSA 3U8JA 1OEDC 3IGQA 4X5TA 3UU6A 4Z91A 2BYRA 2YKSA 5L47A 3C84A 3U8NA 4HFHA 3EAMA 2BYPA 3UQ4A 3WTLA 4HQPA 2LM2A 4WV9A 4ZJTA 4ILAA 4A98A 2XQ4A 4LMJA 5JMEA 5J0ZA 2WZYA 3WTJA 5FJVA 2PGZA 4IL4A 4EZ1A 2XYTA 4UM3S 2QC1B 3RIAA 4QACA 5CFBA 2XQ9A 2MAWA 4COFA 2BJ0A 2WNLA 2XZ6A 2XNVA 4LMLA 2BR7A 4HFCA 4QAAA 1I9BA 5AINA 5J5FA 5HCMA 2BG9C 3ZKRA 2XQAA 4HFIA 3WTHA 3UUBA 4TWHA 5HEJA 4TWFA 5SYOA 2XNUA 5HEGA 3C79A 3ZDGA 2YOEA 2XQ5A 2KSRA 3JADA 3P4WA 4UY2A 4XHEA 2PH9A 5TVCA 4PIRA 4LMKA 1OEDA 2YN6A 3T4MA 3UU4A 2BR8A 5LXBA 4XK9A 2LKHA 4HFBA 2X00A 4ZZCA 1OEDB 3SQ9A 3WTMA 4A97A 3PEOA 4ZRUA 4ZJSA 3TLVA 5IUXA 3TLSA 3P50A 3UU5A 1UV6A 4AFTA 1UX2A 5HCJA 2LKGA 3TLTA 3U8LA 2C9TA 2XZ5A 3TLWA 3EHZA 3TLUA 3SIOA 4TNWA
chains in the Genus database with same CATH superfamily
1ZEEA 3DJBA 4L0RA 3AA0B 2BZBA 5CO5A 1ZHCA 3LBXB 3L8RA 3O1HA 2BYSA 2CWYA 4TWDA 4YFSA 3E22E 3ZN0B 2CWOA 3C50A 4DBQA 1HTJF 5AFHA 4X66T 1UURA 1D0XA 3AE7A 3C4XA 3VR9A 3RIFA 3WTIA 2JIWA 5J5GA 1OEDE 1US7B 3OBVE 4BFQA 3CVRA 4LF9T 3AXJB 4OYKA 5FNVE 4H9SE 4DMVA 3MJXA 2E9XD 2XZEA 3KINB 4EYYR 4UM1A 4D01A 4JEHB 3N9QA 3C98B 2A72A 2X9YA 4MBQA 4JV5T 5H6RB 3IGQA 4N78D 3UUXB 4H9PC 2WCAA 4NUVA 3FBLA 3RC3A 2VWAA 2XQ4A 5F8PA 3FBZA 5JDMA 5LB7B 2XZ6A 4WBNE 1I9BA 2KXPB 2D0UA 3UT5E 4CXYA 4HEAA 5FY0A 2UXNB 2KSRA 3AE5A 1MNEA 3AE8A 4U7IA 4HFVA 5LHIB 3RC8A 2BKPA 4H9QC 2CRBA 2X0YA 2JQHA 3AAIA 3ZSSA 3VRAA 4KUMB 4JI6T 3VRBA 2ZM0A 4AQGA 2ACZA 5AQTB 3T8OA 5J5HA 2BG9B 1CUNA 4X1YE 4XZCA 2ZJVA 4TNVA 5CA0E 4QHOA 5FXVA 4EZHA 2VKDA 2DWKA 4HFDA 1T98A 3AE4A 3KV4A 1QUUA 2BYQA 1S94A 3NRYA 4EIWA 1UGOA 4DV1T 4Q25A 3KFWX 5JDHA 3N9OA 1XNQT 2MOZA 2WNCA 2W67A 4A5XA 3ZT7A 2BVLA 2PFVA 4H9OC 3PUVF 4KX6A 2HHHT 2XSAA 2CPTA 4L5GA 5IWAT 3AA6B 4QWNB 2W0GA 2WDRA 2X9XA 4LMJA 5JMEA 5F3JA 1N32T 3LDQB 1MIVA 2C0SA 4IDQA 1HNZT 1J5ET 4UXNB 4K0KT 5LNKA 3CX8B 5TVCA 4PIRA 2BS3A 1W0BA 2BR8A 2N2NA 4HFBA 1D1CA 5JVDE 3SQ9A 4ZJSA 3TLVA 3E08A 3LG7A 5JTGA 1U5PA 2ODUA 4PW8A 5JRCA 2LRKA 4KI0F 3S4UA 1XDOA 3FB2A 3ZJ2A 4ADZA 4WYVA 4CN1A 4AKHA 5FP3A 4CI2B 2Y7YA 2H3RA 5F5WA 1JNRA 2PG8A 4OFZA 2DWGA 4ZK1A 5L3GB 2WNJA 2BDEA 4YSYA 4YY3T 4EOZB 3N9PA 3K3OA 3JAEA 4DR6T 2W8FA 3PJAJ 1IBKT 1R8IA 5BP0A 4IREA 4EZ4A 4PK6A 2BYRA 3IA3A 1GQEA 3C84A 1L0VA 1WYCA 3AAEB 4HQPA 4U72A 3QOFA 4AQYT 4DO0A 3C4ZA 2RA1A 5L3FB 1WRDA 3SWHA 2XQYA 2F4VT 3RYIE 4XHEA 4ZEYA 1HS7A 4ANJA 1OEDB 2HPJA 4JBWF 1I94T 4JEUB 2LKGA 3TLTA 3U8LA 3QK6A 3QB5K 3TLUA 2A3DA 2LSYA 4EV6A 2RP4A 2MBGA 3O9XA 2MYSA 4I55E 5AQVB 1Y01A 3U3IA 3PUAA 4JI3T 2X51A 4JYAT 2WSSV 2X9HA 2W8GA 5LBMA 4ZK4A 2E9XA 2XSBA 3QUJA 1E2AA 1OWAA 2DHRA 5LOVE 4LF4T 2UU9T 3AECA 4TV9E 3SRZA 4I4TE 3RX6A 5AQHB 2MTQA 1Y64B 2VKJA 1VOMA 4YHJA 5JREA 2E8IA 3G06A 1I6ZA 3AEAA 1HFAA 2J1DG 1MMNA 2M67A 2XQ3A 2BKNA 5LP6E 1EZ3A 4H9RC 3I9YA 2WZIA 2J4GA 3CWZB 2LHNA 3QB5A 4ZOLE 4P0BA 4BA9A 2IDOB 2UXXB 2VKOA 4HFIA 2W2UA 4TWFA 3ZMSB 3SFEA 2YN6A 3CMLA 3QNUA 2LKHA 4CQIA 3R6NA 1XMQT 3ZN1B 2XM2A 4ILUA 2XZ5A 5DABA 1J1JA 2WM9A 3UU8A 2Y48B 2FJDA 1MMAA 2FJAA 5FY1A 4FRRA 5HYAA 3CKDA 4GYSA 3WIPA 2IAKA 3D0TA 4QX8B 3H37A 1ZKEA 3RYCE 5KZUA 4IDPA 5ABGA 2D9DA 3CQXC 3U8KA 4IE0A 2IC6A 4X1KE 2VURA 5HAXA 4ASKA 2WU2A 3FHNA 1YQ4A 4WNKA 4JLEA 2D2SA 3KDSE 1M7KA 4DR1T 5J2TE 5BR8T 4NXNT 3UQ7A 2XASB 5J5IA 1LRZA 3OJAA 4BJMA 1W0AA 2X0HA 2WN9A 4HWCA 2CMRA 2VB6A 1LVFA 1M62A 3RYFE 1XMOT 2VKHA 4CXXA 2VVNA 4EEDA 3EUHA 5BMVE 4HFHA 2BYPA 2CEAA 3WTLA 3RIUA 5HWXA 2Q9QC 4ZJTA 4DNDA 5J2UE 4DV3T 4UM3S 3I0QA 1X9BA 4DV5T 2Y8DA 4HFCA 3PUGA 2H7OA 2OA5A 2XQAA 1FMVA 5JDQA 4J2CA 1SA0E 4JUYA 5KMGP 2CLYB 4P09A 4GKKT 2B1EA 2HPLA 2YDRA 3IEEA 4QXBB 2LM9A 1N36T 4DV7T 2KINB 2XAHB 3WTMA 1IJ6A 3VR8A 3I9WA 4XAXB 4TV8E 3EHZA 4ZI3C 5CB4E 4G63A 1G73A 5AQJB 4DMWA 3AE2A 5JRCB 3WI3A 4EB6E 3L09A 2NW7A 4TUYE 1N34T 2Q9QD 3WAKA 3JCFA 2V6YB 4YXDA 2NTYA 2XQ7A 2WS3A 2YMEA 1N33T 4ZHQE 1MIYA 3FXEB 3BQKA 5LG3A 2XY8B 2WMNA 4LF8T 2G0UA 2DNXA 3CX7B 5HEOA 5HEHA 2N1GA 1YD8G 4NIQA 3SOLA 2ES0A 2V7JA 2K5BB 2A2FX 3GUAA 3PV0F 2V7MA 1HNWT 2ZMAA 3U8JA 1OXZA 3Q5WA 2HN2A 4ZI3D 1HNXT 5L47A 3N2OA 1BR2A 2AXDS 3UQ4A 2X66A 4LF6T 1MNDA 3JC6C 2PGZA 4GIWA 4IL4A 4EZ1A 2XYTA 4EEBA 3ANWB 3B5MA 3ZSTA 2Q9QB 3AE1A 3HKDE 3ZKRA 1VCSA 3MA9A 4LMKA 4MALA 4IGUA 2LSJA 2QRXA 1IZNB 2DLRA 3RPUA 1KEYA 5FVLA 2CXDA 1UX2A 2CHOA 3NBXX 4YSZA 4I43B 3RHWA 3WTNA 3A8YC 2IIUA 2BVMA 2EHOC 4UELA 4QH5A 3JC6D 3AE6A 4PNIA 1ZP0A 2E2AA 2Y58A 5H6QB 5JH7E 4NPPA 4DR4T 5HWYA 3PUQA 2E9XB 3ZYKA 4B3ST 4QABA 4ILCA 3IHRA 3PUXF 4M1PA 2LRLA 3SH1A 2X0LB 4CI3B 4DVDA 2UUCT 2X9WA 5HXEA 4JI8T 3GWHA 1D0ZA 1QLBA 2I6HA 4YSXA 4E7SA 5ABFB 2JMHA 5FJVA 2EHOD 4JI5T 4KHZF 4QACA 3H3MA 4JI1T 2WNLA 2ACXA 3SFDA 1D1BA 4B6XA 5C8YE 3E0ZA 5KDMC 5J5FA 5LBQB 4DR7T 3BK9A 3K1SA 1T72A 5LMUT 2L9QA 2WWUA 2DI4A 3T4MA 3PUSA 2XPKA 3K8PC 2I0MA 4GYRA 4ZRUA 2LSKA 2W63A 4YLHA 4DV0T 2WMOA 3TLWA 3SIOA 4TNWA 3C51A 5KXJA 4AFHA 1FEWA 3L39A 3KV9A 3RKGA 4IDNA 2UZ6A 2LE8A 5LXTE 3ZMUB 1YKEB 5JR9C 2V5DA 4HFEA 2VQFT 5ABEA 2BS2A 3CQGB 3VU7H 4O4JE 4IIJE 4DBMA 4AI6A 4LFBT 2FUPA 3GA8A 5KE4A 3ETVA 2KWIB 5L3CB 2Z6EA 3NKZA 2Y57A 2LEHA 1IBLT 2V6YA 3PTRB 2X67A 1MIWA 5ETWA 4DUZT 2V7LA 4ZR6A 4FJOA 1T7SA 1J5WA 4IHJE 4XBFB 3PU3A 2V6XA 4KHPT 3EVYA 5AQGB 3VKGA 3PURA 4UR9A 4HTEA 2YDSA 2KLQA 5FMNA 1DU2A 3PUZF 1NENA 1IBMT 2KWHA 4DIDB 4FI5A 4U2ZA 1Z8UA 3VKHA 4ZS2A 3CIRA 2XNUA 2DCFA 4UEMA 3K3QC 3P4WA 2WWVA 1WYBA 3UTKA 4O4HE 3ANWA 4ZZCA 4AKIA 3M3ZB 2Q9QA 3UULA 5EZYE 4YTMA 2RPAA 3AEGA 2VK9A 5L3DB 1B7TA 4ZS3A 3HKEE 4GOUA 3HA4A 3ONLC 3U8MA 3RQUA 2M6IA 3LK3B 2Y6XA 2BBJA 1NAFA 4O4IE 1HCIA 3CPZA 2P9BA 4UVCB 4ZZBA 3AE3A 2YEVC 3RI5A 1IJ5A 5LG4A 2ZM2A 3AVRA 5FXWA 2C5IT 3ZPOA 1UK5A 2UXBT 3Q2MA 3RYHE 3UU6A 3HL6A 2XM1A 3UFEA 4MHCA 4DV2T 2IC9A 2WZYA 3PDYA 4P0AA 2CBIA 2K9AA 2XAFB 3ZMZB 5LJNA 4LF7T 3N9LA 4B3MT 3ZDGA 5ABFA 2JJ9A 3Q5XA 4K0UA 2LHRA 2JQKA 3PUYF 5FXXA 2XHEB 3NZPA 2ZM6T 2D5UA 2ODVA 3ETUA 5HXRA 5LJMA 2NOXA 3FZKB 2D0TA 3A7MA 4IT4A 2J47A 4ISTA 5EK4A 2CXLA 3X1DA 2E5LT 2WAUA 3RQWA 3LK42 1KNRA 3N9MA 2A9UA 2VL0A 4UV8B 4BAYB 3EI0A 5AFJA 5L2LA 1BR4A 5DQWA 1HG2A 4HWDA 3Q9DA 2XQ6A 2XNTA 4UM3P 3PMZA 3PU8A 5FL0A 1D0YA 4PK4A 5AFMA 4IE4A 2CM0A 5E0OA 4DV6T 4IL9A 5L3EB 3QC9A 4QXCB 3T1YT 3BQLA 4DR2T 2EHOA 4Z90A 3OVUA 3SQ6A 5AQLB 5L4HA 5EK2A 3ZCJA 5DQVA 4TX5A 3VHLA 4HWIB 3U8NA 4YTPA 2W00A 2KNDA 2XTLA 4ERRA 4I50E 1UUSA 4QX7B 1FMWA 4PFOA 3ZJ1A 4COFA 2XAGB 4HWHA 2XNVA 4CXWA 5AINA 3NZQA 1U4QA 3UFGA 5SYOA 2YOEA 4V1Av 4UY2A 3KVAA 2JQ9A 4H63V 2VQET 4OHFA 5J1GA 4O8SA 2V5CA 3AA7B 5FY7A 3I0OA 5LHHB 1W9RA 2B76A 2GK9A 3J7Yq 5TAOA 2X00D 3AE9A 3UU3A 3ZYMA 2E5VA 5BW2A 5FKYA 1LVKA 1WR0A 3A5XA 2KT9A 3U78A 2FBWA 1HX1B 3O1IA 4LFAT 2H7VC 3ZC0A 2YU2A 3P7IA 3ZEFB 1CHUA 1KK7A 4BJNA 4QH4A 3W15B 2K3WA 3ZDHA 3WTKA 4X1IE 4LFCT 5JR9A 2NW9A 4AISA 5BRXA 2NWBA 2WY2A 3GN5A 4OYJA 2V26A 3EDUA 3PE0A 4X65T 3ZYLA 2LM2A 4PJMA 4C91A 2XAJB 4AKLA 1BR0A 5CJ5A 4HGAA 4YJ2E 2XQ9A 2MAWA 2ZM8A 3PJAA 1YQ3A 5LMNT 2BG9C 5HCMA 2XJ7A 3P4QA 3P4PA 2PH9A 3ZC1A 4JI7T 2HH7A 4XK9A 1O3XA 3TKLB 5ADXL 4MLKA 3R84B 3AEBA 1UX5A 3V5SA 2QGSA 3IBPA 2IMLA 3MZKB 5AQUB 2XQ8A 4X62T 1VCTA 5JDLA 3NWIA 2UUBT 1UW6A 4KP3C 2FJEA 2IHR1 5FXZA 3OKQA 2YMDA 3C4WA 5LCYA 4U31A 3UUMA 2J62A 5AFUL 5DJQC 4QXHB 4AFGA 3N2GE 1X79A 4QH1A 2ZJUA 4U33A 5C3JA 5LA6E 2WBLA 1YKHB 3RH3A 4YTNA 2IW5B 4PJNA 5L4EA 4B3RT 5AFLA 4HN9A 4PFPA 2XYSA 3SS1A 4OK0A 2V7IA 5JDFA 4IDZA 1V9DA 4A98A 5J0ZA 1KNZA 4G2AA 2BJ0A 3FZMB 4CN4A 1HX8A 5AQOB 2K48A 3JADA 2W61A 5GONE 4EYUA 2XAQB 3O4XE 3UU4A 3LJCA 4U2YA 5LXBA 4C90A 5IYZE 3N9NA 3ABVA 2NP9A 1YW0A 2DL1A 3LFMA 3I1AA 4EAHA 3AB3B 4E7ZA 2VASA 4BQTA 3RIUC 4YJ3E 5HEUA 4H63H 2HN1A 3DP7A 3GMIA 3F2EA 4UVBB 4CN6A 2Y54A 1XDPA 2H89A 5EK3A 2AE9A 2OV9A 1XNRT 4ZXLA 3MKDA 2YK0A 4JI0T 4X20E 4YHHT 4A56A 1KF6A 4NUUA 3HR0A 1WLXA 2PJQA 2ZLYA 3P8CD 4NXMT 5M4YA 5LGTB 4EGWA 5HXHA 1XWMA 5AFMB 1VRBA 2M6BA 3PUWF 4NZBA 3B13A 1MMDA 2CE7A 2CBJA 1W09A 2EHOB 4DV4T 4IE5A 5ABHA 1OEDC 4X5TA 4EXTA 3P4SA 4AQFC 1D1AA 1H7CA 4YT0A 3KBTA 1HF8A 2X68A 3EABA 2N9DA 4HE8A 5C2TA 4ZI2C 2QC1B 5CFBA 4JI4T 2BBHA 3AVSA 3WTHA 3UUBA 2SPCA 2BS4A 4B3TT 4TWHA 2NR4A 3MXZA 3Q5EA 4P1NA 2QVAA 3C64A 5AQIB 5FYMA 5HXSA 4X64T 2I59A 3RF1A 3OTOT 2X00A 4GKJT 2PBIA 5KX5E 3DTOA 3P50A 2YINA 4TZ4C 3FZHB 3LBXA 4PJLA 4B5DA 4O2BE 3NRXA 1YXRA 3P4RA 3RKOA 4HWFA 2UUAT 3K3NA 2FJBA 1E1HB 2JMKA 3ZT5A 4GK5E 4F8HA 5AFNA 4ZI7E 1Z0PA 3CX6B 5CGMA 4ZI2D 4UM3A 1HG5A 1NWMX 4ALXA 2V7KA 1HR0T 3AXJA 1XZYA 5IHYA 1IAPA 5AQFB 2W62A 4DR3T 1WR6A 5AQQB 2WB5A 2WQYA 4HKAA 3CK6A 2WU5A 3OPCA 2WP9A 5JR9B 5LGUB 3GN5B 3ZMTB 5L3BB 2YKSA 4DUYT 3EAMA 2UXDT 4PAGA 3IF8B 5AQRB 4Z8XA 5JDGA 4WV9A 2OLTA 4ILAA 4UF0B 3WTJA 2UXCT 1G8XA 3WAJA 2KZ7B 3EDVA 1SE7A 2NW8A 5CA1E 4CZZB 3NVOA 4U3CA 3FZFB 3M65A 5FL1A 5HEJA 3F57A 4UV9B 2XQ5A 4IE6A 2K24A 4OX9T 5AQSB 1SUMB 3ZLIA 3PEOA 5IUXA 3N5LA 4AFTA 5HCJA 5AQNB 2VL8A 3ZMVB 1ZV4X 2MPKA 3HKCE 3MACA 4UXUA 5LHGB 2BG9A 2WDVA 3UUNA 2JRKA 2LLYA 1JNZA 4U74A 4AKRB 4ILBA 3N2KE 2Y56A 1BR1A 3ESLA 2WDQA 4O4LE 3J9X1 3WTOA 3KBUA 2PTFA 4PK5A 2CHNA 1ZOYA 1QSDA 2VVSA 1T8BA 3KVBA 3RLFF 2CA5A 2KMFA 4KBMB 2CLYC 2BYNA 3JAFA 4I0UA 1WCRA 4WBOA 4AKGA 4JI2T 2BG9E 3FZLB 3AA1B 4Z91A 4ISSA 3O1JA 3CQCB 4F6RC 2WZHA 1WFDA 5HXCA 2L3LA 1MMGA 3RIAA 4LMLA 4U7YA 2BR7A 4DR5T 4QAAA 2XUEA 2V1DB 1LKXA 2LOPA 3AEDA 2C5JA 4IDOA 2C5KT 4QKNA 5FVKA 3OYZA 1FIOA 3KV5A 1E7PA 4KMCA 3TLSA 4LF5T 3UU5A 1UV6A 3B57A 5A1LA 4WZXA 1NEKA 2C9TA 4PJJA 4TN7B 2L8KA 1UX4A 2LOSA 3RRCA 2CXFA 4GK0E 4L9IA 5AFKA 3LSVA 4AXPA 4UVAB 3HI2A 1UCUA 3FXDB 4O2AE 2JPFA 2LSIA 1KNPA 3LK2B 2H88A 3RGLA 5AQMB 2NTXA 1SHZC 3T1HT 2V8SV 2QA7A 3Q5DA 3ONJA 2LSGA 5LYJE 3HKBE 3RRWA 2QYWA 5JQGE 5AQPB 3V5UA 1KFYA 3OYXA 3ZT6A 2BKOA 2JQQA 2R6GF 4IE7A 4AIUA 3AEEA 5LGNB 3AAAB 3AEFA 3BQIA 3H3AA 3L3PA 2YDQA 2YU1A 4UIGA 4H9NC 3F31A 5HEGA 3C79A 4DBRA 2LJLA 1AJ3A 2W66A 5JDNA 2IUBA 4CI1B 1OEDA 4UF0A 1S35A 2CCQA 4AQFA 2E9XC 4WW0A 3KV6A 4A97A 2W4XA 3MK7C 3ONXA 4MFRA 1FJGT 3ZCIA 2LT3A 5AQKB
chains in the Genus database with same CATH topology
4B5DA 4BQTA 5CO5A 3UU8A 2XQ8A 4UXUA 4AFHA 2BG9A 3RHWA 5HEUA 5AFKA 3WTNA 3RQWA 4F8HA 1UW6A 5AFNA 3LSVA 2VL0A 2UZ6A 5J5HA 2X00D 4FRRA 2BG9B 2BYSA 3UU3A 4TWDA 2LLYA 2ZJVA 2Y54A 4QH5A 3WIPA 4TNVA 3EI0A 2YMDA 5AFJA 5BW2A 4HFEA 3U8MA 3RQUA 5AFHA 4ILBA 2W8GA 5KZUA 4ZK4A 2XQ7A 2M6IA 4UM3A 3U8KA 4HFDA 2Y58A 2Y56A 2Y7YA 2YMEA 3RIFA 4NPPA 3WTIA 2XQ6A 4DBMA 5LG3A 5J5GA 2XNTA 3WTOA 4QABA 4ALXA 1OEDE 2BYQA 4ZK1A 4ILCA 2WNJA 4BFQA 4AFGA 4ZZBA 5KE4A 4UM3P 3PMZA 2Y57A 5AFMA 4QH1A 2ZJUA 4QH4A 5HEOA 5HEHA 3SH1A 4IL9A 3UQ7A 5AFMB 2M6BA 5J5IA 3JAEA 3RI5A 2W8FA 2BYNA 3ZDHA 4Z90A 5BP0A 4NZBA 5L4EA 3WTKA 5AFLA 2WNCA 3JAFA 4IREA 3SQ6A 3GUAA 4UM1A 4D01A 5BRXA 2WN9A 5L4HA 4ZR6A 2XQ3A 2BG9E 2XYSA 3U8JA 1OEDC 3IGQA 4X5TA 3UU6A 4Z91A 2BYRA 2YKSA 5L47A 3C84A 3U8NA 4HFHA 3EAMA 2BYPA 3UQ4A 3WTLA 4HQPA 2LM2A 4WV9A 4ZJTA 4ILAA 4A98A 2XQ4A 4LMJA 5JMEA 5J0ZA 2WZYA 3WTJA 5FJVA 2PGZA 4IL4A 4EZ1A 2XYTA 4UM3S 2QC1B 3RIAA 4QACA 5CFBA 2XQ9A 2MAWA 4COFA 2BJ0A 2WNLA 2XZ6A 2XNVA 4LMLA 2BR7A 4HFCA 4QAAA 1I9BA 5AINA 5J5FA 5HCMA 2BG9C 3ZKRA 2XQAA 4HFIA 3WTHA 3UUBA 4TWHA 5HEJA 4TWFA 5SYOA 2XNUA 5HEGA 3C79A 3ZDGA 2YOEA 2XQ5A 2KSRA 3JADA 3P4WA 4UY2A 4XHEA 2PH9A 5TVCA 4PIRA 4LMKA 1OEDA 2YN6A 3T4MA 3UU4A 2BR8A 5LXBA 4XK9A 2LKHA 4HFBA 2X00A 4ZZCA 1OEDB 3SQ9A 3WTMA 4A97A 3PEOA 4ZRUA 4ZJSA 3TLVA 5IUXA 3TLSA 3P50A 3UU5A 1UV6A 4AFTA 1UX2A 5HCJA 2LKGA 3TLTA 3U8LA 2C9TA 2XZ5A 3TLWA 3EHZA 3TLUA 3SIOA 4TNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B5D A;  4BQT A;  5CO5 A;  3UU8 A;  2XQ8 A;  4UXU A;  4AFH A;  2BG9 A;  3RHW A;  5HEU A;  5AFK A;  3WTN A;  3RQW A;  4F8H A;  1UW6 A;  5AFN A;  3LSV A;  2VL0 A;  2UZ6 A;  5J5H A;  2X00 D;  4FRR A;  2BG9 B;  2BYS A;  3UU3 A;  4TWD A;  2LLY A;  2ZJV A;  2Y54 A;  4QH5 A;  3WIP A;  4TNV A;  3EI0 A;  2YMD A;  5AFJ A;  5BW2 A;  4HFE A;  3U8M A;  3RQU A;  5AFH A;  4ILB A;  2W8G A;  5KZU A;  4ZK4 A;  2XQ7 A;  2M6I A;  4UM3 A;  3U8K A;  4HFD A;  2Y58 A;  2Y56 A;  2Y7Y A;  2YME A;  3RIF A;  4NPP A;  3WTI A;  2XQ6 A;  4DBM A;  5LG3 A;  5J5G A;  2XNT A;  3WTO A;  4QAB A;  4ALX A;  1OED E;  2BYQ A;  4ZK1 A;  4ILC A;  2WNJ A;  4BFQ A;  4AFG A;  4ZZB A;  5KE4 A;  4UM3 P;  3PMZ A;  2Y57 A;  5AFM A;  4QH1 A;  2ZJU A;  4QH4 A;  5HEO A;  5HEH A;  3SH1 A;  4IL9 A;  3UQ7 A;  5AFM B;  2M6B A;  5J5I A;  3JAE A;  3RI5 A;  2W8F A;  2BYN A;  3ZDH A;  4Z90 A;  5BP0 A;  4NZB A;  5L4E A;  3WTK A;  5AFL A;  2WNC A;  3JAF A;  4IRE A;  3SQ6 A;  3GUA A;  4UM1 A;  4D01 A;  5BRX A;  2WN9 A;  5L4H A;  4ZR6 A;  2XQ3 A;  2BG9 E;  2XYS A;  3U8J A;  1OED C;  3IGQ A;  4X5T A;  3UU6 A;  4Z91 A;  2BYR A;  2YKS A;  5L47 A;  3C84 A;  3U8N A;  4HFH A;  3EAM A;  2BYP A;  3UQ4 A;  3WTL A;  4HQP A;  2LM2 A;  4WV9 A;  4ZJT A;  4ILA A;  4A98 A;  2XQ4 A;  4LMJ A;  5JME A;  5J0Z A;  2WZY A;  3WTJ A;  5FJV A;  2PGZ A;  4IL4 A;  4EZ1 A;  2XYT A;  4UM3 S;  2QC1 B;  3RIA A;  4QAC A;  5CFB A;  2XQ9 A;  2MAW A;  4COF A;  2BJ0 A;  2WNL A;  2XZ6 A;  2XNV A;  4LML A;  2BR7 A;  4HFC A;  4QAA A;  1I9B A;  5AIN A;  5J5F A;  5HCM A;  2BG9 C;  3ZKR A;  2XQA A;  4HFI A;  3WTH A;  3UUB A;  4TWH A;  5HEJ A;  4TWF A;  5SYO A;  2XNU A;  5HEG A;  3C79 A;  3ZDG A;  2YOE A;  2XQ5 A;  2KSR A;  3JAD A;  3P4W A;  4UY2 A;  4XHE A;  2PH9 A;  5TVC A;  4PIR A;  4LMK A;  1OED A;  2YN6 A;  3T4M A;  3UU4 A;  2BR8 A;  5LXB A;  4XK9 A;  2LKH A;  4HFB A;  2X00 A;  4ZZC A;  1OED B;  3SQ9 A;  3WTM A;  4A97 A;  3PEO A;  4ZRU A;  4ZJS A;  3TLV A;  5IUX A;  3TLS A;  3P50 A;  3UU5 A;  1UV6 A;  4AFT A;  1UX2 A;  5HCJ A;  2LKG A;  3TLT A;  3U8L A;  2C9T A;  2XZ5 A;  3TLW A;  3EHZ A;  3TLU A;  3SIO A;  4TNW A; 
#chains in the Genus database with same CATH topology
 1ZEE A;  3DJB A;  4L0R A;  3AA0 B;  2BZB A;  5CO5 A;  1ZHC A;  3LBX B;  3L8R A;  3O1H A;  2BYS A;  2CWY A;  4TWD A;  4YFS A;  3E22 E;  3ZN0 B;  2CWO A;  3C50 A;  4DBQ A;  1HTJ F;  5AFH A;  4X66 T;  1UUR A;  1D0X A;  3AE7 A;  3C4X A;  3VR9 A;  3RIF A;  3WTI A;  2JIW A;  5J5G A;  1OED E;  1US7 B;  3OBV E;  4BFQ A;  3CVR A;  4LF9 T;  3AXJ B;  4OYK A;  5FNV E;  4H9S E;  4DMV A;  3MJX A;  2E9X D;  2XZE A;  3KIN B;  4EYY R;  4UM1 A;  4D01 A;  4JEH B;  3N9Q A;  3C98 B;  2A72 A;  2X9Y A;  4MBQ A;  4JV5 T;  5H6R B;  3IGQ A;  4N78 D;  3UUX B;  4H9P C;  2WCA A;  4NUV A;  3FBL A;  3RC3 A;  2VWA A;  2XQ4 A;  5F8P A;  3FBZ A;  5JDM A;  5LB7 B;  2XZ6 A;  4WBN E;  1I9B A;  2KXP B;  2D0U A;  3UT5 E;  4CXY A;  4HEA A;  5FY0 A;  2UXN B;  2KSR A;  3AE5 A;  1MNE A;  3AE8 A;  4U7I A;  4HFV A;  5LHI B;  3RC8 A;  2BKP A;  4H9Q C;  2CRB A;  2X0Y A;  2JQH A;  3AAI A;  3ZSS A;  3VRA A;  4KUM B;  4JI6 T;  3VRB A;  2ZM0 A;  4AQG A;  2ACZ A;  5AQT B;  3T8O A;  5J5H A;  2BG9 B;  1CUN A;  4X1Y E;  4XZC A;  2ZJV A;  4TNV A;  5CA0 E;  4QHO A;  5FXV A;  4EZH A;  2VKD A;  2DWK A;  4HFD A;  1T98 A;  3AE4 A;  3KV4 A;  1QUU A;  2BYQ A;  1S94 A;  3NRY A;  4EIW A;  1UGO A;  4DV1 T;  4Q25 A;  3KFW X;  5JDH A;  3N9O A;  1XNQ T;  2MOZ A;  2WNC A;  2W67 A;  4A5X A;  3ZT7 A;  2BVL A;  2PFV A;  4H9O C;  3PUV F;  4KX6 A;  2HHH T;  2XSA A;  2CPT A;  4L5G A;  5IWA T;  3AA6 B;  4QWN B;  2W0G A;  2WDR A;  2X9X A;  4LMJ A;  5JME A;  5F3J A;  1N32 T;  3LDQ B;  1MIV A;  2C0S A;  4IDQ A;  1HNZ T;  1J5E T;  4UXN B;  4K0K T;  5LNK A;  3CX8 B;  5TVC A;  4PIR A;  2BS3 A;  1W0B A;  2BR8 A;  2N2N A;  4HFB A;  1D1C A;  5JVD E;  3SQ9 A;  4ZJS A;  3TLV A;  3E08 A;  3LG7 A;  5JTG A;  1U5P A;  2ODU A;  4PW8 A;  5JRC A;  2LRK A;  4KI0 F;  3S4U A;  1XDO A;  3FB2 A;  3ZJ2 A;  4ADZ A;  4WYV A;  4CN1 A;  4AKH A;  5FP3 A;  4CI2 B;  2Y7Y A;  2H3R A;  5F5W A;  1JNR A;  2PG8 A;  4OFZ A;  2DWG A;  4ZK1 A;  5L3G B;  2WNJ A;  2BDE A;  4YSY A;  4YY3 T;  4EOZ B;  3N9P A;  3K3O A;  3JAE A;  4DR6 T;  2W8F A;  3PJA J;  1IBK T;  1R8I A;  5BP0 A;  4IRE A;  4EZ4 A;  4PK6 A;  2BYR A;  3IA3 A;  1GQE A;  3C84 A;  1L0V A;  1WYC A;  3AAE B;  4HQP A;  4U72 A;  3QOF A;  4AQY T;  4DO0 A;  3C4Z A;  2RA1 A;  5L3F B;  1WRD A;  3SWH A;  2XQY A;  2F4V T;  3RYI E;  4XHE A;  4ZEY A;  1HS7 A;  4ANJ A;  1OED B;  2HPJ A;  4JBW F;  1I94 T;  4JEU B;  2LKG A;  3TLT A;  3U8L A;  3QK6 A;  3QB5 K;  3TLU A;  2A3D A;  2LSY A;  4EV6 A;  2RP4 A;  2MBG A;  3O9X A;  2MYS A;  4I55 E;  5AQV B;  1Y01 A;  3U3I A;  3PUA A;  4JI3 T;  2X51 A;  4JYA T;  2WSS V;  2X9H A;  2W8G A;  5LBM A;  4ZK4 A;  2E9X A;  2XSB A;  3QUJ A;  1E2A A;  1OWA A;  2DHR A;  5LOV E;  4LF4 T;  2UU9 T;  3AEC A;  4TV9 E;  3SRZ A;  4I4T E;  3RX6 A;  5AQH B;  2MTQ A;  1Y64 B;  2VKJ A;  1VOM A;  4YHJ A;  5JRE A;  2E8I A;  3G06 A;  1I6Z A;  3AEA A;  1HFA A;  2J1D G;  1MMN A;  2M67 A;  2XQ3 A;  2BKN A;  5LP6 E;  1EZ3 A;  4H9R C;  3I9Y A;  2WZI A;  2J4G A;  3CWZ B;  2LHN A;  3QB5 A;  4ZOL E;  4P0B A;  4BA9 A;  2IDO B;  2UXX B;  2VKO A;  4HFI A;  2W2U A;  4TWF A;  3ZMS B;  3SFE A;  2YN6 A;  3CML A;  3QNU A;  2LKH A;  4CQI A;  3R6N A;  1XMQ T;  3ZN1 B;  2XM2 A;  4ILU A;  2XZ5 A;  5DAB A;  1J1J A;  2WM9 A;  3UU8 A;  2Y48 B;  2FJD A;  1MMA A;  2FJA A;  5FY1 A;  4FRR A;  5HYA A;  3CKD A;  4GYS A;  3WIP A;  2IAK A;  3D0T A;  4QX8 B;  3H37 A;  1ZKE A;  3RYC E;  5KZU A;  4IDP A;  5ABG A;  2D9D A;  3CQX C;  3U8K A;  4IE0 A;  2IC6 A;  4X1K E;  2VUR A;  5HAX A;  4ASK A;  2WU2 A;  3FHN A;  1YQ4 A;  4WNK A;  4JLE A;  2D2S A;  3KDS E;  1M7K A;  4DR1 T;  5J2T E;  5BR8 T;  4NXN T;  3UQ7 A;  2XAS B;  5J5I A;  1LRZ A;  3OJA A;  4BJM A;  1W0A A;  2X0H A;  2WN9 A;  4HWC A;  2CMR A;  2VB6 A;  1LVF A;  1M62 A;  3RYF E;  1XMO T;  2VKH A;  4CXX A;  2VVN A;  4EED A;  3EUH A;  5BMV E;  4HFH A;  2BYP A;  2CEA A;  3WTL A;  3RIU A;  5HWX A;  2Q9Q C;  4ZJT A;  4DND A;  5J2U E;  4DV3 T;  4UM3 S;  3I0Q A;  1X9B A;  4DV5 T;  2Y8D A;  4HFC A;  3PUG A;  2H7O A;  2OA5 A;  2XQA A;  1FMV A;  5JDQ A;  4J2C A;  1SA0 E;  4JUY A;  5KMG P;  2CLY B;  4P09 A;  4GKK T;  2B1E A;  2HPL A;  2YDR A;  3IEE A;  4QXB B;  2LM9 A;  1N36 T;  4DV7 T;  2KIN B;  2XAH B;  3WTM A;  1IJ6 A;  3VR8 A;  3I9W A;  4XAX B;  4TV8 E;  3EHZ A;  4ZI3 C;  5CB4 E;  4G63 A;  1G73 A;  5AQJ B;  4DMW A;  3AE2 A;  5JRC B;  3WI3 A;  4EB6 E;  3L09 A;  2NW7 A;  4TUY E;  1N34 T;  2Q9Q D;  3WAK A;  3JCF A;  2V6Y B;  4YXD A;  2NTY A;  2XQ7 A;  2WS3 A;  2YME A;  1N33 T;  4ZHQ E;  1MIY A;  3FXE B;  3BQK A;  5LG3 A;  2XY8 B;  2WMN A;  4LF8 T;  2G0U A;  2DNX A;  3CX7 B;  5HEO A;  5HEH A;  2N1G A;  1YD8 G;  4NIQ A;  3SOL A;  2ES0 A;  2V7J A;  2K5B B;  2A2F X;  3GUA A;  3PV0 F;  2V7M A;  1HNW T;  2ZMA A;  3U8J A;  1OXZ A;  3Q5W A;  2HN2 A;  4ZI3 D;  1HNX T;  5L47 A;  3N2O A;  1BR2 A;  2AXD S;  3UQ4 A;  2X66 A;  4LF6 T;  1MND A;  3JC6 C;  2PGZ A;  4GIW A;  4IL4 A;  4EZ1 A;  2XYT A;  4EEB A;  3ANW B;  3B5M A;  3ZST A;  2Q9Q B;  3AE1 A;  3HKD E;  3ZKR A;  1VCS A;  3MA9 A;  4LMK A;  4MAL A;  4IGU A;  2LSJ A;  2QRX A;  1IZN B;  2DLR A;  3RPU A;  1KEY A;  5FVL A;  2CXD A;  1UX2 A;  2CHO A;  3NBX X;  4YSZ A;  4I43 B;  3RHW A;  3WTN A;  3A8Y C;  2IIU A;  2BVM A;  2EHO C;  4UEL A;  4QH5 A;  3JC6 D;  3AE6 A;  4PNI A;  1ZP0 A;  2E2A A;  2Y58 A;  5H6Q B;  5JH7 E;  4NPP A;  4DR4 T;  5HWY A;  3PUQ A;  2E9X B;  3ZYK A;  4B3S T;  4QAB A;  4ILC A;  3IHR A;  3PUX F;  4M1P A;  2LRL A;  3SH1 A;  2X0L B;  4CI3 B;  4DVD A;  2UUC T;  2X9W A;  5HXE A;  4JI8 T;  3GWH A;  1D0Z A;  1QLB A;  2I6H A;  4YSX A;  4E7S A;  5ABF B;  2JMH A;  5FJV A;  2EHO D;  4JI5 T;  4KHZ F;  4QAC A;  3H3M A;  4JI1 T;  2WNL A;  2ACX A;  3SFD A;  1D1B A;  4B6X A;  5C8Y E;  3E0Z A;  5KDM C;  5J5F A;  5LBQ B;  4DR7 T;  3BK9 A;  3K1S A;  1T72 A;  5LMU T;  2L9Q A;  2WWU A;  2DI4 A;  3T4M A;  3PUS A;  2XPK A;  3K8P C;  2I0M A;  4GYR A;  4ZRU A;  2LSK A;  2W63 A;  4YLH A;  4DV0 T;  2WMO A;  3TLW A;  3SIO A;  4TNW A;  3C51 A;  5KXJ A;  4AFH A;  1FEW A;  3L39 A;  3KV9 A;  3RKG A;  4IDN A;  2UZ6 A;  2LE8 A;  5LXT E;  3ZMU B;  1YKE B;  5JR9 C;  2V5D A;  4HFE A;  2VQF T;  5ABE A;  2BS2 A;  3CQG B;  3VU7 H;  4O4J E;  4IIJ E;  4DBM A;  4AI6 A;  4LFB T;  2FUP A;  3GA8 A;  5KE4 A;  3ETV A;  2KWI B;  5L3C B;  2Z6E A;  3NKZ A;  2Y57 A;  2LEH A;  1IBL T;  2V6Y A;  3PTR B;  2X67 A;  1MIW A;  5ETW A;  4DUZ T;  2V7L A;  4ZR6 A;  4FJO A;  1T7S A;  1J5W A;  4IHJ E;  4XBF B;  3PU3 A;  2V6X A;  4KHP T;  3EVY A;  5AQG B;  3VKG A;  3PUR A;  4UR9 A;  4HTE A;  2YDS A;  2KLQ A;  5FMN A;  1DU2 A;  3PUZ F;  1NEN A;  1IBM T;  2KWH A;  4DID B;  4FI5 A;  4U2Z A;  1Z8U A;  3VKH A;  4ZS2 A;  3CIR A;  2XNU A;  2DCF A;  4UEM A;  3K3Q C;  3P4W A;  2WWV A;  1WYB A;  3UTK A;  4O4H E;  3ANW A;  4ZZC A;  4AKI A;  3M3Z B;  2Q9Q A;  3UUL A;  5EZY E;  4YTM A;  2RPA A;  3AEG A;  2VK9 A;  5L3D B;  1B7T A;  4ZS3 A;  3HKE E;  4GOU A;  3HA4 A;  3ONL C;  3U8M A;  3RQU A;  2M6I A;  3LK3 B;  2Y6X A;  2BBJ A;  1NAF A;  4O4I E;  1HCI A;  3CPZ A;  2P9B A;  4UVC B;  4ZZB A;  3AE3 A;  2YEV C;  3RI5 A;  1IJ5 A;  5LG4 A;  2ZM2 A;  3AVR A;  5FXW A;  2C5I T;  3ZPO A;  1UK5 A;  2UXB T;  3Q2M A;  3RYH E;  3UU6 A;  3HL6 A;  2XM1 A;  3UFE A;  4MHC A;  4DV2 T;  2IC9 A;  2WZY A;  3PDY A;  4P0A A;  2CBI A;  2K9A A;  2XAF B;  3ZMZ B;  5LJN A;  4LF7 T;  3N9L A;  4B3M T;  3ZDG A;  5ABF A;  2JJ9 A;  3Q5X A;  4K0U A;  2LHR A;  2JQK A;  3PUY F;  5FXX A;  2XHE B;  3NZP A;  2ZM6 T;  2D5U A;  2ODV A;  3ETU A;  5HXR A;  5LJM A;  2NOX A;  3FZK B;  2D0T A;  3A7M A;  4IT4 A;  2J47 A;  4IST A;  5EK4 A;  2CXL A;  3X1D A;  2E5L T;  2WAU A;  3RQW A;  3LK4 2;  1KNR A;  3N9M A;  2A9U A;  2VL0 A;  4UV8 B;  4BAY B;  3EI0 A;  5AFJ A;  5L2L A;  1BR4 A;  5DQW A;  1HG2 A;  4HWD A;  3Q9D A;  2XQ6 A;  2XNT A;  4UM3 P;  3PMZ A;  3PU8 A;  5FL0 A;  1D0Y A;  4PK4 A;  5AFM A;  4IE4 A;  2CM0 A;  5E0O A;  4DV6 T;  4IL9 A;  5L3E B;  3QC9 A;  4QXC B;  3T1Y T;  3BQL A;  4DR2 T;  2EHO A;  4Z90 A;  3OVU A;  3SQ6 A;  5AQL B;  5L4H A;  5EK2 A;  3ZCJ A;  5DQV A;  4TX5 A;  3VHL A;  4HWI B;  3U8N A;  4YTP A;  2W00 A;  2KND A;  2XTL A;  4ERR A;  4I50 E;  1UUS A;  4QX7 B;  1FMW A;  4PFO A;  3ZJ1 A;  4COF A;  2XAG B;  4HWH A;  2XNV A;  4CXW A;  5AIN A;  3NZQ A;  1U4Q A;  3UFG A;  5SYO A;  2YOE A;  4V1A v;  4UY2 A;  3KVA A;  2JQ9 A;  4H63 V;  2VQE T;  4OHF A;  5J1G A;  4O8S A;  2V5C A;  3AA7 B;  5FY7 A;  3I0O A;  5LHH B;  1W9R A;  2B76 A;  2GK9 A;  3J7Y q;  5TAO A;  2X00 D;  3AE9 A;  3UU3 A;  3ZYM A;  2E5V A;  5BW2 A;  5FKY A;  1LVK A;  1WR0 A;  3A5X A;  2KT9 A;  3U78 A;  2FBW A;  1HX1 B;  3O1I A;  4LFA T;  2H7V C;  3ZC0 A;  2YU2 A;  3P7I A;  3ZEF B;  1CHU A;  1KK7 A;  4BJN A;  4QH4 A;  3W15 B;  2K3W A;  3ZDH A;  3WTK A;  4X1I E;  4LFC T;  5JR9 A;  2NW9 A;  4AIS A;  5BRX A;  2NWB A;  2WY2 A;  3GN5 A;  4OYJ A;  2V26 A;  3EDU A;  3PE0 A;  4X65 T;  3ZYL A;  2LM2 A;  4PJM A;  4C91 A;  2XAJ B;  4AKL A;  1BR0 A;  5CJ5 A;  4HGA A;  4YJ2 E;  2XQ9 A;  2MAW A;  2ZM8 A;  3PJA A;  1YQ3 A;  5LMN T;  2BG9 C;  5HCM A;  2XJ7 A;  3P4Q A;  3P4P A;  2PH9 A;  3ZC1 A;  4JI7 T;  2HH7 A;  4XK9 A;  1O3X A;  3TKL B;  5ADX L;  4MLK A;  3R84 B;  3AEB A;  1UX5 A;  3V5S A;  2QGS A;  3IBP A;  2IML A;  3MZK B;  5AQU B;  2XQ8 A;  4X62 T;  1VCT A;  5JDL A;  3NWI A;  2UUB T;  1UW6 A;  4KP3 C;  2FJE A;  2IHR 1;  5FXZ A;  3OKQ A;  2YMD A;  3C4W A;  5LCY A;  4U31 A;  3UUM A;  2J62 A;  5AFU L;  5DJQ C;  4QXH B;  4AFG A;  3N2G E;  1X79 A;  4QH1 A;  2ZJU A;  4U33 A;  5C3J A;  5LA6 E;  2WBL A;  1YKH B;  3RH3 A;  4YTN A;  2IW5 B;  4PJN A;  5L4E A;  4B3R T;  5AFL A;  4HN9 A;  4PFP A;  2XYS A;  3SS1 A;  4OK0 A;  2V7I A;  5JDF A;  4IDZ A;  1V9D A;  4A98 A;  5J0Z A;  1KNZ A;  4G2A A;  2BJ0 A;  3FZM B;  4CN4 A;  1HX8 A;  5AQO B;  2K48 A;  3JAD A;  2W61 A;  5GON E;  4EYU A;  2XAQ B;  3O4X E;  3UU4 A;  3LJC A;  4U2Y A;  5LXB A;  4C90 A;  5IYZ E;  3N9N A;  3ABV A;  2NP9 A;  1YW0 A;  2DL1 A;  3LFM A;  3I1A A;  4EAH A;  3AB3 B;  4E7Z A;  2VAS A;  4BQT A;  3RIU C;  4YJ3 E;  5HEU A;  4H63 H;  2HN1 A;  3DP7 A;  3GMI A;  3F2E A;  4UVB B;  4CN6 A;  2Y54 A;  1XDP A;  2H89 A;  5EK3 A;  2AE9 A;  2OV9 A;  1XNR T;  4ZXL A;  3MKD A;  2YK0 A;  4JI0 T;  4X20 E;  4YHH T;  4A56 A;  1KF6 A;  4NUU A;  3HR0 A;  1WLX A;  2PJQ A;  2ZLY A;  3P8C D;  4NXM T;  5M4Y A;  5LGT B;  4EGW A;  5HXH A;  1XWM A;  5AFM B;  1VRB A;  2M6B A;  3PUW F;  4NZB A;  3B13 A;  1MMD A;  2CE7 A;  2CBJ A;  1W09 A;  2EHO B;  4DV4 T;  4IE5 A;  5ABH A;  1OED C;  4X5T A;  4EXT A;  3P4S A;  4AQF C;  1D1A A;  1H7C A;  4YT0 A;  3KBT A;  1HF8 A;  2X68 A;  3EAB A;  2N9D A;  4HE8 A;  5C2T A;  4ZI2 C;  2QC1 B;  5CFB A;  4JI4 T;  2BBH A;  3AVS A;  3WTH A;  3UUB A;  2SPC A;  2BS4 A;  4B3T T;  4TWH A;  2NR4 A;  3MXZ A;  3Q5E A;  4P1N A;  2QVA A;  3C64 A;  5AQI B;  5FYM A;  5HXS A;  4X64 T;  2I59 A;  3RF1 A;  3OTO T;  2X00 A;  4GKJ T;  2PBI A;  5KX5 E;  3DTO A;  3P50 A;  2YIN A;  4TZ4 C;  3FZH B;  3LBX A;  4PJL A;  4B5D A;  4O2B E;  3NRX A;  1YXR A;  3P4R A;  3RKO A;  4HWF A;  2UUA T;  3K3N A;  2FJB A;  1E1H B;  2JMK A;  3ZT5 A;  4GK5 E;  4F8H A;  5AFN A;  4ZI7 E;  1Z0P A;  3CX6 B;  5CGM A;  4ZI2 D;  4UM3 A;  1HG5 A;  1NWM X;  4ALX A;  2V7K A;  1HR0 T;  3AXJ A;  1XZY A;  5IHY A;  1IAP A;  5AQF B;  2W62 A;  4DR3 T;  1WR6 A;  5AQQ B;  2WB5 A;  2WQY A;  4HKA A;  3CK6 A;  2WU5 A;  3OPC A;  2WP9 A;  5JR9 B;  5LGU B;  3GN5 B;  3ZMT B;  5L3B B;  2YKS A;  4DUY T;  3EAM A;  2UXD T;  4PAG A;  3IF8 B;  5AQR B;  4Z8X A;  5JDG A;  4WV9 A;  2OLT A;  4ILA A;  4UF0 B;  3WTJ A;  2UXC T;  1G8X A;  3WAJ A;  2KZ7 B;  3EDV A;  1SE7 A;  2NW8 A;  5CA1 E;  4CZZ B;  3NVO A;  4U3C A;  3FZF B;  3M65 A;  5FL1 A;  5HEJ A;  3F57 A;  4UV9 B;  2XQ5 A;  4IE6 A;  2K24 A;  4OX9 T;  5AQS B;  1SUM B;  3ZLI A;  3PEO A;  5IUX A;  3N5L A;  4AFT A;  5HCJ A;  5AQN B;  2VL8 A;  3ZMV B;  1ZV4 X;  2MPK A;  3HKC E;  3MAC A;  4UXU A;  5LHG B;  2BG9 A;  2WDV A;  3UUN A;  2JRK A;  2LLY A;  1JNZ A;  4U74 A;  4AKR B;  4ILB A;  3N2K E;  2Y56 A;  1BR1 A;  3ESL A;  2WDQ A;  4O4L E;  3J9X 1;  3WTO A;  3KBU A;  2PTF A;  4PK5 A;  2CHN A;  1ZOY A;  1QSD A;  2VVS A;  1T8B A;  3KVB A;  3RLF F;  2CA5 A;  2KMF A;  4KBM B;  2CLY C;  2BYN A;  3JAF A;  4I0U A;  1WCR A;  4WBO A;  4AKG A;  4JI2 T;  2BG9 E;  3FZL B;  3AA1 B;  4Z91 A;  4ISS A;  3O1J A;  3CQC B;  4F6R C;  2WZH A;  1WFD A;  5HXC A;  2L3L A;  1MMG A;  3RIA A;  4LML A;  4U7Y A;  2BR7 A;  4DR5 T;  4QAA A;  2XUE A;  2V1D B;  1LKX A;  2LOP A;  3AED A;  2C5J A;  4IDO A;  2C5K T;  4QKN A;  5FVK A;  3OYZ A;  1FIO A;  3KV5 A;  1E7P A;  4KMC A;  3TLS A;  4LF5 T;  3UU5 A;  1UV6 A;  3B57 A;  5A1L A;  4WZX A;  1NEK A;  2C9T A;  4PJJ A;  4TN7 B;  2L8K A;  1UX4 A;  2LOS A;  3RRC A;  2CXF A;  4GK0 E;  4L9I A;  5AFK A;  3LSV A;  4AXP A;  4UVA B;  3HI2 A;  1UCU A;  3FXD B;  4O2A E;  2JPF A;  2LSI A;  1KNP A;  3LK2 B;  2H88 A;  3RGL A;  5AQM B;  2NTX A;  1SHZ C;  3T1H T;  2V8S V;  2QA7 A;  3Q5D A;  3ONJ A;  2LSG A;  5LYJ E;  3HKB E;  3RRW A;  2QYW A;  5JQG E;  5AQP B;  3V5U A;  1KFY A;  3OYX A;  3ZT6 A;  2BKO A;  2JQQ A;  2R6G F;  4IE7 A;  4AIU A;  3AEE A;  5LGN B;  3AAA B;  3AEF A;  3BQI A;  3H3A A;  3L3P A;  2YDQ A;  2YU1 A;  4UIG A;  4H9N C;  3F31 A;  5HEG A;  3C79 A;  4DBR A;  2LJL A;  1AJ3 A;  2W66 A;  5JDN A;  2IUB A;  4CI1 B;  1OED A;  4UF0 A;  1S35 A;  2CCQ A;  4AQF A;  2E9X C;  4WW0 A;  3KV6 A;  4A97 A;  2W4X A;  3MK7 C;  3ONX A;  4MFR A;  1FJG T;  3ZCI A;  2LT3 A;  5AQK B; 
#chains in the Genus database with same CATH homology
 4B5D A;  4BQT A;  5CO5 A;  3UU8 A;  2XQ8 A;  4UXU A;  4AFH A;  2BG9 A;  3RHW A;  5HEU A;  5AFK A;  3WTN A;  3RQW A;  4F8H A;  1UW6 A;  5AFN A;  3LSV A;  2VL0 A;  2UZ6 A;  5J5H A;  2X00 D;  4FRR A;  2BG9 B;  2BYS A;  3UU3 A;  4TWD A;  2LLY A;  2ZJV A;  2Y54 A;  4QH5 A;  3WIP A;  4TNV A;  3EI0 A;  2YMD A;  5AFJ A;  5BW2 A;  4HFE A;  3U8M A;  3RQU A;  5AFH A;  4ILB A;  2W8G A;  5KZU A;  4ZK4 A;  2XQ7 A;  2M6I A;  4UM3 A;  3U8K A;  4HFD A;  2Y58 A;  2Y56 A;  2Y7Y A;  2YME A;  3RIF A;  4NPP A;  3WTI A;  2XQ6 A;  4DBM A;  5LG3 A;  5J5G A;  2XNT A;  3WTO A;  4QAB A;  4ALX A;  1OED E;  2BYQ A;  4ZK1 A;  4ILC A;  2WNJ A;  4BFQ A;  4AFG A;  4ZZB A;  5KE4 A;  4UM3 P;  3PMZ A;  2Y57 A;  5AFM A;  4QH1 A;  2ZJU A;  4QH4 A;  5HEO A;  5HEH A;  3SH1 A;  4IL9 A;  3UQ7 A;  5AFM B;  2M6B A;  5J5I A;  3JAE A;  3RI5 A;  2W8F A;  2BYN A;  3ZDH A;  4Z90 A;  5BP0 A;  4NZB A;  5L4E A;  3WTK A;  5AFL A;  2WNC A;  3JAF A;  4IRE A;  3SQ6 A;  3GUA A;  4UM1 A;  4D01 A;  5BRX A;  2WN9 A;  5L4H A;  4ZR6 A;  2XQ3 A;  2BG9 E;  2XYS A;  3U8J A;  1OED C;  3IGQ A;  4X5T A;  3UU6 A;  4Z91 A;  2BYR A;  2YKS A;  5L47 A;  3C84 A;  3U8N A;  4HFH A;  3EAM A;  2BYP A;  3UQ4 A;  3WTL A;  4HQP A;  2LM2 A;  4WV9 A;  4ZJT A;  4ILA A;  4A98 A;  2XQ4 A;  4LMJ A;  5JME A;  5J0Z A;  2WZY A;  3WTJ A;  5FJV A;  2PGZ A;  4IL4 A;  4EZ1 A;  2XYT A;  4UM3 S;  2QC1 B;  3RIA A;  4QAC A;  5CFB A;  2XQ9 A;  2MAW A;  4COF A;  2BJ0 A;  2WNL A;  2XZ6 A;  2XNV A;  4LML A;  2BR7 A;  4HFC A;  4QAA A;  1I9B A;  5AIN A;  5J5F A;  5HCM A;  2BG9 C;  3ZKR A;  2XQA A;  4HFI A;  3WTH A;  3UUB A;  4TWH A;  5HEJ A;  4TWF A;  5SYO A;  2XNU A;  5HEG A;  3C79 A;  3ZDG A;  2YOE A;  2XQ5 A;  2KSR A;  3JAD A;  3P4W A;  4UY2 A;  4XHE A;  2PH9 A;  5TVC A;  4PIR A;  4LMK A;  1OED A;  2YN6 A;  3T4M A;  3UU4 A;  2BR8 A;  5LXB A;  4XK9 A;  2LKH A;  4HFB A;  2X00 A;  4ZZC A;  1OED B;  3SQ9 A;  3WTM A;  4A97 A;  3PEO A;  4ZRU A;  4ZJS A;  3TLV A;  5IUX A;  3TLS A;  3P50 A;  3UU5 A;  1UV6 A;  4AFT A;  1UX2 A;  5HCJ A;  2LKG A;  3TLT A;  3U8L A;  2C9T A;  2XZ5 A;  3TLW A;  3EHZ A;  3TLU A;  3SIO A;  4TNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...