4QH5A

The glic pentameric ligand-gated ion channel (wild-type) crystallized in phosphate buffer
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh5A01
4ILBA 4HQPA 2C9TA 5AFKA 2Y57A 3LSVA 2XYSA 4LMKA 2WZYA 1UV6A 5CO5A 3JADA 3JAEA 4QH4A 2YMEA 3WTOA 3WIPA 5HEHA 4HFBA 4NPPA 4AFGA 2BG9E 3RQUA 3TLVA 1UX2A 5AFNA 2M6IA 2MAWA 3TLUA 2BJ0A 3GUAA 2BG9B 2LKGA 3C84A 3WTIA 2X00D 2PH9A 4ZJTA 3RQWA 4UM3A 2ZJUA 3SH1A 2XQAA 1OEDA 2YOEA 4Z91A 5HEOA 4ILCA 3RIAA 5CFBA 1I9BA 3ZKRA 2Y7YA 3SQ9A 4ZK1A 5KZUA 5HEJA 3ZDHA 5J5IA 5AFMB 2KSRA 4LMLA 4UY2A 4F8HA 3U8MA 3WTHA 4ZZCA 2WNLA 2XQ3A 3EI0A 2X00A 4UM3P 4UM1A 3TLWA 2XZ6A 4TNVA 4B5DA 2BYRA 3ZDGA 2XQ4A 2WN9A 3WTMA 5LXBA 4QACA 4QAAA 5J5FA 5J0ZA 4TWHA 5L47A 3TLTA 2YMDA 5BW2A 2LLYA 2Y54A 4IL4A 4UM3S 3UU4A 5L4EA 2PGZA 2XZ5A 3TLSA 2XNTA 5AFLA 5JMEA 2XQ5A 3U8LA 5AFHA 3UU5A 3UQ4A 4QABA 2YN6A 2XQ7A 2BYPA 4ZJSA 4TNWA 2W8FA 5HCMA 2LKHA 3SQ6A 2W8GA 4BFQA 3UUBA 2BR8A 4LMJA 3WTKA 5AINA 5J5HA 5AFJA 4QH1A 5FJVA 5TVCA 4XK9A 5KE4A 4EZ1A 4IL9A 4A98A 4HFEA 4AFHA 4IREA 2BG9A 3RI5A 2XNUA 2XQ9A 2Y56A 4Z90A 3EAMA 3P50A 1OEDE 4ZK4A 4TWFA 3UQ7A 3WTJA 4ZR6A 5J5GA 1OEDC 4FRRA 4ZRUA 1UW6A 5LG3A 2BYNA 2Y58A 3U8KA 5L4HA 3EHZA 3UU8A 3UU3A 3U8NA 4AFTA 5AFMA 3T4MA 2WNJA 2XQ8A 3SIOA 3RHWA 2LM2A 4HFIA 4ZZBA 2BYSA 4DBMA 3RIFA 3WTNA 4BQTA 5HCJA 2M6BA 3C79A 4PIRA 3WTLA 2XNVA 4UXUA 3P4WA 4A97A 5IUXA 5HEGA 2QC1B 4ILAA 5BP0A 3JAFA 2UZ6A 2BG9C 4QH5A 2ZJVA 2VL0A 2YKSA 5HEUA 2BYQA 3PMZA 4D01A 5SYOA 4HFDA 3U8JA 4HFCA 2XYTA 4ALXA 2BR7A 3PEOA 3UU6A 3IGQA 2WNCA 4COFA 4WV9A 4HFHA 2XQ6A 4NZBA 1OEDB 5BRXA 4XHEA 4TWDA 4X5TA
chains in the Genus database with same CATH superfamily
3ETVA 5AFKA 3G06A 1BR2A 3AVRA 3K3QC 4ASKA 3E0ZA 5FY1A 3LBXB 3ETUA 3NZPA 4UF0A 2E2AA 4AFGA 3O1JA 2CEAA 2V7LA 2YDQA 4ILUA 2EHOD 4U2YA 1W0AA 2LJLA 5AQKB 3ZKRA 3O4XE 4IIJE 4UY2A 3UUMA 3SRZA 2KT9A 4U74A 1G8XA 4CI1B 1UX4A 2BYRA 4NXMT 2XASB 2BZBA 3KVAA 3VU7H 2NTYA 2HHHT 2Q9QD 4AKIA 5JMEA 5AQIB 1KNRA 3T1YT 5HXRA 3S4UA 3Q2MA 2E9XB 3Q5EA 4HE8A 3ZPOA 4PFOA 1E7PA 2GK9A 4LF5T 2KINB 2FJAA 2D9DA 3P4PA 1S35A 1WYCA 2L8KA 4EYUA 4U7IA 5HEGA 3BQLA 2WM9A 1XDPA 5C3JA 1H7CA 3WAJA 3P4SA 4EIWA 3RRCA 1KF6A 4GOUA 2LLYA 3T1HT 4YHJA 1O3XA 3Q5DA 5CO5A 2BKOA 3AB3B 1JNRA 5LGUB 3C4ZA 5ABEA 5HYAA 3QC9A 2YK0A 4DMWA 3UTKA 4BJNA 4JI0T 2ZJUA 2WDRA 1VCSA 3O1IA 5LBQB 1QSDA 2WP9A 3ZDHA 2PG8A 3LDQB 3MJXA 3E22E 3PDYA 2ACXA 3CVRA 2XQ4A 3X1DA 3PJAA 4ZEYA 4HFVA 2AXDS 2CPTA 2C0SA 2ZM6T 3TLSA 2XNTA 3OTOT 5AFLA 2LSKA 2VL8A 2LE8A 1Y01A 1HX8A 2FJDA 3ZMSB 2VQET 3AA7B 5M4YA 2E5VA 2XQ9A 3AEFA 2DL1A 3LK3B 3RIUA 4O2AE 2J1DG 3PUYF 2UXNB 5LG3A 4ZI2D 3VR9A 2BS4A 2H89A 2WNJA 4EV6A 3SIOA 4LFBT 2WSSV 4I43B 2HPLA 1QUUA 2Q9QB 3ZMTB 3OKQA 4OX9T 2XQYA 4ZI3D 4XBFB 2LOPA 3RKGA 3FZKB 5JH7E 3A5XA 3ANWB 3UULA 2WDQA 3AE9A 4PJNA 3JAEA 5KXJA 5AQLB 2JPFA 5JTGA 1HF8A 1HX1B 2I6HA 4ILCA 3ZMUB 3EDVA 4PNIA 3OBVE 2FUPA 5KZUA 2I0MA 4BAYB 4YT0A 1G73A 3RLFF 2KSRA 3WTHA 4YTPA 2W0GA 2CHNA 4NXNT 4YTNA 2DCFA 5LMUT 3ZJ1A 2DLRA 5L47A 5L4EA 2XQ5A 4I50E 3CMLA 2A9UA 2UXDT 2LKHA 5HWXA 4IE5A 5J5HA 5CJ5A 2AE9A 1DU2A 4P0BA 5KE4A 4PAGA 3R6NA 1UCUA 1MMDA 2E8IA 4CQIA 4AFTA 5JDQA 2CXLA 4H9OC 4ZZBA 3WTNA 4HWFA 3C79A 2X51A 3HKEE 3N9OA 3OPCA 5HXSA 2BG9C 2ODUA 2BYQA 2UU9T 2X66A 3KBTA 2V7JA 2BR7A 3P4RA 3ONLC 4X5TA 2UXCT 2UXBT 2K3WA 3LSVA 4UVAB 2Y57A 4LMKA 1X79A 2ACZA 2YMEA 4Q25A 5FYMA 1XMOT 1HG2A 2X00D 4DR2T 2I59A 1I6ZA 2RP4A 5EZYE 5HEOA 2XM2A 1JNZA 2W4XA 2XUEA 3ZCJA 4UM3P 2XZ6A 4KX6A 2IC6A 2BVLA 2X0YA 5FXWA 5LG4A 5E0OA 2JQ9A 4DR7T 2L3LA 4AQYT 2Z6EA 4ZI7E 3LK42 4OHFA 3H3AA 3UUBA 4H63H 3VRAA 3FZLB 2M67A 4LMJA 3RYFE 3VKHA 2BKPA 2WWVA 2VWAA 2NW7A 5AQGB 2ODVA 3K1SA 1N32T 4KUMB 2BG9A 1N36T 4IE0A 4DBRA 4UIGA 1OEDC 5HAXA 1ZP0A 2Y6XA 4DV1T 1IBLT 3PU3A 4MFRA 3LG7A 4YLHA 3PURA 4UXUA 1S94A 4K0KT 4ILAA 2KNDA 4BA9A 5BP0A 3PMZA 5HEUA 5ABFA 5J1GA 2KZ7B 3N2GE 4HWCA 5EK3A 3SOLA 3P4QA 4HWDA 5AFUL 1W0BA 4DBQA 3DP7A 2A2FX 3MXZA 4A56A 4YFSA 2QYWA 1XMQT 1QLBA 3JADA 4QH4A 3CX7B 5FXZA 3WTOA 4TV9E 4YHHT 3B57A 4L0RA 2CA5A 3AE4A 3RIAA 3AE5A 1BR4A 2X68A 1HNWT 4EZ4A 4XZCA 4ZZCA 2E9XC 1NWMX 3RYIE 2BKNA 4TNVA 3V5SA 3PUZF 2E5LT 1BR1A 4CXWA 4QAAA 3UU4A 5KX5E 4FI5A 1Z8UA 2UUAT 4IDQA 3CQGB 2W8FA 3CQXC 3LBXA 1AJ3A 1KFYA 1HFAA 2VKOA 2ZLYA 3DJBA 2K24A 4EEBA 4JYAT 4UELA 4EEDA 2XNUA 3N9PA 2UXXB 5LHHB 5LGTB 3FB2A 5J5GA 3KFWX 4CN6A 2VKJA 1VCTA 3AEEA 3T4MA 2XQ8A 2A72A 3RIFA 5FL0A 3LFMA 2KWHA 1D1CA 3Q5WA 2YU1A 4U33A 3ZLIA 5HXHA 4ALXA 4X1KE 4UR9A 1FMWA 5LA6E 4H9RC 1WLXA 4JI1T 5LB7B 4TWDA 3TLUA 4XAXB 3ZC0A 2OA5A 4GK5E 4IGUA 5JDGA 4JI8T 3IEEA 4P0AA 2WWUA 5H6RB 3CKDA 3RH3A 3ESLA 5EK4A 4UM3A 2CBIA 4UEMA 3AAEB 2DI4A 2XZEA 1MMAA 4X66T 3U78A 4DV4T 4EAHA 2PFVA 4JI3T 5HXCA 4G2AA 1HCIA 1YQ3A 4EOZB 1X9BA 3KV4A 3PUSA 4EZHA 2RA1A 2IMLA 3D0TA 3WTMA 4MLKA 3PUAA 4QX8B 1UK5A 3ZMVB 5J0ZA 1FJGT 4U31A 5JDMA 4GKJT 2L9QA 4JI7T 2JMKA 4ERRA 4QABA 2W8GA 1XNQT 1XWMA 1IZNB 2X9YA 3PE0A 4XK9A 3QK6A 1YQ4A 4N78D 5FXXA 3W15B 4Z90A 5LOVE 3BK9A 1YKHB 2YDSA 3RYCE 2NP9A 5FVKA 3KDSE 5LXTE 4JI4T 1ZHCA 5HCJA 4E7ZA 4GK0E 2QC1B 2V6XA 4YSYA 1KNZA 3U8JA 1LVKA 3M3ZB 4UVCB 4NUVA 1MIYA 4UV9B 2XPKA 5FNVE 4ILBA 3Q5XA 2WZYA 2IUBA 4I55E 3FBLA 2XSBA 3GMIA 3WIPA 4G63A 1NENA 2WCAA 4PW8A 1IJ6A 1UX2A 3TLVA 2LRKA 2LRLA 4MBQA 2OLTA 3RQWA 3C4WA 4LFCT 3RIUC 2LSYA 3F31A 5DABA 1EZ3A 1I9BA 4TUYE 3PUXF 3AAIA 4TZ4C 2WNLA 3NZQA 2K48A 3TLWA 2PBIA 2Y48B 3RC8A 2VB6A 2Q9QA 5JR9A 3HL6A 4LF8T 1VRBA 5AQNB 2JQKA 2PJQA 2BS3A 4AKGA 3ANWA 5AQFB 2CM0A 5AQHB 5AFJA 3JCFA 1UUSA 4DO0A 5TVCA 4O4JE 3RPUA 5FY7A 5L3DB 4PJMA 3L8RA 2RPAA 4YTMA 1US7B 3IHRA 2Y8DA 3WTJA 5FMNA 2Y58A 2BYNA 2BBHA 3KVBA 1XZYA 4LF6T 4HFIA 2OV9A 2HN1A 1CHUA 1U5PA 1ZOYA 3AA0B 5JRCB 2EHOB 3UFEA 4U72A 1SUMB 2IC9A 5JQGE 3KV9A 2N1GA 4CZZB 4E7SA 4NZBA 1WR6A 2LEHA 2D0TA 4WBOA 2C9TA 2NW9A 1I94T 3KV6A 3KBUA 1UV6A 1M62A 4CXXA 4H63V 4TN7B 2LM9A 2MAWA 3AE1A 5JR9B 3GUAA 4L5GA 4AXPA 3U3IA 3ZSTA 1NEKA 3AVSA 5LJNA 2IIUA 5CFBA 4AISA 4GYRA 2SPCA 2X9XA 5L3FB 5AQPB 5IYZE 4DMVA 1Y64B 3GN5B 4CI2B 5FP3A 3O9XA 5J2UE 1WR0A 4O2BE 3N5LA 2HH7A 4C91A 3ONXA 2LSIA 4UV8B 4YJ2E 4DV5T 2B76A 3VR8A 4DR4T 3EDUA 4UM3S 2LT3A 4WBNE 2V7KA 4KBMB 1MNDA 5CA1E 3FZHB 4CI3B 2JRKA 3SWHA 4OYKA 2W62A 3AA6B 3C64A 2CWYA 4KMCA 4EZ1A 4ISTA 1OXZA 4MALA 5J2TE 4FRRA 4EB6E 2MOZA 2D5UA 5L3BB 5ABHA 5L3GB 3WAKA 2LM2A 3FZFB 4AIUA 2VKHA 1D1BA 3I1AA 2XNVA 3V5UA 4AQFA 1SE7A 1M7KA 3ZYMA 4DNDA 5H6QB 2XTLA 4U2ZA 2D2SA 3IGQA 2IW5B 3VHLA 5F8PA 4IHJE 3HR0A 1HNXT 4H9SE 2H7OA 4HWIB 4NPPA 3AEAA 4DR5T 2J47A 2M6IA 4DV3T 3OYXA 4IDNA 4DUYT 2DWKA 4ZK1A 2JQHA 2LSJA 1WFDA 5L2LA 5AFMB 2DNXA 4HKAA 5DQWA 4HN9A 1IBKT 2WN9A 3I0OA 2V8SV 3N9LA 4QACA 4PJLA 3P7IA 1YW0A 2KLQA 3AECA 4ADZA 2BYPA 3SQ6A 4O8SA 2QA7A 1IAPA 5AINA 3AXJB 2CXDA 5AQMB 5FL1A 3FXDB 5LMNT 5LP6E 3LK2B 3P50A 3CIRA 1OEDE 3MK7C 5CGMA 3U8KA 5DJQC 2N2NA 3U8NA 2V7MA 3ZN1B 2JIWA 2BYSA 3JC6C 1LKXA 1T98A 1V9DA 4HEAA 2WDVA 3C50A 2ZM8A 2R6GF 2UZ6A 2MTQA 1MMGA 4JEUB 2WNCA 3RF1A 4I4TE 5KMGP 2V5DA 2LSGA 3UUNA 3ZEFB 4HFBA 3CWZB 3QUJA 1FEWA 2ZM2A 2QVAA 3IF8B 2V6YA 4TV8E 1YD8G 4MHCA 1MNEA 4EYYR 4HGAA 2CLYB 3I9YA 1HNZT 2LHRA 2XM1A 4H9NC 1J1JA 1SA0E 3EI0A 3PUWF 3ZSSA 2LHNA 2DHRA 1XNRT 2X67A 2YMDA 5HCMA 3ZC1A 4KHPT 2CHOA 4CXYA 5LNKA 5LGNB 4QX7B 3T8OA 3VRBA 3J9X1 5KDMC 2CWOA 4U7YA 4P1NA 3F57A 4O4LE 3NKZA 3RHWA 3WI3A 3P4WA 4I0UA 2PTFA 2W2UA 3JAFA 2NOXA 2ZJVA 4D01A 5SYOA 4HFDA 3NVOA 4HFCA 3QNUA 2E9XD 3PEOA 4PFPA 2V6YB 4DR6T 3UU6A 4HFHA 5BRXA 4YSXA 2IHR1 3MZKB 4F6RC 4PJJA 3A7MA 3QB5K 3ZJ2A 2FJBA 2WU2A 3QB5A 3C84A 4QXCB 2YDRA 3ZT7A 3SQ9A 2G0UA 1T7SA 4CN4A 3CK6A 3PU8A 3HA4A 1W9RA 4UM1A 5BR8T 2IAKA 3OVUA 2VURA 2YEVC 3ZDGA 3ZN0B 3IBPA 2NTXA 1MIWA 3ZT6A 2A3DA 4KHZF 2XJ7A 1KNPA 2KMFA 3U8LA 2D0UA 5L3CB 5JVDE 2BR8A 4IE7A 1ZEEA 4QH1A 1MIVA 5FJVA 5LHGB 4M1PA 2VQFT 2EHOC 1ZV4X 4A98A 4HFEA 2K5BB 4AFHA 5C2TA 3AE3A 3EAMA 4JBWF 4WNKA 2JJ9A 3K3NA 4ZR6A 3QOFA 2WS3A 3BQIA 3UU8A 4DV0T 3RGLA 2XAFB 2V1DB 2M6BA 2WB5A 4HWHA 2Q9QC 4GIWA 5JR9C 4QH5A 5FKYA 4BJMA 2DWGA 1GQEA 5LYJE 3CPZA 3ONJA 1KK7A 3UT5E 3LJCA 4HQPA 2X0LB 4NUUA 3FBZA 3KV5A 5AQTB 4DVDA 2NWBA 1UURA 5AFNA 2BDEA 2F4VT 5AQUB 2PH9A 3C51A 2FBWA 3L09A 5LJMA 2LOSA 3E08A 1CUNA 5HEJA 3NRYA 5J5IA 2XHEB 4O4IE 2NR4A 4IT4A 4YY3T 4IE4A 3PTRB 5JRCA 1D0XA 2V5CA 2EHOA 2VKDA 4QXHB 3N9MA 4JLEA 3L3PA 3UQ4A 4ZJSA 4YXDA 5JDNA 2KWIB 4X1IE 3Q9DA 4X64T 1Z0PA 4UF0B 2QGSA 1FIOA 3A8YC 4X62T 4IREA 4AKHA 3SFEA 5C8YE 3N2KE 3F2EA 3OYZA 4WYVA 1R8IA 4ZRUA 5TAOA 2WQYA 2W00A 4L9IA 5FXVA 2XY8B 3GN5A 4ZS2A 2P9BA 4OK0A 4A97A 2J4GA 3FHNA 4X65T 1HTJF 2VVNA 4ISSA 5AQOB 5AQQB 3ZYLA 4ZHQE 4V1Av 3UFGA 3DTOA 4JI5T 4QHOA 1LVFA 3RKOA 3AE8A 4DV7T 4H9QC 3HKCE 3RQUA 4ZI2C 2UUBT 2LKGA 2ZM0A 3C4XA 2W66A 4KP3C 4A5XA 2BS2A 2YOEA 2Y7YA 3PUGA 5BMVE 3H37A 5F5WA 3AAAB 4LMLA 4ZI3C 2VASA 2WY2A 2H88A 1WRDA 4AQFC 1NAFA 3K8PC 3EVYA 3TLTA 4IL4A 4B3TT 1YXRA 2X0HA 3GA8A 4JUYA 4X1YE 1B7TA 4GYSA 2CXFA 1UGOA 3FZMB 3CX8B 4WZXA 1UX5A 5IHYA 5LBMA 4DUZT 4DV6T 5HWYA 3RC3A 3EHZA 4J2CA 1U4QA 3L39A 3RX6A 5AFMA 2C5KT 5F3JA 3WTLA 1T8BA 4NIQA 2KXPB 3H3MA 1N33T 4U3CA 4JEHB 2V26A 2NW8A 4ANJA 4QXBB 5LHIB 2CLYC 1MMNA 2XQ6A 4ZS3A 4FJOA 3AXJA 4O4HE 2XSAA 3CQCB 5HEHA 1L0VA 3NWIA 2BG9E 3CX6B 4AKRB 3VKGA 2B1EA 2BJ0A 2YINA 2X9WA 3SH1A 4DV2T 2XQAA 4EXTA 5AQVB 2IDOB 2CRBA 4X20E 2C5JA 3TKLB 3N2OA 2CBJA 2XQ3A 1E1HB 5AQRB 2HN2A 5LXBA 4LFAT 2JMHA 4PK6A 3OJAA 3EUHA 2Y54A 4AQGA 5ADXL 5A1LA 3B13A 2XQ7A 3MKDA 4EGWA 4KI0F 2WU5A 3B5MA 4JV5T 3IA3A 2WMNA 3NBXX 3AE6A 4TX5A 4QKNA 2MBGA 4K0UA 4YSZA 3RI5A 4DR3T 3RRWA 1YKEB 3AA1B 3SS1A 4UVBB 5JDFA 3UQ7A 2H3RA 3KINB 2QRXA 1UW6A 4H9PC 2MYSA 3ZCIA 4GKKT 4IDZA 4DBMA 2K9AA 4ZOLE 4IDPA 5IUXA 2YKSA 4B3MT 2FJEA 3PV0F 4DIDB 4PK5A 1IBMT 3ZT5A 3PJAJ 2UUCT 3AE2A 4B6XA 2XAJB 3MACA 4ZJTA 1KEYA 3PUVF 1T72A 3P8CD 3MA9A 4Z91A 5CA0E 2W63A 2JQQA 2C5IT 1D0YA 2MPKA 5AQSB 2VK9A 2X9HA 2X00A 4B5DA 3HI2A 4P09A 3HKDE 3JC6D 4B3ST 5J5FA 4TWHA 4OFZA 3BQKA 2PGZA 5AFHA 2YN6A 5HXEA 4BFQA 1W09A 2CMRA 3AEGA 4LF7T 2VVSA 1HG5A 2W67A 2W61A 5CB4E 1N34T 5JDLA 4HTEA 5AQJB 4C90A 4ZXLA 4QWNB 4LF9T 4ZK4A 1E2AA 4TWFA 4LF4T 3UU3A 3NRXA 4CN1A 1SHZC 4Z8XA 5GONE 1J5WA 4BQTA 4AKLA 5L3EB 4PIRA 3N9NA 3AEDA 3RYHE 3GWHA 2VL0A 5JDHA 4XHEA 5BW2A 2CE7A 3UUXB 3ABVA 2XYSA 1D1AA 1VOMA 4IDOA 2N9DA 3HKBE 4B3RT 4IE6A 1J5ET 2BG9B 3WTIA 1FMVA 1WCRA 2BVMA 4AI6A 1OEDA 5FY0A 2CCQA 2WBLA 4YJ3E 1D0ZA 2WZHA 2WMOA 3I9WA 3AEBA 4F8HA 3R84B 3U8MA 1HS7A 2WZIA 3K3OA 4PK4A 5IWAT 5ABFB 1IJ5A 2J62A 1OWAA 5ABGA 2XAQB 1HR0T 2XZ5A 3UU5A 5LCYA 4TNWA 3SFDA 2H7VC 3ZYKA 2XAGB 3WTKA 4JI6T 3EABA 2BBJA 2YU2A 5DQVA 5JREA 4IL9A 1BR0A 1XDOA 2Y56A 1ZKEA 2V7IA 2WAUA 4JI2T 4OYJA 3PUQA 5L4HA 3ZMZB 3C98B 2ZMAA 4DR1T 2E9XA 2XAHB 1LRZA 4UXNB 1WYBA 3AE7A 4WW0A 5EK2A 3I0QA 2HPJA 3J7Yq 2XYTA 3FXEB 3N9QA 5FVLA 3O1HA 3M65A 4COFA 4WV9A 5ETWA 1OEDB 2ES0A
chains in the Genus database with same CATH topology
4ILBA 4HQPA 2C9TA 5AFKA 2Y57A 3LSVA 2XYSA 4LMKA 2WZYA 1UV6A 5CO5A 3JADA 3JAEA 4QH4A 2YMEA 3WTOA 3WIPA 5HEHA 4HFBA 4NPPA 4AFGA 2BG9E 3RQUA 3TLVA 1UX2A 5AFNA 2M6IA 2MAWA 3TLUA 2BJ0A 3GUAA 2BG9B 2LKGA 3C84A 3WTIA 2X00D 2PH9A 4ZJTA 3RQWA 4UM3A 2ZJUA 3SH1A 2XQAA 1OEDA 2YOEA 4Z91A 5HEOA 4ILCA 3RIAA 5CFBA 1I9BA 3ZKRA 2Y7YA 3SQ9A 4ZK1A 5KZUA 5HEJA 3ZDHA 5J5IA 5AFMB 2KSRA 4LMLA 4UY2A 4F8HA 3U8MA 3WTHA 4ZZCA 2WNLA 2XQ3A 3EI0A 2X00A 4UM3P 4UM1A 3TLWA 2XZ6A 4TNVA 4B5DA 2BYRA 3ZDGA 2XQ4A 2WN9A 3WTMA 5LXBA 4QACA 4QAAA 5J5FA 5J0ZA 4TWHA 5L47A 3TLTA 2YMDA 5BW2A 2LLYA 2Y54A 4IL4A 4UM3S 3UU4A 5L4EA 2PGZA 2XZ5A 3TLSA 2XNTA 5AFLA 5JMEA 2XQ5A 3U8LA 5AFHA 3UU5A 3UQ4A 4QABA 2YN6A 2XQ7A 2BYPA 4ZJSA 4TNWA 2W8FA 5HCMA 2LKHA 3SQ6A 2W8GA 4BFQA 3UUBA 2BR8A 4LMJA 3WTKA 5AINA 5J5HA 5AFJA 4QH1A 5FJVA 5TVCA 4XK9A 5KE4A 4EZ1A 4IL9A 4A98A 4HFEA 4AFHA 4IREA 2BG9A 3RI5A 2XNUA 2XQ9A 2Y56A 4Z90A 3EAMA 3P50A 1OEDE 4ZK4A 4TWFA 3UQ7A 3WTJA 4ZR6A 5J5GA 1OEDC 4FRRA 4ZRUA 1UW6A 5LG3A 2BYNA 2Y58A 3U8KA 5L4HA 3EHZA 3UU8A 3UU3A 3U8NA 4AFTA 5AFMA 3T4MA 2WNJA 2XQ8A 3SIOA 3RHWA 2LM2A 4HFIA 4ZZBA 2BYSA 4DBMA 3RIFA 3WTNA 4BQTA 5HCJA 2M6BA 3C79A 4PIRA 3WTLA 2XNVA 4UXUA 3P4WA 4A97A 5IUXA 5HEGA 2QC1B 4ILAA 5BP0A 3JAFA 2UZ6A 2BG9C 4QH5A 2ZJVA 2VL0A 2YKSA 5HEUA 2BYQA 3PMZA 4D01A 5SYOA 4HFDA 3U8JA 4HFCA 2XYTA 4ALXA 2BR7A 3PEOA 3UU6A 3IGQA 2WNCA 4COFA 4WV9A 4HFHA 2XQ6A 4NZBA 1OEDB 5BRXA 4XHEA 4TWDA 4X5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILB A;  4HQP A;  2C9T A;  5AFK A;  2Y57 A;  3LSV A;  2XYS A;  4LMK A;  2WZY A;  1UV6 A;  5CO5 A;  3JAD A;  3JAE A;  4QH4 A;  2YME A;  3WTO A;  3WIP A;  5HEH A;  4HFB A;  4NPP A;  4AFG A;  2BG9 E;  3RQU A;  3TLV A;  1UX2 A;  5AFN A;  2M6I A;  2MAW A;  3TLU A;  2BJ0 A;  3GUA A;  2BG9 B;  2LKG A;  3C84 A;  3WTI A;  2X00 D;  2PH9 A;  4ZJT A;  3RQW A;  4UM3 A;  2ZJU A;  3SH1 A;  2XQA A;  1OED A;  2YOE A;  4Z91 A;  5HEO A;  4ILC A;  3RIA A;  5CFB A;  1I9B A;  3ZKR A;  2Y7Y A;  3SQ9 A;  4ZK1 A;  5KZU A;  5HEJ A;  3ZDH A;  5J5I A;  5AFM B;  2KSR A;  4LML A;  4UY2 A;  4F8H A;  3U8M A;  3WTH A;  4ZZC A;  2WNL A;  2XQ3 A;  3EI0 A;  2X00 A;  4UM3 P;  4UM1 A;  3TLW A;  2XZ6 A;  4TNV A;  4B5D A;  2BYR A;  3ZDG A;  2XQ4 A;  2WN9 A;  3WTM A;  5LXB A;  4QAC A;  4QAA A;  5J5F A;  5J0Z A;  4TWH A;  5L47 A;  3TLT A;  2YMD A;  5BW2 A;  2LLY A;  2Y54 A;  4IL4 A;  4UM3 S;  3UU4 A;  5L4E A;  2PGZ A;  2XZ5 A;  3TLS A;  2XNT A;  5AFL A;  5JME A;  2XQ5 A;  3U8L A;  5AFH A;  3UU5 A;  3UQ4 A;  4QAB A;  2YN6 A;  2XQ7 A;  2BYP A;  4ZJS A;  4TNW A;  2W8F A;  5HCM A;  2LKH A;  3SQ6 A;  2W8G A;  4BFQ A;  3UUB A;  2BR8 A;  4LMJ A;  3WTK A;  5AIN A;  5J5H A;  5AFJ A;  4QH1 A;  5FJV A;  5TVC A;  4XK9 A;  5KE4 A;  4EZ1 A;  4IL9 A;  4A98 A;  4HFE A;  4AFH A;  4IRE A;  2BG9 A;  3RI5 A;  2XNU A;  2XQ9 A;  2Y56 A;  4Z90 A;  3EAM A;  3P50 A;  1OED E;  4ZK4 A;  4TWF A;  3UQ7 A;  3WTJ A;  4ZR6 A;  5J5G A;  1OED C;  4FRR A;  4ZRU A;  1UW6 A;  5LG3 A;  2BYN A;  2Y58 A;  3U8K A;  5L4H A;  3EHZ A;  3UU8 A;  3UU3 A;  3U8N A;  4AFT A;  5AFM A;  3T4M A;  2WNJ A;  2XQ8 A;  3SIO A;  3RHW A;  2LM2 A;  4HFI A;  4ZZB A;  2BYS A;  4DBM A;  3RIF A;  3WTN A;  4BQT A;  5HCJ A;  2M6B A;  3C79 A;  4PIR A;  3WTL A;  2XNV A;  4UXU A;  3P4W A;  4A97 A;  5IUX A;  5HEG A;  2QC1 B;  4ILA A;  5BP0 A;  3JAF A;  2UZ6 A;  2BG9 C;  4QH5 A;  2ZJV A;  2VL0 A;  2YKS A;  5HEU A;  2BYQ A;  3PMZ A;  4D01 A;  5SYO A;  4HFD A;  3U8J A;  4HFC A;  2XYT A;  4ALX A;  2BR7 A;  3PEO A;  3UU6 A;  3IGQ A;  2WNC A;  4COF A;  4WV9 A;  4HFH A;  2XQ6 A;  4NZB A;  1OED B;  5BRX A;  4XHE A;  4TWD A;  4X5T A; 
#chains in the Genus database with same CATH topology
 3ETV A;  5AFK A;  3G06 A;  1BR2 A;  3AVR A;  3K3Q C;  4ASK A;  3E0Z A;  5FY1 A;  3LBX B;  3ETU A;  3NZP A;  4UF0 A;  2E2A A;  4AFG A;  3O1J A;  2CEA A;  2V7L A;  2YDQ A;  4ILU A;  2EHO D;  4U2Y A;  1W0A A;  2LJL A;  5AQK B;  3ZKR A;  3O4X E;  4IIJ E;  4UY2 A;  3UUM A;  3SRZ A;  2KT9 A;  4U74 A;  1G8X A;  4CI1 B;  1UX4 A;  2BYR A;  4NXM T;  2XAS B;  2BZB A;  3KVA A;  3VU7 H;  2NTY A;  2HHH T;  2Q9Q D;  4AKI A;  5JME A;  5AQI B;  1KNR A;  3T1Y T;  5HXR A;  3S4U A;  3Q2M A;  2E9X B;  3Q5E A;  4HE8 A;  3ZPO A;  4PFO A;  1E7P A;  2GK9 A;  4LF5 T;  2KIN B;  2FJA A;  2D9D A;  3P4P A;  1S35 A;  1WYC A;  2L8K A;  4EYU A;  4U7I A;  5HEG A;  3BQL A;  2WM9 A;  1XDP A;  5C3J A;  1H7C A;  3WAJ A;  3P4S A;  4EIW A;  3RRC A;  1KF6 A;  4GOU A;  2LLY A;  3T1H T;  4YHJ A;  1O3X A;  3Q5D A;  5CO5 A;  2BKO A;  3AB3 B;  1JNR A;  5LGU B;  3C4Z A;  5ABE A;  5HYA A;  3QC9 A;  2YK0 A;  4DMW A;  3UTK A;  4BJN A;  4JI0 T;  2ZJU A;  2WDR A;  1VCS A;  3O1I A;  5LBQ B;  1QSD A;  2WP9 A;  3ZDH A;  2PG8 A;  3LDQ B;  3MJX A;  3E22 E;  3PDY A;  2ACX A;  3CVR A;  2XQ4 A;  3X1D A;  3PJA A;  4ZEY A;  4HFV A;  2AXD S;  2CPT A;  2C0S A;  2ZM6 T;  3TLS A;  2XNT A;  3OTO T;  5AFL A;  2LSK A;  2VL8 A;  2LE8 A;  1Y01 A;  1HX8 A;  2FJD A;  3ZMS B;  2VQE T;  3AA7 B;  5M4Y A;  2E5V A;  2XQ9 A;  3AEF A;  2DL1 A;  3LK3 B;  3RIU A;  4O2A E;  2J1D G;  3PUY F;  2UXN B;  5LG3 A;  4ZI2 D;  3VR9 A;  2BS4 A;  2H89 A;  2WNJ A;  4EV6 A;  3SIO A;  4LFB T;  2WSS V;  4I43 B;  2HPL A;  1QUU A;  2Q9Q B;  3ZMT B;  3OKQ A;  4OX9 T;  2XQY A;  4ZI3 D;  4XBF B;  2LOP A;  3RKG A;  3FZK B;  5JH7 E;  3A5X A;  3ANW B;  3UUL A;  2WDQ A;  3AE9 A;  4PJN A;  3JAE A;  5KXJ A;  5AQL B;  2JPF A;  5JTG A;  1HF8 A;  1HX1 B;  2I6H A;  4ILC A;  3ZMU B;  3EDV A;  4PNI A;  3OBV E;  2FUP A;  5KZU A;  2I0M A;  4BAY B;  4YT0 A;  1G73 A;  3RLF F;  2KSR A;  3WTH A;  4YTP A;  2W0G A;  2CHN A;  4NXN T;  4YTN A;  2DCF A;  5LMU T;  3ZJ1 A;  2DLR A;  5L47 A;  5L4E A;  2XQ5 A;  4I50 E;  3CML A;  2A9U A;  2UXD T;  2LKH A;  5HWX A;  4IE5 A;  5J5H A;  5CJ5 A;  2AE9 A;  1DU2 A;  4P0B A;  5KE4 A;  4PAG A;  3R6N A;  1UCU A;  1MMD A;  2E8I A;  4CQI A;  4AFT A;  5JDQ A;  2CXL A;  4H9O C;  4ZZB A;  3WTN A;  4HWF A;  3C79 A;  2X51 A;  3HKE E;  3N9O A;  3OPC A;  5HXS A;  2BG9 C;  2ODU A;  2BYQ A;  2UU9 T;  2X66 A;  3KBT A;  2V7J A;  2BR7 A;  3P4R A;  3ONL C;  4X5T A;  2UXC T;  2UXB T;  2K3W A;  3LSV A;  4UVA B;  2Y57 A;  4LMK A;  1X79 A;  2ACZ A;  2YME A;  4Q25 A;  5FYM A;  1XMO T;  1HG2 A;  2X00 D;  4DR2 T;  2I59 A;  1I6Z A;  2RP4 A;  5EZY E;  5HEO A;  2XM2 A;  1JNZ A;  2W4X A;  2XUE A;  3ZCJ A;  4UM3 P;  2XZ6 A;  4KX6 A;  2IC6 A;  2BVL A;  2X0Y A;  5FXW A;  5LG4 A;  5E0O A;  2JQ9 A;  4DR7 T;  2L3L A;  4AQY T;  2Z6E A;  4ZI7 E;  3LK4 2;  4OHF A;  3H3A A;  3UUB A;  4H63 H;  3VRA A;  3FZL B;  2M67 A;  4LMJ A;  3RYF E;  3VKH A;  2BKP A;  2WWV A;  2VWA A;  2NW7 A;  5AQG B;  2ODV A;  3K1S A;  1N32 T;  4KUM B;  2BG9 A;  1N36 T;  4IE0 A;  4DBR A;  4UIG A;  1OED C;  5HAX A;  1ZP0 A;  2Y6X A;  4DV1 T;  1IBL T;  3PU3 A;  4MFR A;  3LG7 A;  4YLH A;  3PUR A;  4UXU A;  1S94 A;  4K0K T;  4ILA A;  2KND A;  4BA9 A;  5BP0 A;  3PMZ A;  5HEU A;  5ABF A;  5J1G A;  2KZ7 B;  3N2G E;  4HWC A;  5EK3 A;  3SOL A;  3P4Q A;  4HWD A;  5AFU L;  1W0B A;  4DBQ A;  3DP7 A;  2A2F X;  3MXZ A;  4A56 A;  4YFS A;  2QYW A;  1XMQ T;  1QLB A;  3JAD A;  4QH4 A;  3CX7 B;  5FXZ A;  3WTO A;  4TV9 E;  4YHH T;  3B57 A;  4L0R A;  2CA5 A;  3AE4 A;  3RIA A;  3AE5 A;  1BR4 A;  2X68 A;  1HNW T;  4EZ4 A;  4XZC A;  4ZZC A;  2E9X C;  1NWM X;  3RYI E;  2BKN A;  4TNV A;  3V5S A;  3PUZ F;  2E5L T;  1BR1 A;  4CXW A;  4QAA A;  3UU4 A;  5KX5 E;  4FI5 A;  1Z8U A;  2UUA T;  4IDQ A;  3CQG B;  2W8F A;  3CQX C;  3LBX A;  1AJ3 A;  1KFY A;  1HFA A;  2VKO A;  2ZLY A;  3DJB A;  2K24 A;  4EEB A;  4JYA T;  4UEL A;  4EED A;  2XNU A;  3N9P A;  2UXX B;  5LHH B;  5LGT B;  3FB2 A;  5J5G A;  3KFW X;  4CN6 A;  2VKJ A;  1VCT A;  3AEE A;  3T4M A;  2XQ8 A;  2A72 A;  3RIF A;  5FL0 A;  3LFM A;  2KWH A;  1D1C A;  3Q5W A;  2YU1 A;  4U33 A;  3ZLI A;  5HXH A;  4ALX A;  4X1K E;  4UR9 A;  1FMW A;  5LA6 E;  4H9R C;  1WLX A;  4JI1 T;  5LB7 B;  4TWD A;  3TLU A;  4XAX B;  3ZC0 A;  2OA5 A;  4GK5 E;  4IGU A;  5JDG A;  4JI8 T;  3IEE A;  4P0A A;  2WWU A;  5H6R B;  3CKD A;  3RH3 A;  3ESL A;  5EK4 A;  4UM3 A;  2CBI A;  4UEM A;  3AAE B;  2DI4 A;  2XZE A;  1MMA A;  4X66 T;  3U78 A;  4DV4 T;  4EAH A;  2PFV A;  4JI3 T;  5HXC A;  4G2A A;  1HCI A;  1YQ3 A;  4EOZ B;  1X9B A;  3KV4 A;  3PUS A;  4EZH A;  2RA1 A;  2IML A;  3D0T A;  3WTM A;  4MLK A;  3PUA A;  4QX8 B;  1UK5 A;  3ZMV B;  5J0Z A;  1FJG T;  4U31 A;  5JDM A;  4GKJ T;  2L9Q A;  4JI7 T;  2JMK A;  4ERR A;  4QAB A;  2W8G A;  1XNQ T;  1XWM A;  1IZN B;  2X9Y A;  3PE0 A;  4XK9 A;  3QK6 A;  1YQ4 A;  4N78 D;  5FXX A;  3W15 B;  4Z90 A;  5LOV E;  3BK9 A;  1YKH B;  2YDS A;  3RYC E;  2NP9 A;  5FVK A;  3KDS E;  5LXT E;  4JI4 T;  1ZHC A;  5HCJ A;  4E7Z A;  4GK0 E;  2QC1 B;  2V6X A;  4YSY A;  1KNZ A;  3U8J A;  1LVK A;  3M3Z B;  4UVC B;  4NUV A;  1MIY A;  4UV9 B;  2XPK A;  5FNV E;  4ILB A;  3Q5X A;  2WZY A;  2IUB A;  4I55 E;  3FBL A;  2XSB A;  3GMI A;  3WIP A;  4G63 A;  1NEN A;  2WCA A;  4PW8 A;  1IJ6 A;  1UX2 A;  3TLV A;  2LRK A;  2LRL A;  4MBQ A;  2OLT A;  3RQW A;  3C4W A;  4LFC T;  3RIU C;  2LSY A;  3F31 A;  5DAB A;  1EZ3 A;  1I9B A;  4TUY E;  3PUX F;  3AAI A;  4TZ4 C;  2WNL A;  3NZQ A;  2K48 A;  3TLW A;  2PBI A;  2Y48 B;  3RC8 A;  2VB6 A;  2Q9Q A;  5JR9 A;  3HL6 A;  4LF8 T;  1VRB A;  5AQN B;  2JQK A;  2PJQ A;  2BS3 A;  4AKG A;  3ANW A;  5AQF B;  2CM0 A;  5AQH B;  5AFJ A;  3JCF A;  1UUS A;  4DO0 A;  5TVC A;  4O4J E;  3RPU A;  5FY7 A;  5L3D B;  4PJM A;  3L8R A;  2RPA A;  4YTM A;  1US7 B;  3IHR A;  2Y8D A;  3WTJ A;  5FMN A;  2Y58 A;  2BYN A;  2BBH A;  3KVB A;  1XZY A;  4LF6 T;  4HFI A;  2OV9 A;  2HN1 A;  1CHU A;  1U5P A;  1ZOY A;  3AA0 B;  5JRC B;  2EHO B;  3UFE A;  4U72 A;  1SUM B;  2IC9 A;  5JQG E;  3KV9 A;  2N1G A;  4CZZ B;  4E7S A;  4NZB A;  1WR6 A;  2LEH A;  2D0T A;  4WBO A;  2C9T A;  2NW9 A;  1I94 T;  3KV6 A;  3KBU A;  1UV6 A;  1M62 A;  4CXX A;  4H63 V;  4TN7 B;  2LM9 A;  2MAW A;  3AE1 A;  5JR9 B;  3GUA A;  4L5G A;  4AXP A;  3U3I A;  3ZST A;  1NEK A;  3AVS A;  5LJN A;  2IIU A;  5CFB A;  4AIS A;  4GYR A;  2SPC A;  2X9X A;  5L3F B;  5AQP B;  5IYZ E;  4DMV A;  1Y64 B;  3GN5 B;  4CI2 B;  5FP3 A;  3O9X A;  5J2U E;  1WR0 A;  4O2B E;  3N5L A;  2HH7 A;  4C91 A;  3ONX A;  2LSI A;  4UV8 B;  4YJ2 E;  4DV5 T;  2B76 A;  3VR8 A;  4DR4 T;  3EDU A;  4UM3 S;  2LT3 A;  4WBN E;  2V7K A;  4KBM B;  1MND A;  5CA1 E;  3FZH B;  4CI3 B;  2JRK A;  3SWH A;  4OYK A;  2W62 A;  3AA6 B;  3C64 A;  2CWY A;  4KMC A;  4EZ1 A;  4IST A;  1OXZ A;  4MAL A;  5J2T E;  4FRR A;  4EB6 E;  2MOZ A;  2D5U A;  5L3B B;  5ABH A;  5L3G B;  3WAK A;  2LM2 A;  3FZF B;  4AIU A;  2VKH A;  1D1B A;  3I1A A;  2XNV A;  3V5U A;  4AQF A;  1SE7 A;  1M7K A;  3ZYM A;  4DND A;  5H6Q B;  2XTL A;  4U2Z A;  2D2S A;  3IGQ A;  2IW5 B;  3VHL A;  5F8P A;  4IHJ E;  3HR0 A;  1HNX T;  4H9S E;  2H7O A;  4HWI B;  4NPP A;  3AEA A;  4DR5 T;  2J47 A;  2M6I A;  4DV3 T;  3OYX A;  4IDN A;  4DUY T;  2DWK A;  4ZK1 A;  2JQH A;  2LSJ A;  1WFD A;  5L2L A;  5AFM B;  2DNX A;  4HKA A;  5DQW A;  4HN9 A;  1IBK T;  2WN9 A;  3I0O A;  2V8S V;  3N9L A;  4QAC A;  4PJL A;  3P7I A;  1YW0 A;  2KLQ A;  3AEC A;  4ADZ A;  2BYP A;  3SQ6 A;  4O8S A;  2QA7 A;  1IAP A;  5AIN A;  3AXJ B;  2CXD A;  5AQM B;  5FL1 A;  3FXD B;  5LMN T;  5LP6 E;  3LK2 B;  3P50 A;  3CIR A;  1OED E;  3MK7 C;  5CGM A;  3U8K A;  5DJQ C;  2N2N A;  3U8N A;  2V7M A;  3ZN1 B;  2JIW A;  2BYS A;  3JC6 C;  1LKX A;  1T98 A;  1V9D A;  4HEA A;  2WDV A;  3C50 A;  2ZM8 A;  2R6G F;  2UZ6 A;  2MTQ A;  1MMG A;  4JEU B;  2WNC A;  3RF1 A;  4I4T E;  5KMG P;  2V5D A;  2LSG A;  3UUN A;  3ZEF B;  4HFB A;  3CWZ B;  3QUJ A;  1FEW A;  2ZM2 A;  2QVA A;  3IF8 B;  2V6Y A;  4TV8 E;  1YD8 G;  4MHC A;  1MNE A;  4EYY R;  4HGA A;  2CLY B;  3I9Y A;  1HNZ T;  2LHR A;  2XM1 A;  4H9N C;  1J1J A;  1SA0 E;  3EI0 A;  3PUW F;  3ZSS A;  2LHN A;  2DHR A;  1XNR T;  2X67 A;  2YMD A;  5HCM A;  3ZC1 A;  4KHP T;  2CHO A;  4CXY A;  5LNK A;  5LGN B;  4QX7 B;  3T8O A;  3VRB A;  3J9X 1;  5KDM C;  2CWO A;  4U7Y A;  4P1N A;  3F57 A;  4O4L E;  3NKZ A;  3RHW A;  3WI3 A;  3P4W A;  4I0U A;  2PTF A;  2W2U A;  3JAF A;  2NOX A;  2ZJV A;  4D01 A;  5SYO A;  4HFD A;  3NVO A;  4HFC A;  3QNU A;  2E9X D;  3PEO A;  4PFP A;  2V6Y B;  4DR6 T;  3UU6 A;  4HFH A;  5BRX A;  4YSX A;  2IHR 1;  3MZK B;  4F6R C;  4PJJ A;  3A7M A;  3QB5 K;  3ZJ2 A;  2FJB A;  2WU2 A;  3QB5 A;  3C84 A;  4QXC B;  2YDR A;  3ZT7 A;  3SQ9 A;  2G0U A;  1T7S A;  4CN4 A;  3CK6 A;  3PU8 A;  3HA4 A;  1W9R A;  4UM1 A;  5BR8 T;  2IAK A;  3OVU A;  2VUR A;  2YEV C;  3ZDG A;  3ZN0 B;  3IBP A;  2NTX A;  1MIW A;  3ZT6 A;  2A3D A;  4KHZ F;  2XJ7 A;  1KNP A;  2KMF A;  3U8L A;  2D0U A;  5L3C B;  5JVD E;  2BR8 A;  4IE7 A;  1ZEE A;  4QH1 A;  1MIV A;  5FJV A;  5LHG B;  4M1P A;  2VQF T;  2EHO C;  1ZV4 X;  4A98 A;  4HFE A;  2K5B B;  4AFH A;  5C2T A;  3AE3 A;  3EAM A;  4JBW F;  4WNK A;  2JJ9 A;  3K3N A;  4ZR6 A;  3QOF A;  2WS3 A;  3BQI A;  3UU8 A;  4DV0 T;  3RGL A;  2XAF B;  2V1D B;  2M6B A;  2WB5 A;  4HWH A;  2Q9Q C;  4GIW A;  5JR9 C;  4QH5 A;  5FKY A;  4BJM A;  2DWG A;  1GQE A;  5LYJ E;  3CPZ A;  3ONJ A;  1KK7 A;  3UT5 E;  3LJC A;  4HQP A;  2X0L B;  4NUU A;  3FBZ A;  3KV5 A;  5AQT B;  4DVD A;  2NWB A;  1UUR A;  5AFN A;  2BDE A;  2F4V T;  5AQU B;  2PH9 A;  3C51 A;  2FBW A;  3L09 A;  5LJM A;  2LOS A;  3E08 A;  1CUN A;  5HEJ A;  3NRY A;  5J5I A;  2XHE B;  4O4I E;  2NR4 A;  4IT4 A;  4YY3 T;  4IE4 A;  3PTR B;  5JRC A;  1D0X A;  2V5C A;  2EHO A;  2VKD A;  4QXH B;  3N9M A;  4JLE A;  3L3P A;  3UQ4 A;  4ZJS A;  4YXD A;  5JDN A;  2KWI B;  4X1I E;  3Q9D A;  4X64 T;  1Z0P A;  4UF0 B;  2QGS A;  1FIO A;  3A8Y C;  4X62 T;  4IRE A;  4AKH A;  3SFE A;  5C8Y E;  3N2K E;  3F2E A;  3OYZ A;  4WYV A;  1R8I A;  4ZRU A;  5TAO A;  2WQY A;  2W00 A;  4L9I A;  5FXV A;  2XY8 B;  3GN5 A;  4ZS2 A;  2P9B A;  4OK0 A;  4A97 A;  2J4G A;  3FHN A;  4X65 T;  1HTJ F;  2VVN A;  4ISS A;  5AQO B;  5AQQ B;  3ZYL A;  4ZHQ E;  4V1A v;  3UFG A;  3DTO A;  4JI5 T;  4QHO A;  1LVF A;  3RKO A;  3AE8 A;  4DV7 T;  4H9Q C;  3HKC E;  3RQU A;  4ZI2 C;  2UUB T;  2LKG A;  2ZM0 A;  3C4X A;  2W66 A;  4KP3 C;  4A5X A;  2BS2 A;  2YOE A;  2Y7Y A;  3PUG A;  5BMV E;  3H37 A;  5F5W A;  3AAA B;  4LML A;  4ZI3 C;  2VAS A;  2WY2 A;  2H88 A;  1WRD A;  4AQF C;  1NAF A;  3K8P C;  3EVY A;  3TLT A;  4IL4 A;  4B3T T;  1YXR A;  2X0H A;  3GA8 A;  4JUY A;  4X1Y E;  1B7T A;  4GYS A;  2CXF A;  1UGO A;  3FZM B;  3CX8 B;  4WZX A;  1UX5 A;  5IHY A;  5LBM A;  4DUZ T;  4DV6 T;  5HWY A;  3RC3 A;  3EHZ A;  4J2C A;  1U4Q A;  3L39 A;  3RX6 A;  5AFM A;  2C5K T;  5F3J A;  3WTL A;  1T8B A;  4NIQ A;  2KXP B;  3H3M A;  1N33 T;  4U3C A;  4JEH B;  2V26 A;  2NW8 A;  4ANJ A;  4QXB B;  5LHI B;  2CLY C;  1MMN A;  2XQ6 A;  4ZS3 A;  4FJO A;  3AXJ A;  4O4H E;  2XSA A;  3CQC B;  5HEH A;  1L0V A;  3NWI A;  2BG9 E;  3CX6 B;  4AKR B;  3VKG A;  2B1E A;  2BJ0 A;  2YIN A;  2X9W A;  3SH1 A;  4DV2 T;  2XQA A;  4EXT A;  5AQV B;  2IDO B;  2CRB A;  4X20 E;  2C5J A;  3TKL B;  3N2O A;  2CBJ A;  2XQ3 A;  1E1H B;  5AQR B;  2HN2 A;  5LXB A;  4LFA T;  2JMH A;  4PK6 A;  3OJA A;  3EUH A;  2Y54 A;  4AQG A;  5ADX L;  5A1L A;  3B13 A;  2XQ7 A;  3MKD A;  4EGW A;  4KI0 F;  2WU5 A;  3B5M A;  4JV5 T;  3IA3 A;  2WMN A;  3NBX X;  3AE6 A;  4TX5 A;  4QKN A;  2MBG A;  4K0U A;  4YSZ A;  3RI5 A;  4DR3 T;  3RRW A;  1YKE B;  3AA1 B;  3SS1 A;  4UVB B;  5JDF A;  3UQ7 A;  2H3R A;  3KIN B;  2QRX A;  1UW6 A;  4H9P C;  2MYS A;  3ZCI A;  4GKK T;  4IDZ A;  4DBM A;  2K9A A;  4ZOL E;  4IDP A;  5IUX A;  2YKS A;  4B3M T;  2FJE A;  3PV0 F;  4DID B;  4PK5 A;  1IBM T;  3ZT5 A;  3PJA J;  2UUC T;  3AE2 A;  4B6X A;  2XAJ B;  3MAC A;  4ZJT A;  1KEY A;  3PUV F;  1T72 A;  3P8C D;  3MA9 A;  4Z91 A;  5CA0 E;  2W63 A;  2JQQ A;  2C5I T;  1D0Y A;  2MPK A;  5AQS B;  2VK9 A;  2X9H A;  2X00 A;  4B5D A;  3HI2 A;  4P09 A;  3HKD E;  3JC6 D;  4B3S T;  5J5F A;  4TWH A;  4OFZ A;  3BQK A;  2PGZ A;  5AFH A;  2YN6 A;  5HXE A;  4BFQ A;  1W09 A;  2CMR A;  3AEG A;  4LF7 T;  2VVS A;  1HG5 A;  2W67 A;  2W61 A;  5CB4 E;  1N34 T;  5JDL A;  4HTE A;  5AQJ B;  4C90 A;  4ZXL A;  4QWN B;  4LF9 T;  4ZK4 A;  1E2A A;  4TWF A;  4LF4 T;  3UU3 A;  3NRX A;  4CN1 A;  1SHZ C;  4Z8X A;  5GON E;  1J5W A;  4BQT A;  4AKL A;  5L3E B;  4PIR A;  3N9N A;  3AED A;  3RYH E;  3GWH A;  2VL0 A;  5JDH A;  4XHE A;  5BW2 A;  2CE7 A;  3UUX B;  3ABV A;  2XYS A;  1D1A A;  1VOM A;  4IDO A;  2N9D A;  3HKB E;  4B3R T;  4IE6 A;  1J5E T;  2BG9 B;  3WTI A;  1FMV A;  1WCR A;  2BVM A;  4AI6 A;  1OED A;  5FY0 A;  2CCQ A;  2WBL A;  4YJ3 E;  1D0Z A;  2WZH A;  2WMO A;  3I9W A;  3AEB A;  4F8H A;  3R84 B;  3U8M A;  1HS7 A;  2WZI A;  3K3O A;  4PK4 A;  5IWA T;  5ABF B;  1IJ5 A;  2J62 A;  1OWA A;  5ABG A;  2XAQ B;  1HR0 T;  2XZ5 A;  3UU5 A;  5LCY A;  4TNW A;  3SFD A;  2H7V C;  3ZYK A;  2XAG B;  3WTK A;  4JI6 T;  3EAB A;  2BBJ A;  2YU2 A;  5DQV A;  5JRE A;  4IL9 A;  1BR0 A;  1XDO A;  2Y56 A;  1ZKE A;  2V7I A;  2WAU A;  4JI2 T;  4OYJ A;  3PUQ A;  5L4H A;  3ZMZ B;  3C98 B;  2ZMA A;  4DR1 T;  2E9X A;  2XAH B;  1LRZ A;  4UXN B;  1WYB A;  3AE7 A;  4WW0 A;  5EK2 A;  3I0Q A;  2HPJ A;  3J7Y q;  2XYT A;  3FXE B;  3N9Q A;  5FVL A;  3O1H A;  3M65 A;  4COF A;  4WV9 A;  5ETW A;  1OED B;  2ES0 A; 
#chains in the Genus database with same CATH homology
 4ILB A;  4HQP A;  2C9T A;  5AFK A;  2Y57 A;  3LSV A;  2XYS A;  4LMK A;  2WZY A;  1UV6 A;  5CO5 A;  3JAD A;  3JAE A;  4QH4 A;  2YME A;  3WTO A;  3WIP A;  5HEH A;  4HFB A;  4NPP A;  4AFG A;  2BG9 E;  3RQU A;  3TLV A;  1UX2 A;  5AFN A;  2M6I A;  2MAW A;  3TLU A;  2BJ0 A;  3GUA A;  2BG9 B;  2LKG A;  3C84 A;  3WTI A;  2X00 D;  2PH9 A;  4ZJT A;  3RQW A;  4UM3 A;  2ZJU A;  3SH1 A;  2XQA A;  1OED A;  2YOE A;  4Z91 A;  5HEO A;  4ILC A;  3RIA A;  5CFB A;  1I9B A;  3ZKR A;  2Y7Y A;  3SQ9 A;  4ZK1 A;  5KZU A;  5HEJ A;  3ZDH A;  5J5I A;  5AFM B;  2KSR A;  4LML A;  4UY2 A;  4F8H A;  3U8M A;  3WTH A;  4ZZC A;  2WNL A;  2XQ3 A;  3EI0 A;  2X00 A;  4UM3 P;  4UM1 A;  3TLW A;  2XZ6 A;  4TNV A;  4B5D A;  2BYR A;  3ZDG A;  2XQ4 A;  2WN9 A;  3WTM A;  5LXB A;  4QAC A;  4QAA A;  5J5F A;  5J0Z A;  4TWH A;  5L47 A;  3TLT A;  2YMD A;  5BW2 A;  2LLY A;  2Y54 A;  4IL4 A;  4UM3 S;  3UU4 A;  5L4E A;  2PGZ A;  2XZ5 A;  3TLS A;  2XNT A;  5AFL A;  5JME A;  2XQ5 A;  3U8L A;  5AFH A;  3UU5 A;  3UQ4 A;  4QAB A;  2YN6 A;  2XQ7 A;  2BYP A;  4ZJS A;  4TNW A;  2W8F A;  5HCM A;  2LKH A;  3SQ6 A;  2W8G A;  4BFQ A;  3UUB A;  2BR8 A;  4LMJ A;  3WTK A;  5AIN A;  5J5H A;  5AFJ A;  4QH1 A;  5FJV A;  5TVC A;  4XK9 A;  5KE4 A;  4EZ1 A;  4IL9 A;  4A98 A;  4HFE A;  4AFH A;  4IRE A;  2BG9 A;  3RI5 A;  2XNU A;  2XQ9 A;  2Y56 A;  4Z90 A;  3EAM A;  3P50 A;  1OED E;  4ZK4 A;  4TWF A;  3UQ7 A;  3WTJ A;  4ZR6 A;  5J5G A;  1OED C;  4FRR A;  4ZRU A;  1UW6 A;  5LG3 A;  2BYN A;  2Y58 A;  3U8K A;  5L4H A;  3EHZ A;  3UU8 A;  3UU3 A;  3U8N A;  4AFT A;  5AFM A;  3T4M A;  2WNJ A;  2XQ8 A;  3SIO A;  3RHW A;  2LM2 A;  4HFI A;  4ZZB A;  2BYS A;  4DBM A;  3RIF A;  3WTN A;  4BQT A;  5HCJ A;  2M6B A;  3C79 A;  4PIR A;  3WTL A;  2XNV A;  4UXU A;  3P4W A;  4A97 A;  5IUX A;  5HEG A;  2QC1 B;  4ILA A;  5BP0 A;  3JAF A;  2UZ6 A;  2BG9 C;  4QH5 A;  2ZJV A;  2VL0 A;  2YKS A;  5HEU A;  2BYQ A;  3PMZ A;  4D01 A;  5SYO A;  4HFD A;  3U8J A;  4HFC A;  2XYT A;  4ALX A;  2BR7 A;  3PEO A;  3UU6 A;  3IGQ A;  2WNC A;  4COF A;  4WV9 A;  4HFH A;  2XQ6 A;  4NZB A;  1OED B;  5BRX A;  4XHE A;  4TWD A;  4X5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...