4XK9A

Crystal structure of a-achbp in complex with pinnatoxin g
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
210
structure length
210
Chain Sequence
KLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Marine Macrocyclic Imines, Pinnatoxins A and G: Structural Determinants and Functional Properties to Distinguish Neuronal alpha 7 from Muscle alpha 12 beta gamma delta nAChRs.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Acetylcholine-binding protein
total genus 50
structure length 210
sequence length 210
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4xk9A00
3T4MA 3U8NA 2WNCA 2BYQA 2YN6A 4HQPA 3RQUA 5CO5A 5AFHA 5IUXA 5BRXA 2Y54A 5L4HA 2XQ8A 3C79A 2W8FA 4HFBA 4A98A 4UM3A 3WIPA 2XQ7A 4D01A 2UZ6A 3UQ7A 4HFCA 5AINA 4ZZBA 3RQWA 3ZDHA 4FRRA 4IL4A 2Y7YA 2WNLA 2Y57A 5HCJA 2XQ3A 4X5TA 4ZK4A 3WTJA 4UM1A 3U8LA 3EHZA 4AFGA 2WN9A 3UQ4A 4ZK1A 5CFBA 4TNWA 2W8GA 4ZRUA 5JMEA 1UX2A 4F8HA 5FJVA 3ZDGA 4WV9A 4BFQA 3PEOA 5AFLA 5KE4A 5KZUA 2XQ6A 2XYSA 3SIOA 4LMJA 3WTIA 2WNJA 4ZZCA 3LSVA 3RI5A 4ZR6A 4ZJTA 1I9BA 2PGZA 3JADA 2BG9B 3WTKA 3ZKRA 2YMDA 4QABA 4HFHA 5J0ZA 5L47A 3TLVA 1UW6A 2XYTA 2X00A 3SQ6A 3WTHA 4UY2A 3RIAA 4QACA 4ZJSA 5HEGA 4COFA 3EAMA 2BG9C 3PMZA 2BYRA 3UU8A 3EI0A 2BYPA 3WTOA 5BP0A 4TWHA 4IL9A 4ALXA 2XQ5A 2BR8A 2XQ9A 4HFIA 5HCMA 3RHWA 3WTLA 4A97A 2XNVA 2XNUA 4LMKA 2QC1B 2YOEA 5HEJA 4TNVA 3SQ9A 5AFJA 5L4EA 2X00D 2WZYA 2ZJVA 4HFEA 3U8JA 3C84A 3WTNA 3P4WA 4PIRA 5SYOA 5AFMA 3IGQA 3RIFA 2XQ4A 4DBMA 5AFNA 5J5GA 4QAAA 4BQTA 4ILBA 4TWDA 3UUBA 5J5HA 5LG3A 5AFMB 4UM3S 3JAFA 4UM3P 2VL0A 2BG9E 2BG9A 2PH9A 4UXUA 5HEOA 4AFTA 4NZBA 3GUAA 3U8KA 4QH5A 2BJ0A 5HEUA 2Y56A 3U8MA 4LMLA 3P50A 2BYSA 4Z90A 3UU6A 4QH4A 2YKSA 2XNTA 4QH1A 3TLTA 4Z91A 4B5DA 5J5FA 3WTMA 3JAEA 2XZ5A 3TLUA 3UU3A 4NPPA 3UU4A 4EZ1A 2XZ6A 3UU5A 5TVCA 2YMEA 4IREA 4TWFA 5AFKA 5J5IA 2BYNA 4AFHA 5BW2A 2BR7A 3SH1A 5HEHA 3TLSA 4HFDA 3TLWA 2C9TA 2ZJUA 5LXBA 4ILAA 4XK9A 4ILCA 2Y58A 2XQAA 1UV6A 4XHEA
chains in the Genus database with same CATH superfamily
3T4MA 3U8NA 2WNCA 2BYQA 2YN6A 4HQPA 3RQUA 5CO5A 5AFHA 5IUXA 5BRXA 2Y54A 5L4HA 2XQ8A 3C79A 2W8FA 4HFBA 4A98A 4UM3A 3WIPA 2XQ7A 4D01A 2UZ6A 3UQ7A 4HFCA 5AINA 4ZZBA 3RQWA 3ZDHA 4FRRA 4IL4A 2Y7YA 2WNLA 2Y57A 5HCJA 2XQ3A 4X5TA 4ZK4A 3WTJA 4UM1A 3U8LA 3EHZA 4AFGA 2WN9A 3UQ4A 4ZK1A 5CFBA 4TNWA 2W8GA 4ZRUA 5JMEA 1UX2A 4F8HA 5FJVA 3ZDGA 4WV9A 4BFQA 3PEOA 5AFLA 5KE4A 5KZUA 2XQ6A 2XYSA 3SIOA 4LMJA 3WTIA 2WNJA 4ZZCA 3LSVA 3RI5A 4ZR6A 4ZJTA 1I9BA 2PGZA 3JADA 2BG9B 3WTKA 3ZKRA 2YMDA 4QABA 4HFHA 5J0ZA 5L47A 3TLVA 1UW6A 2XYTA 2X00A 3SQ6A 3WTHA 4UY2A 3RIAA 4QACA 4ZJSA 5HEGA 4COFA 3EAMA 2BG9C 3PMZA 2BYRA 3UU8A 3EI0A 2BYPA 3WTOA 5BP0A 4TWHA 4IL9A 4ALXA 2XQ5A 2BR8A 2XQ9A 4HFIA 5HCMA 3RHWA 3WTLA 4A97A 2XNVA 2XNUA 4LMKA 2QC1B 2YOEA 5HEJA 4TNVA 3SQ9A 5AFJA 5L4EA 2X00D 2WZYA 2ZJVA 4HFEA 3U8JA 3C84A 3WTNA 3P4WA 4PIRA 5SYOA 5AFMA 3IGQA 3RIFA 2XQ4A 4DBMA 5AFNA 5J5GA 4QAAA 4BQTA 4ILBA 4TWDA 3UUBA 5J5HA 5LG3A 5AFMB 4UM3S 3JAFA 4UM3P 2VL0A 2BG9E 2BG9A 2PH9A 4UXUA 5HEOA 4AFTA 4NZBA 3GUAA 3U8KA 4QH5A 2BJ0A 5HEUA 2Y56A 3U8MA 4LMLA 3P50A 2BYSA 4Z90A 3UU6A 4QH4A 2YKSA 2XNTA 4QH1A 3TLTA 4Z91A 4B5DA 5J5FA 3WTMA 3JAEA 2XZ5A 3TLUA 3UU3A 4NPPA 3UU4A 4EZ1A 2XZ6A 3UU5A 5TVCA 2YMEA 4IREA 4TWFA 5AFKA 5J5IA 2BYNA 4AFHA 5BW2A 2BR7A 3SH1A 5HEHA 3TLSA 4HFDA 3TLWA 2C9TA 2ZJUA 5LXBA 4ILAA 4XK9A 4ILCA 2Y58A 2XQAA 1UV6A 4XHEA
chains in the Genus database with same CATH topology
3T4MA 3U8NA 2WNCA 2BYQA 2YN6A 4HQPA 3RQUA 5CO5A 5AFHA 5IUXA 5BRXA 2Y54A 5L4HA 2XQ8A 3C79A 2W8FA 4HFBA 4A98A 4UM3A 3WIPA 2XQ7A 4D01A 2UZ6A 3UQ7A 4HFCA 5AINA 4ZZBA 3RQWA 3ZDHA 4FRRA 4IL4A 2Y7YA 2WNLA 2Y57A 5HCJA 2XQ3A 4X5TA 4ZK4A 3WTJA 4UM1A 3U8LA 3EHZA 4AFGA 2WN9A 3UQ4A 4ZK1A 5CFBA 4TNWA 2W8GA 4ZRUA 5JMEA 1UX2A 4F8HA 5FJVA 3ZDGA 4WV9A 4BFQA 3PEOA 5AFLA 5KE4A 5KZUA 2XQ6A 2XYSA 3SIOA 4LMJA 3WTIA 2WNJA 4ZZCA 3LSVA 3RI5A 4ZR6A 4ZJTA 1I9BA 2PGZA 3JADA 2BG9B 3WTKA 3ZKRA 2YMDA 4QABA 4HFHA 5J0ZA 5L47A 3TLVA 1UW6A 2XYTA 2X00A 3SQ6A 3WTHA 4UY2A 3RIAA 4QACA 4ZJSA 5HEGA 4COFA 3EAMA 2BG9C 3PMZA 2BYRA 3UU8A 3EI0A 2BYPA 3WTOA 5BP0A 4TWHA 4IL9A 4ALXA 2XQ5A 2BR8A 2XQ9A 4HFIA 5HCMA 3RHWA 3WTLA 4A97A 2XNVA 2XNUA 4LMKA 2QC1B 2YOEA 5HEJA 4TNVA 3SQ9A 5AFJA 5L4EA 2X00D 2WZYA 2ZJVA 4HFEA 3U8JA 3C84A 3WTNA 3P4WA 4PIRA 5SYOA 5AFMA 3IGQA 3RIFA 2XQ4A 4DBMA 5AFNA 5J5GA 4QAAA 4BQTA 4ILBA 4TWDA 3UUBA 5J5HA 5LG3A 5AFMB 4UM3S 3JAFA 4UM3P 2VL0A 2BG9E 2BG9A 2PH9A 4UXUA 5HEOA 4AFTA 4NZBA 3GUAA 3U8KA 4QH5A 2BJ0A 5HEUA 2Y56A 3U8MA 4LMLA 3P50A 2BYSA 4Z90A 3UU6A 4QH4A 2YKSA 2XNTA 4QH1A 3TLTA 4Z91A 4B5DA 5J5FA 3WTMA 3JAEA 2XZ5A 3TLUA 3UU3A 4NPPA 3UU4A 4EZ1A 2XZ6A 3UU5A 5TVCA 2YMEA 4IREA 4TWFA 5AFKA 5J5IA 2BYNA 4AFHA 5BW2A 2BR7A 3SH1A 5HEHA 3TLSA 4HFDA 3TLWA 2C9TA 2ZJUA 5LXBA 4ILAA 4XK9A 4ILCA 2Y58A 2XQAA 1UV6A 4XHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4M A;  3U8N A;  2WNC A;  2BYQ A;  2YN6 A;  4HQP A;  3RQU A;  5CO5 A;  5AFH A;  5IUX A;  5BRX A;  2Y54 A;  5L4H A;  2XQ8 A;  3C79 A;  2W8F A;  4HFB A;  4A98 A;  4UM3 A;  3WIP A;  2XQ7 A;  4D01 A;  2UZ6 A;  3UQ7 A;  4HFC A;  5AIN A;  4ZZB A;  3RQW A;  3ZDH A;  4FRR A;  4IL4 A;  2Y7Y A;  2WNL A;  2Y57 A;  5HCJ A;  2XQ3 A;  4X5T A;  4ZK4 A;  3WTJ A;  4UM1 A;  3U8L A;  3EHZ A;  4AFG A;  2WN9 A;  3UQ4 A;  4ZK1 A;  5CFB A;  4TNW A;  2W8G A;  4ZRU A;  5JME A;  1UX2 A;  4F8H A;  5FJV A;  3ZDG A;  4WV9 A;  4BFQ A;  3PEO A;  5AFL A;  5KE4 A;  5KZU A;  2XQ6 A;  2XYS A;  3SIO A;  4LMJ A;  3WTI A;  2WNJ A;  4ZZC A;  3LSV A;  3RI5 A;  4ZR6 A;  4ZJT A;  1I9B A;  2PGZ A;  3JAD A;  2BG9 B;  3WTK A;  3ZKR A;  2YMD A;  4QAB A;  4HFH A;  5J0Z A;  5L47 A;  3TLV A;  1UW6 A;  2XYT A;  2X00 A;  3SQ6 A;  3WTH A;  4UY2 A;  3RIA A;  4QAC A;  4ZJS A;  5HEG A;  4COF A;  3EAM A;  2BG9 C;  3PMZ A;  2BYR A;  3UU8 A;  3EI0 A;  2BYP A;  3WTO A;  5BP0 A;  4TWH A;  4IL9 A;  4ALX A;  2XQ5 A;  2BR8 A;  2XQ9 A;  4HFI A;  5HCM A;  3RHW A;  3WTL A;  4A97 A;  2XNV A;  2XNU A;  4LMK A;  2QC1 B;  2YOE A;  5HEJ A;  4TNV A;  3SQ9 A;  5AFJ A;  5L4E A;  2X00 D;  2WZY A;  2ZJV A;  4HFE A;  3U8J A;  3C84 A;  3WTN A;  3P4W A;  4PIR A;  5SYO A;  5AFM A;  3IGQ A;  3RIF A;  2XQ4 A;  4DBM A;  5AFN A;  5J5G A;  4QAA A;  4BQT A;  4ILB A;  4TWD A;  3UUB A;  5J5H A;  5LG3 A;  5AFM B;  4UM3 S;  3JAF A;  4UM3 P;  2VL0 A;  2BG9 E;  2BG9 A;  2PH9 A;  4UXU A;  5HEO A;  4AFT A;  4NZB A;  3GUA A;  3U8K A;  4QH5 A;  2BJ0 A;  5HEU A;  2Y56 A;  3U8M A;  4LML A;  3P50 A;  2BYS A;  4Z90 A;  3UU6 A;  4QH4 A;  2YKS A;  2XNT A;  4QH1 A;  3TLT A;  4Z91 A;  4B5D A;  5J5F A;  3WTM A;  3JAE A;  2XZ5 A;  3TLU A;  3UU3 A;  4NPP A;  3UU4 A;  4EZ1 A;  2XZ6 A;  3UU5 A;  5TVC A;  2YME A;  4IRE A;  4TWF A;  5AFK A;  5J5I A;  2BYN A;  4AFH A;  5BW2 A;  2BR7 A;  3SH1 A;  5HEH A;  3TLS A;  4HFD A;  3TLW A;  2C9T A;  2ZJU A;  5LXB A;  4ILA A;  4XK9 A;  4ILC A;  2Y58 A;  2XQA A;  1UV6 A;  4XHE A; 
#chains in the Genus database with same CATH topology
 3T4M A;  3U8N A;  2WNC A;  2BYQ A;  2YN6 A;  4HQP A;  3RQU A;  5CO5 A;  5AFH A;  5IUX A;  5BRX A;  2Y54 A;  5L4H A;  2XQ8 A;  3C79 A;  2W8F A;  4HFB A;  4A98 A;  4UM3 A;  3WIP A;  2XQ7 A;  4D01 A;  2UZ6 A;  3UQ7 A;  4HFC A;  5AIN A;  4ZZB A;  3RQW A;  3ZDH A;  4FRR A;  4IL4 A;  2Y7Y A;  2WNL A;  2Y57 A;  5HCJ A;  2XQ3 A;  4X5T A;  4ZK4 A;  3WTJ A;  4UM1 A;  3U8L A;  3EHZ A;  4AFG A;  2WN9 A;  3UQ4 A;  4ZK1 A;  5CFB A;  4TNW A;  2W8G A;  4ZRU A;  5JME A;  1UX2 A;  4F8H A;  5FJV A;  3ZDG A;  4WV9 A;  4BFQ A;  3PEO A;  5AFL A;  5KE4 A;  5KZU A;  2XQ6 A;  2XYS A;  3SIO A;  4LMJ A;  3WTI A;  2WNJ A;  4ZZC A;  3LSV A;  3RI5 A;  4ZR6 A;  4ZJT A;  1I9B A;  2PGZ A;  3JAD A;  2BG9 B;  3WTK A;  3ZKR A;  2YMD A;  4QAB A;  4HFH A;  5J0Z A;  5L47 A;  3TLV A;  1UW6 A;  2XYT A;  2X00 A;  3SQ6 A;  3WTH A;  4UY2 A;  3RIA A;  4QAC A;  4ZJS A;  5HEG A;  4COF A;  3EAM A;  2BG9 C;  3PMZ A;  2BYR A;  3UU8 A;  3EI0 A;  2BYP A;  3WTO A;  5BP0 A;  4TWH A;  4IL9 A;  4ALX A;  2XQ5 A;  2BR8 A;  2XQ9 A;  4HFI A;  5HCM A;  3RHW A;  3WTL A;  4A97 A;  2XNV A;  2XNU A;  4LMK A;  2QC1 B;  2YOE A;  5HEJ A;  4TNV A;  3SQ9 A;  5AFJ A;  5L4E A;  2X00 D;  2WZY A;  2ZJV A;  4HFE A;  3U8J A;  3C84 A;  3WTN A;  3P4W A;  4PIR A;  5SYO A;  5AFM A;  3IGQ A;  3RIF A;  2XQ4 A;  4DBM A;  5AFN A;  5J5G A;  4QAA A;  4BQT A;  4ILB A;  4TWD A;  3UUB A;  5J5H A;  5LG3 A;  5AFM B;  4UM3 S;  3JAF A;  4UM3 P;  2VL0 A;  2BG9 E;  2BG9 A;  2PH9 A;  4UXU A;  5HEO A;  4AFT A;  4NZB A;  3GUA A;  3U8K A;  4QH5 A;  2BJ0 A;  5HEU A;  2Y56 A;  3U8M A;  4LML A;  3P50 A;  2BYS A;  4Z90 A;  3UU6 A;  4QH4 A;  2YKS A;  2XNT A;  4QH1 A;  3TLT A;  4Z91 A;  4B5D A;  5J5F A;  3WTM A;  3JAE A;  2XZ5 A;  3TLU A;  3UU3 A;  4NPP A;  3UU4 A;  4EZ1 A;  2XZ6 A;  3UU5 A;  5TVC A;  2YME A;  4IRE A;  4TWF A;  5AFK A;  5J5I A;  2BYN A;  4AFH A;  5BW2 A;  2BR7 A;  3SH1 A;  5HEH A;  3TLS A;  4HFD A;  3TLW A;  2C9T A;  2ZJU A;  5LXB A;  4ILA A;  4XK9 A;  4ILC A;  2Y58 A;  2XQA A;  1UV6 A;  4XHE A; 
#chains in the Genus database with same CATH homology
 3T4M A;  3U8N A;  2WNC A;  2BYQ A;  2YN6 A;  4HQP A;  3RQU A;  5CO5 A;  5AFH A;  5IUX A;  5BRX A;  2Y54 A;  5L4H A;  2XQ8 A;  3C79 A;  2W8F A;  4HFB A;  4A98 A;  4UM3 A;  3WIP A;  2XQ7 A;  4D01 A;  2UZ6 A;  3UQ7 A;  4HFC A;  5AIN A;  4ZZB A;  3RQW A;  3ZDH A;  4FRR A;  4IL4 A;  2Y7Y A;  2WNL A;  2Y57 A;  5HCJ A;  2XQ3 A;  4X5T A;  4ZK4 A;  3WTJ A;  4UM1 A;  3U8L A;  3EHZ A;  4AFG A;  2WN9 A;  3UQ4 A;  4ZK1 A;  5CFB A;  4TNW A;  2W8G A;  4ZRU A;  5JME A;  1UX2 A;  4F8H A;  5FJV A;  3ZDG A;  4WV9 A;  4BFQ A;  3PEO A;  5AFL A;  5KE4 A;  5KZU A;  2XQ6 A;  2XYS A;  3SIO A;  4LMJ A;  3WTI A;  2WNJ A;  4ZZC A;  3LSV A;  3RI5 A;  4ZR6 A;  4ZJT A;  1I9B A;  2PGZ A;  3JAD A;  2BG9 B;  3WTK A;  3ZKR A;  2YMD A;  4QAB A;  4HFH A;  5J0Z A;  5L47 A;  3TLV A;  1UW6 A;  2XYT A;  2X00 A;  3SQ6 A;  3WTH A;  4UY2 A;  3RIA A;  4QAC A;  4ZJS A;  5HEG A;  4COF A;  3EAM A;  2BG9 C;  3PMZ A;  2BYR A;  3UU8 A;  3EI0 A;  2BYP A;  3WTO A;  5BP0 A;  4TWH A;  4IL9 A;  4ALX A;  2XQ5 A;  2BR8 A;  2XQ9 A;  4HFI A;  5HCM A;  3RHW A;  3WTL A;  4A97 A;  2XNV A;  2XNU A;  4LMK A;  2QC1 B;  2YOE A;  5HEJ A;  4TNV A;  3SQ9 A;  5AFJ A;  5L4E A;  2X00 D;  2WZY A;  2ZJV A;  4HFE A;  3U8J A;  3C84 A;  3WTN A;  3P4W A;  4PIR A;  5SYO A;  5AFM A;  3IGQ A;  3RIF A;  2XQ4 A;  4DBM A;  5AFN A;  5J5G A;  4QAA A;  4BQT A;  4ILB A;  4TWD A;  3UUB A;  5J5H A;  5LG3 A;  5AFM B;  4UM3 S;  3JAF A;  4UM3 P;  2VL0 A;  2BG9 E;  2BG9 A;  2PH9 A;  4UXU A;  5HEO A;  4AFT A;  4NZB A;  3GUA A;  3U8K A;  4QH5 A;  2BJ0 A;  5HEU A;  2Y56 A;  3U8M A;  4LML A;  3P50 A;  2BYS A;  4Z90 A;  3UU6 A;  4QH4 A;  2YKS A;  2XNT A;  4QH1 A;  3TLT A;  4Z91 A;  4B5D A;  5J5F A;  3WTM A;  3JAE A;  2XZ5 A;  3TLU A;  3UU3 A;  4NPP A;  3UU4 A;  4EZ1 A;  2XZ6 A;  3UU5 A;  5TVC A;  2YME A;  4IRE A;  4TWF A;  5AFK A;  5J5I A;  2BYN A;  4AFH A;  5BW2 A;  2BR7 A;  3SH1 A;  5HEH A;  3TLS A;  4HFD A;  3TLW A;  2C9T A;  2ZJU A;  5LXB A;  4ILA A;  4XK9 A;  4ILC A;  2Y58 A;  2XQA A;  1UV6 A;  4XHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...