4XK9A

Crystal structure of a-achbp in complex with pinnatoxin g
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
210
structure length
210
Chain Sequence
KLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein
molecule keywords Soluble acetylcholine receptor
publication title Marine Macrocyclic Imines, Pinnatoxins A and G: Structural Determinants and Functional Properties to Distinguish Neuronal alpha 7 from Muscle alpha 12 beta gamma delta nAChRs.
pubmed doi rcsb
source organism Aplysia californica
total genus 50
structure length 210
sequence length 210
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4xk9A00
2XQ9A 4NZBA 3U8JA 3C84A 5HEHA 5TVCA 2BYRA 3SIOA 2Y7YA 4HQPA 4FRRA 5HEGA 5J5HA 3JAFA 2Y56A 4UM1A 2XNVA 4HFEA 5HEUA 3TLUA 4ZK4A 3UQ4A 5L4HA 2XZ6A 2XQ3A 3TLVA 3WTIA 4COFA 2BYSA 5HEOA 4NPPA 4TWDA 3UUBA 3ZDHA 4UM3S 4HFHA 4Z90A 3SQ9A 4A98A 5J5FA 2BR7A 3U8LA 4ILBA 3UU4A 2BYQA 5AFJA 4LMJA 5AINA 5BRXA 4AFHA 3LSVA 2Y54A 2YMEA 4TWHA 4ZK1A 4QABA 2UZ6A 2YMDA 3U8NA 5BW2A 2X00D 2WNJA 3U8MA 4UM3A 2ZJUA 2BG9A 3JAEA 3WTNA 4DBMA 3PMZA 5JMEA 1UW6A 4B5DA 3RQUA 2PGZA 4Z91A 4QAAA 5CO5A 4A97A 4QH4A 5AFMB 3RIFA 3TLSA 4ILCA 5L4EA 1UX2A 5HCJA 3RIAA 5AFNA 2BYPA 1UV6A 3WIPA 3WTMA 3UU6A 3UQ7A 1I9BA 2YOEA 3RHWA 4HFCA 2Y58A 4IREA 2Y57A 5FJVA 4F8HA 4ZZBA 2BYNA 4LMLA 3WTJA 2XQAA 3WTHA 4UXUA 3PEOA 5KZUA 3ZDGA 4XHEA 3U8KA 5CFBA 2WNCA 2XQ5A 3RI5A 5LG3A 5AFMA 2W8GA 2X00A 5BP0A 5HCMA 4HFDA 2XNTA 4ZJSA 4AFGA 4QACA 4LMKA 4PIRA 4ALXA 2YKSA 3EAMA 4ZJTA 2VL0A 5J5GA 2C9TA 5SYOA 2WZYA 3EI0A 5IUXA 2BG9E 4IL9A 3RQWA 4ZR6A 5AFLA 5AFHA 2QC1B 4UM3P 3JADA 2XQ4A 2BG9C 2XQ6A 2WNLA 3P50A 5KE4A 4ZRUA 4ZZCA 3TLWA 3UU8A 3SQ6A 4TNWA 2YN6A 3GUAA 4EZ1A 2XZ5A 5L47A 3IGQA 5LXBA 2ZJVA 5J5IA 2BR8A 3SH1A 4HFBA 4X5TA 2XQ8A 4BQTA 3WTKA 4WV9A 3ZKRA 4QH1A 2BG9B 3WTOA 4HFIA 3UU5A 4BFQA 2BJ0A 4D01A 5AFKA 2XQ7A 4XK9A 4ILAA 4TNVA 2XYSA 2PH9A 3UU3A 2XNUA 4IL4A 2WN9A 4UY2A 3EHZA 5J0ZA 3P4WA 2XYTA 3TLTA 4AFTA 3C79A 4QH5A 3WTLA 4TWFA 3T4MA 5HEJA 2W8FA
chains in the Genus database with same CATH superfamily
2XQ9A 4NZBA 3U8JA 3C84A 5HEHA 5TVCA 2BYRA 3SIOA 2Y7YA 4HQPA 4FRRA 5HEGA 5J5HA 3JAFA 2Y56A 4UM1A 2XNVA 4HFEA 5HEUA 3TLUA 4ZK4A 3UQ4A 5L4HA 2XZ6A 2XQ3A 3TLVA 3WTIA 4COFA 2BYSA 5HEOA 4NPPA 4TWDA 3UUBA 3ZDHA 4UM3S 4HFHA 4Z90A 3SQ9A 4A98A 5J5FA 2BR7A 3U8LA 4ILBA 3UU4A 2BYQA 5AFJA 4LMJA 5AINA 5BRXA 4AFHA 3LSVA 2Y54A 2YMEA 4TWHA 4ZK1A 4QABA 2UZ6A 2YMDA 3U8NA 5BW2A 2X00D 2WNJA 3U8MA 4UM3A 2ZJUA 2BG9A 3JAEA 3WTNA 4DBMA 3PMZA 5JMEA 1UW6A 4B5DA 3RQUA 2PGZA 4Z91A 4QAAA 5CO5A 4A97A 4QH4A 5AFMB 3RIFA 3TLSA 4ILCA 5L4EA 1UX2A 5HCJA 3RIAA 5AFNA 2BYPA 1UV6A 3WIPA 3WTMA 3UU6A 3UQ7A 1I9BA 2YOEA 3RHWA 4HFCA 2Y58A 4IREA 2Y57A 5FJVA 4F8HA 4ZZBA 2BYNA 4LMLA 3WTJA 2XQAA 3WTHA 4UXUA 3PEOA 5KZUA 3ZDGA 4XHEA 3U8KA 5CFBA 2WNCA 2XQ5A 3RI5A 5LG3A 5AFMA 2W8GA 2X00A 5BP0A 5HCMA 4HFDA 2XNTA 4ZJSA 4AFGA 4QACA 4LMKA 4PIRA 4ALXA 2YKSA 3EAMA 4ZJTA 2VL0A 5J5GA 2C9TA 5SYOA 2WZYA 3EI0A 5IUXA 2BG9E 4IL9A 3RQWA 4ZR6A 5AFLA 5AFHA 2QC1B 4UM3P 3JADA 2XQ4A 2BG9C 2XQ6A 2WNLA 3P50A 5KE4A 4ZRUA 4ZZCA 3TLWA 3UU8A 3SQ6A 4TNWA 2YN6A 3GUAA 4EZ1A 2XZ5A 5L47A 3IGQA 5LXBA 2ZJVA 5J5IA 2BR8A 3SH1A 4HFBA 4X5TA 2XQ8A 4BQTA 3WTKA 4WV9A 3ZKRA 4QH1A 2BG9B 3WTOA 4HFIA 3UU5A 4BFQA 2BJ0A 4D01A 5AFKA 2XQ7A 4XK9A 4ILAA 4TNVA 2XYSA 2PH9A 3UU3A 2XNUA 4IL4A 2WN9A 4UY2A 3EHZA 5J0ZA 3P4WA 2XYTA 3TLTA 4AFTA 3C79A 4QH5A 3WTLA 4TWFA 3T4MA 5HEJA 2W8FA
chains in the Genus database with same CATH topology
2XQ9A 4NZBA 3U8JA 3C84A 5HEHA 5TVCA 2BYRA 3SIOA 2Y7YA 4HQPA 4FRRA 5HEGA 5J5HA 3JAFA 2Y56A 4UM1A 2XNVA 4HFEA 5HEUA 3TLUA 4ZK4A 3UQ4A 5L4HA 2XZ6A 2XQ3A 3TLVA 3WTIA 4COFA 2BYSA 5HEOA 4NPPA 4TWDA 3UUBA 3ZDHA 4UM3S 4HFHA 4Z90A 3SQ9A 4A98A 5J5FA 2BR7A 3U8LA 4ILBA 3UU4A 2BYQA 5AFJA 4LMJA 5AINA 5BRXA 4AFHA 3LSVA 2Y54A 2YMEA 4TWHA 4ZK1A 4QABA 2UZ6A 2YMDA 3U8NA 5BW2A 2X00D 2WNJA 3U8MA 4UM3A 2ZJUA 2BG9A 3JAEA 3WTNA 4DBMA 3PMZA 5JMEA 1UW6A 4B5DA 3RQUA 2PGZA 4Z91A 4QAAA 5CO5A 4A97A 4QH4A 5AFMB 3RIFA 3TLSA 4ILCA 5L4EA 1UX2A 5HCJA 3RIAA 5AFNA 2BYPA 1UV6A 3WIPA 3WTMA 3UU6A 3UQ7A 1I9BA 2YOEA 3RHWA 4HFCA 2Y58A 4IREA 2Y57A 5FJVA 4F8HA 4ZZBA 2BYNA 4LMLA 3WTJA 2XQAA 3WTHA 4UXUA 3PEOA 5KZUA 3ZDGA 4XHEA 3U8KA 5CFBA 2WNCA 2XQ5A 3RI5A 5LG3A 5AFMA 2W8GA 2X00A 5BP0A 5HCMA 4HFDA 2XNTA 4ZJSA 4AFGA 4QACA 4LMKA 4PIRA 4ALXA 2YKSA 3EAMA 4ZJTA 2VL0A 5J5GA 2C9TA 5SYOA 2WZYA 3EI0A 5IUXA 2BG9E 4IL9A 3RQWA 4ZR6A 5AFLA 5AFHA 2QC1B 4UM3P 3JADA 2XQ4A 2BG9C 2XQ6A 2WNLA 3P50A 5KE4A 4ZRUA 4ZZCA 3TLWA 3UU8A 3SQ6A 4TNWA 2YN6A 3GUAA 4EZ1A 2XZ5A 5L47A 3IGQA 5LXBA 2ZJVA 5J5IA 2BR8A 3SH1A 4HFBA 4X5TA 2XQ8A 4BQTA 3WTKA 4WV9A 3ZKRA 4QH1A 2BG9B 3WTOA 4HFIA 3UU5A 4BFQA 2BJ0A 4D01A 5AFKA 2XQ7A 4XK9A 4ILAA 4TNVA 2XYSA 2PH9A 3UU3A 2XNUA 4IL4A 2WN9A 4UY2A 3EHZA 5J0ZA 3P4WA 2XYTA 3TLTA 4AFTA 3C79A 4QH5A 3WTLA 4TWFA 3T4MA 5HEJA 2W8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ9 A;  4NZB A;  3U8J A;  3C84 A;  5HEH A;  5TVC A;  2BYR A;  3SIO A;  2Y7Y A;  4HQP A;  4FRR A;  5HEG A;  5J5H A;  3JAF A;  2Y56 A;  4UM1 A;  2XNV A;  4HFE A;  5HEU A;  3TLU A;  4ZK4 A;  3UQ4 A;  5L4H A;  2XZ6 A;  2XQ3 A;  3TLV A;  3WTI A;  4COF A;  2BYS A;  5HEO A;  4NPP A;  4TWD A;  3UUB A;  3ZDH A;  4UM3 S;  4HFH A;  4Z90 A;  3SQ9 A;  4A98 A;  5J5F A;  2BR7 A;  3U8L A;  4ILB A;  3UU4 A;  2BYQ A;  5AFJ A;  4LMJ A;  5AIN A;  5BRX A;  4AFH A;  3LSV A;  2Y54 A;  2YME A;  4TWH A;  4ZK1 A;  4QAB A;  2UZ6 A;  2YMD A;  3U8N A;  5BW2 A;  2X00 D;  2WNJ A;  3U8M A;  4UM3 A;  2ZJU A;  2BG9 A;  3JAE A;  3WTN A;  4DBM A;  3PMZ A;  5JME A;  1UW6 A;  4B5D A;  3RQU A;  2PGZ A;  4Z91 A;  4QAA A;  5CO5 A;  4A97 A;  4QH4 A;  5AFM B;  3RIF A;  3TLS A;  4ILC A;  5L4E A;  1UX2 A;  5HCJ A;  3RIA A;  5AFN A;  2BYP A;  1UV6 A;  3WIP A;  3WTM A;  3UU6 A;  3UQ7 A;  1I9B A;  2YOE A;  3RHW A;  4HFC A;  2Y58 A;  4IRE A;  2Y57 A;  5FJV A;  4F8H A;  4ZZB A;  2BYN A;  4LML A;  3WTJ A;  2XQA A;  3WTH A;  4UXU A;  3PEO A;  5KZU A;  3ZDG A;  4XHE A;  3U8K A;  5CFB A;  2WNC A;  2XQ5 A;  3RI5 A;  5LG3 A;  5AFM A;  2W8G A;  2X00 A;  5BP0 A;  5HCM A;  4HFD A;  2XNT A;  4ZJS A;  4AFG A;  4QAC A;  4LMK A;  4PIR A;  4ALX A;  2YKS A;  3EAM A;  4ZJT A;  2VL0 A;  5J5G A;  2C9T A;  5SYO A;  2WZY A;  3EI0 A;  5IUX A;  2BG9 E;  4IL9 A;  3RQW A;  4ZR6 A;  5AFL A;  5AFH A;  2QC1 B;  4UM3 P;  3JAD A;  2XQ4 A;  2BG9 C;  2XQ6 A;  2WNL A;  3P50 A;  5KE4 A;  4ZRU A;  4ZZC A;  3TLW A;  3UU8 A;  3SQ6 A;  4TNW A;  2YN6 A;  3GUA A;  4EZ1 A;  2XZ5 A;  5L47 A;  3IGQ A;  5LXB A;  2ZJV A;  5J5I A;  2BR8 A;  3SH1 A;  4HFB A;  4X5T A;  2XQ8 A;  4BQT A;  3WTK A;  4WV9 A;  3ZKR A;  4QH1 A;  2BG9 B;  3WTO A;  4HFI A;  3UU5 A;  4BFQ A;  2BJ0 A;  4D01 A;  5AFK A;  2XQ7 A;  4XK9 A;  4ILA A;  4TNV A;  2XYS A;  2PH9 A;  3UU3 A;  2XNU A;  4IL4 A;  2WN9 A;  4UY2 A;  3EHZ A;  5J0Z A;  3P4W A;  2XYT A;  3TLT A;  4AFT A;  3C79 A;  4QH5 A;  3WTL A;  4TWF A;  3T4M A;  5HEJ A;  2W8F A; 
#chains in the Genus database with same CATH topology
 2XQ9 A;  4NZB A;  3U8J A;  3C84 A;  5HEH A;  5TVC A;  2BYR A;  3SIO A;  2Y7Y A;  4HQP A;  4FRR A;  5HEG A;  5J5H A;  3JAF A;  2Y56 A;  4UM1 A;  2XNV A;  4HFE A;  5HEU A;  3TLU A;  4ZK4 A;  3UQ4 A;  5L4H A;  2XZ6 A;  2XQ3 A;  3TLV A;  3WTI A;  4COF A;  2BYS A;  5HEO A;  4NPP A;  4TWD A;  3UUB A;  3ZDH A;  4UM3 S;  4HFH A;  4Z90 A;  3SQ9 A;  4A98 A;  5J5F A;  2BR7 A;  3U8L A;  4ILB A;  3UU4 A;  2BYQ A;  5AFJ A;  4LMJ A;  5AIN A;  5BRX A;  4AFH A;  3LSV A;  2Y54 A;  2YME A;  4TWH A;  4ZK1 A;  4QAB A;  2UZ6 A;  2YMD A;  3U8N A;  5BW2 A;  2X00 D;  2WNJ A;  3U8M A;  4UM3 A;  2ZJU A;  2BG9 A;  3JAE A;  3WTN A;  4DBM A;  3PMZ A;  5JME A;  1UW6 A;  4B5D A;  3RQU A;  2PGZ A;  4Z91 A;  4QAA A;  5CO5 A;  4A97 A;  4QH4 A;  5AFM B;  3RIF A;  3TLS A;  4ILC A;  5L4E A;  1UX2 A;  5HCJ A;  3RIA A;  5AFN A;  2BYP A;  1UV6 A;  3WIP A;  3WTM A;  3UU6 A;  3UQ7 A;  1I9B A;  2YOE A;  3RHW A;  4HFC A;  2Y58 A;  4IRE A;  2Y57 A;  5FJV A;  4F8H A;  4ZZB A;  2BYN A;  4LML A;  3WTJ A;  2XQA A;  3WTH A;  4UXU A;  3PEO A;  5KZU A;  3ZDG A;  4XHE A;  3U8K A;  5CFB A;  2WNC A;  2XQ5 A;  3RI5 A;  5LG3 A;  5AFM A;  2W8G A;  2X00 A;  5BP0 A;  5HCM A;  4HFD A;  2XNT A;  4ZJS A;  4AFG A;  4QAC A;  4LMK A;  4PIR A;  4ALX A;  2YKS A;  3EAM A;  4ZJT A;  2VL0 A;  5J5G A;  2C9T A;  5SYO A;  2WZY A;  3EI0 A;  5IUX A;  2BG9 E;  4IL9 A;  3RQW A;  4ZR6 A;  5AFL A;  5AFH A;  2QC1 B;  4UM3 P;  3JAD A;  2XQ4 A;  2BG9 C;  2XQ6 A;  2WNL A;  3P50 A;  5KE4 A;  4ZRU A;  4ZZC A;  3TLW A;  3UU8 A;  3SQ6 A;  4TNW A;  2YN6 A;  3GUA A;  4EZ1 A;  2XZ5 A;  5L47 A;  3IGQ A;  5LXB A;  2ZJV A;  5J5I A;  2BR8 A;  3SH1 A;  4HFB A;  4X5T A;  2XQ8 A;  4BQT A;  3WTK A;  4WV9 A;  3ZKR A;  4QH1 A;  2BG9 B;  3WTO A;  4HFI A;  3UU5 A;  4BFQ A;  2BJ0 A;  4D01 A;  5AFK A;  2XQ7 A;  4XK9 A;  4ILA A;  4TNV A;  2XYS A;  2PH9 A;  3UU3 A;  2XNU A;  4IL4 A;  2WN9 A;  4UY2 A;  3EHZ A;  5J0Z A;  3P4W A;  2XYT A;  3TLT A;  4AFT A;  3C79 A;  4QH5 A;  3WTL A;  4TWF A;  3T4M A;  5HEJ A;  2W8F A; 
#chains in the Genus database with same CATH homology
 2XQ9 A;  4NZB A;  3U8J A;  3C84 A;  5HEH A;  5TVC A;  2BYR A;  3SIO A;  2Y7Y A;  4HQP A;  4FRR A;  5HEG A;  5J5H A;  3JAF A;  2Y56 A;  4UM1 A;  2XNV A;  4HFE A;  5HEU A;  3TLU A;  4ZK4 A;  3UQ4 A;  5L4H A;  2XZ6 A;  2XQ3 A;  3TLV A;  3WTI A;  4COF A;  2BYS A;  5HEO A;  4NPP A;  4TWD A;  3UUB A;  3ZDH A;  4UM3 S;  4HFH A;  4Z90 A;  3SQ9 A;  4A98 A;  5J5F A;  2BR7 A;  3U8L A;  4ILB A;  3UU4 A;  2BYQ A;  5AFJ A;  4LMJ A;  5AIN A;  5BRX A;  4AFH A;  3LSV A;  2Y54 A;  2YME A;  4TWH A;  4ZK1 A;  4QAB A;  2UZ6 A;  2YMD A;  3U8N A;  5BW2 A;  2X00 D;  2WNJ A;  3U8M A;  4UM3 A;  2ZJU A;  2BG9 A;  3JAE A;  3WTN A;  4DBM A;  3PMZ A;  5JME A;  1UW6 A;  4B5D A;  3RQU A;  2PGZ A;  4Z91 A;  4QAA A;  5CO5 A;  4A97 A;  4QH4 A;  5AFM B;  3RIF A;  3TLS A;  4ILC A;  5L4E A;  1UX2 A;  5HCJ A;  3RIA A;  5AFN A;  2BYP A;  1UV6 A;  3WIP A;  3WTM A;  3UU6 A;  3UQ7 A;  1I9B A;  2YOE A;  3RHW A;  4HFC A;  2Y58 A;  4IRE A;  2Y57 A;  5FJV A;  4F8H A;  4ZZB A;  2BYN A;  4LML A;  3WTJ A;  2XQA A;  3WTH A;  4UXU A;  3PEO A;  5KZU A;  3ZDG A;  4XHE A;  3U8K A;  5CFB A;  2WNC A;  2XQ5 A;  3RI5 A;  5LG3 A;  5AFM A;  2W8G A;  2X00 A;  5BP0 A;  5HCM A;  4HFD A;  2XNT A;  4ZJS A;  4AFG A;  4QAC A;  4LMK A;  4PIR A;  4ALX A;  2YKS A;  3EAM A;  4ZJT A;  2VL0 A;  5J5G A;  2C9T A;  5SYO A;  2WZY A;  3EI0 A;  5IUX A;  2BG9 E;  4IL9 A;  3RQW A;  4ZR6 A;  5AFL A;  5AFH A;  2QC1 B;  4UM3 P;  3JAD A;  2XQ4 A;  2BG9 C;  2XQ6 A;  2WNL A;  3P50 A;  5KE4 A;  4ZRU A;  4ZZC A;  3TLW A;  3UU8 A;  3SQ6 A;  4TNW A;  2YN6 A;  3GUA A;  4EZ1 A;  2XZ5 A;  5L47 A;  3IGQ A;  5LXB A;  2ZJV A;  5J5I A;  2BR8 A;  3SH1 A;  4HFB A;  4X5T A;  2XQ8 A;  4BQT A;  3WTK A;  4WV9 A;  3ZKR A;  4QH1 A;  2BG9 B;  3WTO A;  4HFI A;  3UU5 A;  4BFQ A;  2BJ0 A;  4D01 A;  5AFK A;  2XQ7 A;  4XK9 A;  4ILA A;  4TNV A;  2XYS A;  2PH9 A;  3UU3 A;  2XNU A;  4IL4 A;  2WN9 A;  4UY2 A;  3EHZ A;  5J0Z A;  3P4W A;  2XYT A;  3TLT A;  4AFT A;  3C79 A;  4QH5 A;  3WTL A;  4TWF A;  3T4M A;  5HEJ A;  2W8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...