4XK9A

Crystal structure of a-achbp in complex with pinnatoxin g
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
210
structure length
210
Chain Sequence
b'KLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Marine Macrocyclic Imines, Pinnatoxins A and G: Structural Determinants and Functional Properties to Distinguish Neuronal alpha 7 from Muscle alpha 12 beta gamma delta nAChRs.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Acetylcholine-binding protein
total genus 50
structure length 210
sequence length 210
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4xk9A00
4ZK4A 3UQ7A 3U8MA 2WNLA 3WTKA 2XZ6A 3C84A 2XQ7A 4TWFA 4A97A 2Y56A 3TLWA 3PMZA 4HQPA 3SQ6A 3RHWA 5HCJA 2X00A 4LMLA 3JAEA 4UM3S 2W8GA 2BR8A 4D01A 4ZK1A 5AFNA 3WTHA 2XNVA 4PIRA 5HEGA 5AFMB 3WTIA 2W8FA 5J5GA 4XHEA 2BYRA 1UX2A 2Y54A 4HFHA 4B5DA 2WZYA 4ZJSA 3P50A 3UU4A 3UQ4A 2XQ5A 3UUBA 4Z91A 4TWHA 4F8HA 2BYNA 3RQWA 3T4MA 5LXBA 2WNJA 5J5HA 4NZBA 4HFCA 3EAMA 5L47A 3RQUA 2XQ6A 3RIAA 2QC1B 3UU8A 3JADA 5JMEA 4COFA 2ZJVA 2Y57A 3JAFA 5TVCA 4AFGA 4HFEA 4ILCA 4ZR6A 3SQ9A 4UM1A 5CO5A 3WTMA 4LMKA 5BW2A 2XNTA 2YKSA 4EZ1A 4IL4A 2BG9B 2XYSA 5IUXA 4XK9A 4ZZBA 2Y7YA 5HEJA 4AFTA 2BYPA 4QH1A 3TLUA 2BYSA 3C79A 3TLTA 2PH9A 4HFDA 4HFIA 2BG9C 3LSVA 3U8LA 3IGQA 5KE4A 4QAAA 4WV9A 2XQ9A 5FJVA 5SYOA 2YOEA 3U8NA 5KZUA 3UU6A 2WN9A 4UM3P 3ZDHA 4AFHA 2Y58A 2UZ6A 2VL0A 5L4HA 2BG9A 4TWDA 4LMJA 3PEOA 3U8KA 5AFMA 4X5TA 4ILBA 3WTOA 4A98A 2XQAA 5J5FA 2ZJUA 2BYQA 5AFLA 2XQ3A 5HEUA 3ZKRA 4QACA 3EI0A 1UV6A 2BR7A 3TLSA 4BQTA 2BJ0A 2YMEA 3P4WA 3WTJA 5HEHA 5HCMA 3WIPA 5J5IA 2XZ5A 1I9BA 5BP0A 4ZZCA 3UU5A 3RI5A 4DBMA 4TNVA 4UXUA 4NPPA 2XYTA 5AFKA 4Z90A 4ZJTA 3SH1A 2C9TA 5HEOA 4QABA 5AFHA 3SIOA 2XQ4A 4ALXA 2BG9E 4UM3A 3ZDGA 5AFJA 5LG3A 4QH5A 2XNUA 3GUAA 4ZRUA 3RIFA 5BRXA 4FRRA 4IREA 2PGZA 4UY2A 2X00D 3WTNA 1UW6A 4TNWA 4HFBA 2WNCA 5J0ZA 5CFBA 3WTLA 3U8JA 5L4EA 4QH4A 3TLVA 4BFQA 2YN6A 3EHZA 2YMDA 4ILAA 4IL9A 3UU3A 2XQ8A 5AINA
chains in the Genus database with same CATH superfamily
4ZK4A 3UQ7A 3U8MA 2WNLA 3WTKA 2XZ6A 3C84A 2XQ7A 4TWFA 4A97A 2Y56A 3TLWA 3PMZA 4HQPA 3SQ6A 3RHWA 5HCJA 2X00A 4LMLA 3JAEA 4UM3S 2W8GA 2BR8A 4D01A 4ZK1A 5AFNA 3WTHA 2XNVA 4PIRA 5HEGA 5AFMB 3WTIA 2W8FA 5J5GA 4XHEA 2BYRA 1UX2A 2Y54A 4HFHA 4B5DA 2WZYA 4ZJSA 3P50A 3UU4A 3UQ4A 2XQ5A 3UUBA 4Z91A 4TWHA 4F8HA 2BYNA 3RQWA 3T4MA 5LXBA 2WNJA 5J5HA 4NZBA 4HFCA 3EAMA 5L47A 3RQUA 2XQ6A 3RIAA 2QC1B 3UU8A 3JADA 5JMEA 4COFA 2ZJVA 2Y57A 3JAFA 5TVCA 4AFGA 4HFEA 4ILCA 4ZR6A 3SQ9A 4UM1A 5CO5A 3WTMA 4LMKA 5BW2A 2XNTA 2YKSA 4EZ1A 4IL4A 2BG9B 2XYSA 5IUXA 4XK9A 4ZZBA 2Y7YA 5HEJA 4AFTA 2BYPA 4QH1A 3TLUA 2BYSA 3C79A 3TLTA 2PH9A 4HFDA 4HFIA 2BG9C 3LSVA 3U8LA 3IGQA 5KE4A 4QAAA 4WV9A 2XQ9A 5FJVA 5SYOA 2YOEA 3U8NA 5KZUA 3UU6A 2WN9A 4UM3P 3ZDHA 4AFHA 2Y58A 2UZ6A 2VL0A 5L4HA 2BG9A 4TWDA 4LMJA 3PEOA 3U8KA 5AFMA 4X5TA 4ILBA 3WTOA 4A98A 2XQAA 5J5FA 2ZJUA 2BYQA 5AFLA 2XQ3A 5HEUA 3ZKRA 4QACA 3EI0A 1UV6A 2BR7A 3TLSA 4BQTA 2BJ0A 2YMEA 3P4WA 3WTJA 5HEHA 5HCMA 3WIPA 5J5IA 2XZ5A 1I9BA 5BP0A 4ZZCA 3UU5A 3RI5A 4DBMA 4TNVA 4UXUA 4NPPA 2XYTA 5AFKA 4Z90A 4ZJTA 3SH1A 2C9TA 5HEOA 4QABA 5AFHA 3SIOA 2XQ4A 4ALXA 2BG9E 4UM3A 3ZDGA 5AFJA 5LG3A 4QH5A 2XNUA 3GUAA 4ZRUA 3RIFA 5BRXA 4FRRA 4IREA 2PGZA 4UY2A 2X00D 3WTNA 1UW6A 4TNWA 4HFBA 2WNCA 5J0ZA 5CFBA 3WTLA 3U8JA 5L4EA 4QH4A 3TLVA 4BFQA 2YN6A 3EHZA 2YMDA 4ILAA 4IL9A 3UU3A 2XQ8A 5AINA
chains in the Genus database with same CATH topology
4ZK4A 3UQ7A 3U8MA 2WNLA 3WTKA 2XZ6A 3C84A 2XQ7A 4TWFA 4A97A 2Y56A 3TLWA 3PMZA 4HQPA 3SQ6A 3RHWA 5HCJA 2X00A 4LMLA 3JAEA 4UM3S 2W8GA 2BR8A 4D01A 4ZK1A 5AFNA 3WTHA 2XNVA 4PIRA 5HEGA 5AFMB 3WTIA 2W8FA 5J5GA 4XHEA 2BYRA 1UX2A 2Y54A 4HFHA 4B5DA 2WZYA 4ZJSA 3P50A 3UU4A 3UQ4A 2XQ5A 3UUBA 4Z91A 4TWHA 4F8HA 2BYNA 3RQWA 3T4MA 5LXBA 2WNJA 5J5HA 4NZBA 4HFCA 3EAMA 5L47A 3RQUA 2XQ6A 3RIAA 2QC1B 3UU8A 3JADA 5JMEA 4COFA 2ZJVA 2Y57A 3JAFA 5TVCA 4AFGA 4HFEA 4ILCA 4ZR6A 3SQ9A 4UM1A 5CO5A 3WTMA 4LMKA 5BW2A 2XNTA 2YKSA 4EZ1A 4IL4A 2BG9B 2XYSA 5IUXA 4XK9A 4ZZBA 2Y7YA 5HEJA 4AFTA 2BYPA 4QH1A 3TLUA 2BYSA 3C79A 3TLTA 2PH9A 4HFDA 4HFIA 2BG9C 3LSVA 3U8LA 3IGQA 5KE4A 4QAAA 4WV9A 2XQ9A 5FJVA 5SYOA 2YOEA 3U8NA 5KZUA 3UU6A 2WN9A 4UM3P 3ZDHA 4AFHA 2Y58A 2UZ6A 2VL0A 5L4HA 2BG9A 4TWDA 4LMJA 3PEOA 3U8KA 5AFMA 4X5TA 4ILBA 3WTOA 4A98A 2XQAA 5J5FA 2ZJUA 2BYQA 5AFLA 2XQ3A 5HEUA 3ZKRA 4QACA 3EI0A 1UV6A 2BR7A 3TLSA 4BQTA 2BJ0A 2YMEA 3P4WA 3WTJA 5HEHA 5HCMA 3WIPA 5J5IA 2XZ5A 1I9BA 5BP0A 4ZZCA 3UU5A 3RI5A 4DBMA 4TNVA 4UXUA 4NPPA 2XYTA 5AFKA 4Z90A 4ZJTA 3SH1A 2C9TA 5HEOA 4QABA 5AFHA 3SIOA 2XQ4A 4ALXA 2BG9E 4UM3A 3ZDGA 5AFJA 5LG3A 4QH5A 2XNUA 3GUAA 4ZRUA 3RIFA 5BRXA 4FRRA 4IREA 2PGZA 4UY2A 2X00D 3WTNA 1UW6A 4TNWA 4HFBA 2WNCA 5J0ZA 5CFBA 3WTLA 3U8JA 5L4EA 4QH4A 3TLVA 4BFQA 2YN6A 3EHZA 2YMDA 4ILAA 4IL9A 3UU3A 2XQ8A 5AINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZK4 A;  3UQ7 A;  3U8M A;  2WNL A;  3WTK A;  2XZ6 A;  3C84 A;  2XQ7 A;  4TWF A;  4A97 A;  2Y56 A;  3TLW A;  3PMZ A;  4HQP A;  3SQ6 A;  3RHW A;  5HCJ A;  2X00 A;  4LML A;  3JAE A;  4UM3 S;  2W8G A;  2BR8 A;  4D01 A;  4ZK1 A;  5AFN A;  3WTH A;  2XNV A;  4PIR A;  5HEG A;  5AFM B;  3WTI A;  2W8F A;  5J5G A;  4XHE A;  2BYR A;  1UX2 A;  2Y54 A;  4HFH A;  4B5D A;  2WZY A;  4ZJS A;  3P50 A;  3UU4 A;  3UQ4 A;  2XQ5 A;  3UUB A;  4Z91 A;  4TWH A;  4F8H A;  2BYN A;  3RQW A;  3T4M A;  5LXB A;  2WNJ A;  5J5H A;  4NZB A;  4HFC A;  3EAM A;  5L47 A;  3RQU A;  2XQ6 A;  3RIA A;  2QC1 B;  3UU8 A;  3JAD A;  5JME A;  4COF A;  2ZJV A;  2Y57 A;  3JAF A;  5TVC A;  4AFG A;  4HFE A;  4ILC A;  4ZR6 A;  3SQ9 A;  4UM1 A;  5CO5 A;  3WTM A;  4LMK A;  5BW2 A;  2XNT A;  2YKS A;  4EZ1 A;  4IL4 A;  2BG9 B;  2XYS A;  5IUX A;  4XK9 A;  4ZZB A;  2Y7Y A;  5HEJ A;  4AFT A;  2BYP A;  4QH1 A;  3TLU A;  2BYS A;  3C79 A;  3TLT A;  2PH9 A;  4HFD A;  4HFI A;  2BG9 C;  3LSV A;  3U8L A;  3IGQ A;  5KE4 A;  4QAA A;  4WV9 A;  2XQ9 A;  5FJV A;  5SYO A;  2YOE A;  3U8N A;  5KZU A;  3UU6 A;  2WN9 A;  4UM3 P;  3ZDH A;  4AFH A;  2Y58 A;  2UZ6 A;  2VL0 A;  5L4H A;  2BG9 A;  4TWD A;  4LMJ A;  3PEO A;  3U8K A;  5AFM A;  4X5T A;  4ILB A;  3WTO A;  4A98 A;  2XQA A;  5J5F A;  2ZJU A;  2BYQ A;  5AFL A;  2XQ3 A;  5HEU A;  3ZKR A;  4QAC A;  3EI0 A;  1UV6 A;  2BR7 A;  3TLS A;  4BQT A;  2BJ0 A;  2YME A;  3P4W A;  3WTJ A;  5HEH A;  5HCM A;  3WIP A;  5J5I A;  2XZ5 A;  1I9B A;  5BP0 A;  4ZZC A;  3UU5 A;  3RI5 A;  4DBM A;  4TNV A;  4UXU A;  4NPP A;  2XYT A;  5AFK A;  4Z90 A;  4ZJT A;  3SH1 A;  2C9T A;  5HEO A;  4QAB A;  5AFH A;  3SIO A;  2XQ4 A;  4ALX A;  2BG9 E;  4UM3 A;  3ZDG A;  5AFJ A;  5LG3 A;  4QH5 A;  2XNU A;  3GUA A;  4ZRU A;  3RIF A;  5BRX A;  4FRR A;  4IRE A;  2PGZ A;  4UY2 A;  2X00 D;  3WTN A;  1UW6 A;  4TNW A;  4HFB A;  2WNC A;  5J0Z A;  5CFB A;  3WTL A;  3U8J A;  5L4E A;  4QH4 A;  3TLV A;  4BFQ A;  2YN6 A;  3EHZ A;  2YMD A;  4ILA A;  4IL9 A;  3UU3 A;  2XQ8 A;  5AIN A; 
#chains in the Genus database with same CATH topology
 4ZK4 A;  3UQ7 A;  3U8M A;  2WNL A;  3WTK A;  2XZ6 A;  3C84 A;  2XQ7 A;  4TWF A;  4A97 A;  2Y56 A;  3TLW A;  3PMZ A;  4HQP A;  3SQ6 A;  3RHW A;  5HCJ A;  2X00 A;  4LML A;  3JAE A;  4UM3 S;  2W8G A;  2BR8 A;  4D01 A;  4ZK1 A;  5AFN A;  3WTH A;  2XNV A;  4PIR A;  5HEG A;  5AFM B;  3WTI A;  2W8F A;  5J5G A;  4XHE A;  2BYR A;  1UX2 A;  2Y54 A;  4HFH A;  4B5D A;  2WZY A;  4ZJS A;  3P50 A;  3UU4 A;  3UQ4 A;  2XQ5 A;  3UUB A;  4Z91 A;  4TWH A;  4F8H A;  2BYN A;  3RQW A;  3T4M A;  5LXB A;  2WNJ A;  5J5H A;  4NZB A;  4HFC A;  3EAM A;  5L47 A;  3RQU A;  2XQ6 A;  3RIA A;  2QC1 B;  3UU8 A;  3JAD A;  5JME A;  4COF A;  2ZJV A;  2Y57 A;  3JAF A;  5TVC A;  4AFG A;  4HFE A;  4ILC A;  4ZR6 A;  3SQ9 A;  4UM1 A;  5CO5 A;  3WTM A;  4LMK A;  5BW2 A;  2XNT A;  2YKS A;  4EZ1 A;  4IL4 A;  2BG9 B;  2XYS A;  5IUX A;  4XK9 A;  4ZZB A;  2Y7Y A;  5HEJ A;  4AFT A;  2BYP A;  4QH1 A;  3TLU A;  2BYS A;  3C79 A;  3TLT A;  2PH9 A;  4HFD A;  4HFI A;  2BG9 C;  3LSV A;  3U8L A;  3IGQ A;  5KE4 A;  4QAA A;  4WV9 A;  2XQ9 A;  5FJV A;  5SYO A;  2YOE A;  3U8N A;  5KZU A;  3UU6 A;  2WN9 A;  4UM3 P;  3ZDH A;  4AFH A;  2Y58 A;  2UZ6 A;  2VL0 A;  5L4H A;  2BG9 A;  4TWD A;  4LMJ A;  3PEO A;  3U8K A;  5AFM A;  4X5T A;  4ILB A;  3WTO A;  4A98 A;  2XQA A;  5J5F A;  2ZJU A;  2BYQ A;  5AFL A;  2XQ3 A;  5HEU A;  3ZKR A;  4QAC A;  3EI0 A;  1UV6 A;  2BR7 A;  3TLS A;  4BQT A;  2BJ0 A;  2YME A;  3P4W A;  3WTJ A;  5HEH A;  5HCM A;  3WIP A;  5J5I A;  2XZ5 A;  1I9B A;  5BP0 A;  4ZZC A;  3UU5 A;  3RI5 A;  4DBM A;  4TNV A;  4UXU A;  4NPP A;  2XYT A;  5AFK A;  4Z90 A;  4ZJT A;  3SH1 A;  2C9T A;  5HEO A;  4QAB A;  5AFH A;  3SIO A;  2XQ4 A;  4ALX A;  2BG9 E;  4UM3 A;  3ZDG A;  5AFJ A;  5LG3 A;  4QH5 A;  2XNU A;  3GUA A;  4ZRU A;  3RIF A;  5BRX A;  4FRR A;  4IRE A;  2PGZ A;  4UY2 A;  2X00 D;  3WTN A;  1UW6 A;  4TNW A;  4HFB A;  2WNC A;  5J0Z A;  5CFB A;  3WTL A;  3U8J A;  5L4E A;  4QH4 A;  3TLV A;  4BFQ A;  2YN6 A;  3EHZ A;  2YMD A;  4ILA A;  4IL9 A;  3UU3 A;  2XQ8 A;  5AIN A; 
#chains in the Genus database with same CATH homology
 4ZK4 A;  3UQ7 A;  3U8M A;  2WNL A;  3WTK A;  2XZ6 A;  3C84 A;  2XQ7 A;  4TWF A;  4A97 A;  2Y56 A;  3TLW A;  3PMZ A;  4HQP A;  3SQ6 A;  3RHW A;  5HCJ A;  2X00 A;  4LML A;  3JAE A;  4UM3 S;  2W8G A;  2BR8 A;  4D01 A;  4ZK1 A;  5AFN A;  3WTH A;  2XNV A;  4PIR A;  5HEG A;  5AFM B;  3WTI A;  2W8F A;  5J5G A;  4XHE A;  2BYR A;  1UX2 A;  2Y54 A;  4HFH A;  4B5D A;  2WZY A;  4ZJS A;  3P50 A;  3UU4 A;  3UQ4 A;  2XQ5 A;  3UUB A;  4Z91 A;  4TWH A;  4F8H A;  2BYN A;  3RQW A;  3T4M A;  5LXB A;  2WNJ A;  5J5H A;  4NZB A;  4HFC A;  3EAM A;  5L47 A;  3RQU A;  2XQ6 A;  3RIA A;  2QC1 B;  3UU8 A;  3JAD A;  5JME A;  4COF A;  2ZJV A;  2Y57 A;  3JAF A;  5TVC A;  4AFG A;  4HFE A;  4ILC A;  4ZR6 A;  3SQ9 A;  4UM1 A;  5CO5 A;  3WTM A;  4LMK A;  5BW2 A;  2XNT A;  2YKS A;  4EZ1 A;  4IL4 A;  2BG9 B;  2XYS A;  5IUX A;  4XK9 A;  4ZZB A;  2Y7Y A;  5HEJ A;  4AFT A;  2BYP A;  4QH1 A;  3TLU A;  2BYS A;  3C79 A;  3TLT A;  2PH9 A;  4HFD A;  4HFI A;  2BG9 C;  3LSV A;  3U8L A;  3IGQ A;  5KE4 A;  4QAA A;  4WV9 A;  2XQ9 A;  5FJV A;  5SYO A;  2YOE A;  3U8N A;  5KZU A;  3UU6 A;  2WN9 A;  4UM3 P;  3ZDH A;  4AFH A;  2Y58 A;  2UZ6 A;  2VL0 A;  5L4H A;  2BG9 A;  4TWD A;  4LMJ A;  3PEO A;  3U8K A;  5AFM A;  4X5T A;  4ILB A;  3WTO A;  4A98 A;  2XQA A;  5J5F A;  2ZJU A;  2BYQ A;  5AFL A;  2XQ3 A;  5HEU A;  3ZKR A;  4QAC A;  3EI0 A;  1UV6 A;  2BR7 A;  3TLS A;  4BQT A;  2BJ0 A;  2YME A;  3P4W A;  3WTJ A;  5HEH A;  5HCM A;  3WIP A;  5J5I A;  2XZ5 A;  1I9B A;  5BP0 A;  4ZZC A;  3UU5 A;  3RI5 A;  4DBM A;  4TNV A;  4UXU A;  4NPP A;  2XYT A;  5AFK A;  4Z90 A;  4ZJT A;  3SH1 A;  2C9T A;  5HEO A;  4QAB A;  5AFH A;  3SIO A;  2XQ4 A;  4ALX A;  2BG9 E;  4UM3 A;  3ZDG A;  5AFJ A;  5LG3 A;  4QH5 A;  2XNU A;  3GUA A;  4ZRU A;  3RIF A;  5BRX A;  4FRR A;  4IRE A;  2PGZ A;  4UY2 A;  2X00 D;  3WTN A;  1UW6 A;  4TNW A;  4HFB A;  2WNC A;  5J0Z A;  5CFB A;  3WTL A;  3U8J A;  5L4E A;  4QH4 A;  3TLV A;  4BFQ A;  2YN6 A;  3EHZ A;  2YMD A;  4ILA A;  4IL9 A;  3UU3 A;  2XQ8 A;  5AIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...