4QH5A

The glic pentameric ligand-gated ion channel (wild-type) crystallized in phosphate buffer
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh5A01
4ZJTA 4COFA 2PGZA 4QAAA 3UQ4A 3WTJA 2XQ5A 4LMLA 5HEJA 1OEDE 2M6BA 4IREA 3TLUA 2W8FA 2Y54A 4UM1A 3U8KA 3WTIA 3EAMA 5J0ZA 4XK9A 2VL0A 5SYOA 3SH1A 2XYTA 4BFQA 2QC1B 2LKHA 5HCMA 4A98A 2LKGA 4IL9A 2Y7YA 5FJVA 4ALXA 2BYQA 1OEDA 4ZZCA 4HFBA 4HFDA 3PEOA 1I9BA 4UM3S 4NPPA 3JADA 2WNLA 5KZUA 2Y57A 2UZ6A 3P50A 4UM3P 4F8HA 2KSRA 5HEUA 2C9TA 2W8GA 5AFMA 5AFMB 4B5DA 5BP0A 4D01A 4HFHA 5HEGA 2XQ9A 3ZDGA 4Z90A 3UU3A 3TLTA 4ZK4A 4HFIA 3WTLA 2LM2A 2M6IA 4NZBA 3WTOA 2WN9A 4AFTA 3UU8A 4AFGA 3T4MA 4TNWA 2YMDA 2BR8A 3P4WA 3RIAA 3JAEA 3UQ7A 3UU4A 2ZJUA 4DBMA 3RI5A 3RIFA 4ILCA 4TWFA 4XHEA 3U8NA 5LG3A 4BQTA 2BG9B 2LLYA 5AFHA 3WTHA 4ZK1A 2YOEA 2Y58A 2XQAA 3SQ9A 4EZ1A 5L4HA 3TLSA 2XQ6A 4FRRA 1UW6A 2BG9C 3U8MA 3C84A 3WTKA 5J5FA 2YKSA 5IUXA 5L47A 4ZRUA 2BYPA 3WIPA 5J5IA 5J5HA 3UU6A 2BR7A 2ZJVA 3GUAA 4X5TA 2WNCA 3ZDHA 5HEHA 1UV6A 2BG9E 5AFNA 5BW2A 4LMKA 2WZYA 3IGQA 4TWDA 3RQUA 4IL4A 1UX2A 4QACA 3UUBA 5LXBA 2Y56A 3EI0A 4HFCA 2BG9A 2PH9A 4UM3A 4ILBA 4Z91A 2BYSA 4LMJA 3LSVA 2BYNA 4HQPA 4AFHA 4UY2A 3JAFA 5AFLA 4TNVA 3C79A 5HEOA 2XQ8A 2WNJA 5AFKA 2XZ5A 4PIRA 5TVCA 2XYSA 2YMEA 4ILAA 2X00A 2BJ0A 2YN6A 4HFEA 2XQ3A 2BYRA 4A97A 3PMZA 5BRXA 3SQ6A 2XQ4A 2XNTA 5KE4A 1OEDB 5L4EA 4QH1A 5CO5A 5J5GA 4QABA 2XNUA 3U8LA 4ZJSA 4UXUA 4WV9A 2XNVA 2XQ7A 3RHWA 3UU5A 5CFBA 2X00D 5AINA 2MAWA 4QH5A 4TWHA 3TLVA 3WTMA 4ZZBA 1OEDC 3WTNA 5JMEA 2XZ6A 3TLWA 4ZR6A 3U8JA 5AFJA 3ZKRA 5HCJA 4QH4A 3EHZA 3SIOA 3RQWA
chains in the Genus database with same CATH superfamily
1IJ5A 4QAAA 2Q9QB 2JRKA 3AE7A 2W66A 3EABA 3N2OA 5IHYA 3RYFE 1I9BA 4X64T 3T1HT 3JADA 3SFEA 2X9YA 4TX5A 2QGSA 3RC3A 1YKHB 1Y01A 4MHCA 3K8PC 2KLQA 2IIUA 2WM9A 2LM2A 3NZQA 3OPCA 1MIYA 2YK0A 4EXTA 2NW7A 2WMOA 2X9XA 2YOEA 4LF8T 5L4HA 2WDRA 2A3DA 3T8OA 3L8RA 1KFYA 1S35A 2ZM6T 2K3WA 5LA6E 4LMKA 1KNRA 1X9BA 3PUQA 4K0UA 2KT9A 2X68A 4HQPA 5FVKA 4UY2A 3HL6A 4KUMB 2XZ5A 4NUVA 5HXHA 4AQGA 4EYYR 2WBLA 3RHWA 3UU5A 5HXRA 1E2AA 5AQNB 4CI1B 2XZ6A 4ZR6A 5HAXA 5ADXL 2K48A 3ZKRA 2B76A 2WU5A 5KDMC 1MNDA 1KNZA 3KVAA 4PJNA 2VL0A 3FBLA 4ALXA 5AQHB 1XNRT 4DR2T 4JV5T 4NPPA 4UF0A 2FJBA 5AQGB 1HX1B 2V6XA 2YINA 2VVSA 2VASA 2KMFA 1LRZA 4ZK4A 2LSYA 2CBJA 1MMAA 4UXNB 3GN5A 3IA3A 3ONJA 2D5UA 5JRCB 4H63V 3WAKA 3PDYA 3AAEB 3RX6A 3LDQB 3U8MA 2CWOA 1D0XA 3BK9A 2UXXB 4KI0F 5LMNT 3MACA 3O4XE 4C90A 3W15B 3KV6A 4IE5A 5JREA 3SWHA 3CX8B 2DLRA 4HFCA 2E9XD 4PW8A 5KMGP 4Z91A 1IBKT 4ADZA 4OK0A 5FMNA 3PMZA 5BRXA 2CHNA 3U3IA 3S4UA 4PK5A 2XNTA 4QH1A 5FY7A 3T1YT 2XSBA 4QH5A 5M4YA 2LT3A 1G73A 3HKDE 4ASKA 5AFJA 5FXZA 3CMLA 4X1IE 4UV8B 1FIOA 2XQ5A 4IREA 2Y54A 1HNWT 2V7JA 3WAJA 3SH1A 1MNEA 3VR8A 2UXBT 4IL9A 2D0UA 5TAOA 2R6GF 4DV4T 4U33A 2JQKA 4XZCA 2XASB 5AFMA 2W8GA 2AXDS 1ZEEA 3KFWX 2XQYA 2V7KA 4NZBA 2JQHA 4HWCA 4JI5T 2UU9T 2QYWA 3RIAA 3JAEA 5AQIB 2VKHA 4I0UA 3AAAB 2BG9B 4LF9T 5HXEA 2Y58A 4EZHA 4PJJA 3O1JA 4DR7T 2XAGB 4X1YE 1WYBA 4CN6A 3C84A 5IUXA 3G06A 1HR0T 1FJGT 5FKYA 2XSAA 2V8SV 3MK7C 4IDOA 3AVRA 1QLBA 4TWDA 2XZEA 2NW9A 1W9RA 5ETWA 2BKOA 3LSVA 1KEYA 3L39A 2MYSA 1SA0E 4LFAT 2X00A 2FBWA 2YN6A 1JNRA 2WU2A 2V6YA 5EK2A 2XM1A 4GKJT 2YDRA 4PJLA 1ZV4X 1BR4A 5AQMB 4GIWA 3WTNA 3X1DA 3AB3B 3GA8A 4CN4A 2I59A 2PGZA 4IE7A 4I55E 3V5SA 5SYOA 4DV5T 4A98A 4CXYA 3NRXA 3PUSA 3AE8A 3PV0F 2K9AA 2WNLA 4BAYB 1YW0A 2DL1A 3SFDA 5HEUA 4UVCB 3ZSSA 4J2CA 3RRCA 2X51A 3NVOA 3UU8A 2BKPA 4L9IA 2BVLA 4TWFA 5AQOB 3AEDA 5HWYA 3SS1A 4DV0T 4QHOA 3IBPA 2N9DA 3VRAA 4ZI7E 2UUAT 2UXCT 3ZLIA 5JH7E 3OVUA 4K0KT 5LNKA 4B3MT 2ZM8A 1CHUA 2N1GA 5ABFA 3FZHB 4X20E 2CMRA 4YY3T 3RRWA 4DV1T 4B6XA 1M62A 3LBXA 4ILBA 4U72A 3C4WA 3EDVA 4JBWF 3B5MA 3FB2A 3OTOT 1HF8A 5AFLA 4H9SE 3N5LA 3HA4A 5AQUB 1OXZA 5LHIB 4KMCA 1YD8G 5F5WA 1UX5A 2LRLA 3N9OA 1OEDC 3ZCJA 4YHJA 3CKDA 3PJAJ 3M65A 1O3XA 2JPFA 4JI4T 4LMLA 3TLUA 2A72A 2CLYB 2D0TA 1YQ3A 2BYQA 1OEDA 4EAHA 3OKQA 4IE0A 2W61A 4CZZB 4GOUA 2AE9A 1JNZA 4QWNB 5DJQC 3ETVA 2XJ7A 3CK6A 4HE8A 3PURA 4AQFC 2ACXA 4ZOLE 4HWFA 2XY8B 2WN9A 2E9XB 2XAJB 5FXWA 1V9DA 1WCRA 4YTPA 4C91A 3ZEFB 4BQTA 4AQFA 3NZPA 4EZ1A 3P4SA 4H9RC 1YKEB 3RYIE 4H9QC 1IJ6A 3FZFB 4DR1T 3KDSE 4DVDA 3PUAA 2NR4A 5AQLB 3DP7A 3ZPOA 5BR8T 3D0TA 5JVDE 5AQJB 1WR6A 3ZYMA 2X00D 1XNQT 4JYAT 4ZI2C 3TLWA 3QNUA 2JIWA 4QH4A 3B57A 4TZ4C 3O1HA 3AE6A 3CVRA 3WTJA 3EAMA 1T8BA 2LKHA 2C0SA 1UGOA 3AA6B 3RKGA 4UM3P 2ZM2A 5AQFB 2ODVA 5AQPB 4JUYA 4UVBB 1MMNA 4CI3B 3WTLA 2BZBA 4DBQA 4B3RT 1VCSA 4CI2B 2X66A 1VCTA 3ZCIA 2XTLA 3AA0B 2H7VC 4TN7B 2V7LA 5L3FB 1S94A 4E7ZA 5J5IA 2CHOA 3PU8A 5FY0A 4HWIB 2LHNA 2BG9E 5LJNA 5BW2A 2N2NA 5FNVE 2EHOC 2B1EA 2MOZA 4L5GA 2HPJA 2WMNA 2IW5B 4MBQA 4EYUA 4U2YA 3PJAA 3B13A 5KE4A 3UUNA 2EHOA 2XAQB 1NAFA 3VHLA 3Q9DA 3U8LA 1XDOA 4UF0B 4YTNA 3N9LA 4HEAA 1NWMX 4O4IE 1LKXA 4GK0E 5HXCA 3ONLC 4JI3T 3IHRA 3BQKA 4CXWA 3R6NA 3UT5E 5HCMA 5ABEA 2BS3A 4ZZCA 3ZN0B 3GN5B 3FHNA 4HKAA 1KNPA 3I0QA 3ZC1A 1HG5A 4HWDA 4AFTA 2WP9A 5IYZE 4AKIA 4XHEA 4CN1A 4U2ZA 2VWAA 5KXJA 4UR9A 3H3MA 1QUUA 1D0YA 3ESLA 1GQEA 1UW6A 3P4RA 3NRYA 4G63A 5J5FA 3CX6B 2BR7A 3KINB 4EGWA 3NWIA 2CXLA 2X0LB 4X5TA 1J1JA 4IE4A 4GYRA 5AFNA 2W0GA 2NWBA 3RQUA 1SUMB 5LOVE 5HXSA 3ZN1B 5HWXA 5AQRB 1HNZT 3CX7B 4JI2T 3L3PA 4JLEA 2VURA 4BJNA 4H9OC 3H3AA 2V26A 3R84B 1W09A 5KZUA 1MMDA 2K5BB 3ZMZB 2IC9A 5L3EB 5A1LA 5F8PA 3A5XA 4AISA 5J2UE 5L3GB 3J9X1 2JMHA 3F31A 1BR2A 5J1GA 4QX8B 4QXHB 3UQ4A 3AE4A 2W8FA 3ZT5A 4G2AA 1SHZC 3KV5A 2NTXA 2W00A 2BBHA 4EEBA 4LF5T 4ZXLA 4LFCT 4HFBA 4HTEA 3TKLB 4JI0T 3K3OA 5FYMA 5CGMA 3A8YC 4ZI2D 4Z90A 4YXDA 2X9WA 3MKDA 2PJQA 5ABGA 2H88A 3F57A 3ZMTB 3T4MA 1D1AA 2DWGA 3C51A 4QX7B 4U74A 1DU2A 3O1IA 1HTJF 4UIGA 3C98B 5FXXA 5F3JA 5BMVE 2XQ6A 3SOLA 4YJ3E 5L47A 2OV9A 4DUYT 2V6YB 5FY1A 1Z0PA 2WNCA 3ZDHA 4YSZA 2H89A 2E5VA 5LGUB 4IL4A 1UX2A 5IWAT 5LXBA 3EI0A 5JDGA 2NP9A 4O4LE 2WWUA 4LFBT 5LGTB 4YFSA 3VRBA 4DIDB 1HG2A 1W0AA 3MZKB 4ZJSA 3HI2A 3FXEB 2PBIA 4H9NC 2EHOD 1XDPA 4L0RA 2XAHB 2W67A 4NUUA 5EK3A 4CXXA 2V5CA 3AEAA 2DWKA 2YDQA 3RF1A 2Y7YA 4F6RC 3UULA 3PEOA 2OA5A 3AA7B 3N9MA 3C64A 3ANWA 1WR0A 3J7Yq 4DV3T 4WW0A 5LHGB 3K3QC 4HFIA 5AQSB 3WTOA 2X9HA 4AFGA 3RPUA 5CJ5A 3O9XA 5E0OA 5LXTE 4MFRA 5ABFB 5H6QB 4DBMA 4ILCA 4JI7T 3KV9A 3LBXB 3WTHA 4YJ2E 3Q5XA 1HS7A 2E8IA 4FI5A 5J2TE 4ISSA 4QXBB 3ZT7A 5J5HA 2V1DB 3GUAA 4ZHQE 5HEHA 2KNDA 1U4QA 2QA7A 1NENA 3NBXX 3V5UA 4ZEYA 2Y56A 2CM0A 2J1DG 2RPAA 5JR9C 1QSDA 3LJCA 1N34T 4TNVA 2W63A 1AJ3A 3UUXB 3ABVA 2D9DA 1OEDB 5L4EA 2Z6EA 4JI8T 4O8SA 5JR9A 4QABA 2WDVA 2Y6XA 4WV9A 4TUYE 3Q5DA 4TV9E 4YT0A 5LG4A 3U8JA 4UV9B 4DMWA 3VU7H 2QVAA 3LG7A 5GONE 2M6BA 2C5IT 2L9QA 2JJ9A 1XZYA 3FXDB 2LE8A 3FBZA 3PUZF 4HGAA 2YU2A 3PUGA 3P50A 2C9TA 1IBLT 4YTMA 3LK42 4HFHA 3OYZA 2DCFA 3ZDGA 2ES0A 2M6IA 2DHRA 3P4QA 2BBJA 5DQVA 2LM9A 5LJMA 4QKNA 3FZKB 4JEUB 3KBTA 5FP3A 3QB5A 4KX6A 5LHHB 2WY2A 3HKCE 4ISTA 4DNDA 5LCYA 4X62T 4UEMA 3F2EA 2WZHA 2HHHT 2CCQA 4P0BA 4LF7T 3QC9A 3MXZA 1R8IA 3P7IA 2V5DA 1FMVA 3LK3B 3ZJ2A 3AE5A 1ZP0A 3E0ZA 4PFOA 4PIRA 3CPZA 5LMUT 1Y64B 1N32T 2LHRA 5JDQA 4A97A 3PUVF 3AA1B 4CQIA 5FL0A 2MBGA 4ANJA 2CLYC 2A9UA 4OHFA 1U5PA 4TWHA 4WZXA 4ZZBA 4FJOA 2J47A 1M7KA 3CQCB 4IDNA 4AKHA 3RQWA 1BR1A 2L3LA 3ZT6A 3JCFA 4O2AE 3HKEE 3Q5WA 4AI6A 2H3RA 3OJAA 3K3NA 4UM3S 3RYHE 2UZ6A 2CRBA 2W62A 3ZC0A 2FUPA 4D01A 2CXFA 3C50A 3GWHA 3TLTA 5ABHA 1CUNA 4M1PA 2YMDA 2YEVC 1VOMA 3UU4A 2YU1A 4NXNT 1BR0A 1YQ4A 1VRBA 4IT4A 2JMKA 3JC6C 3AEGA 3FZLB 4DBRA 3CWZB 2BYPA 4OYJA 3WIPA 2EHOB 2WAUA 2WZYA 5AQQB 4BA9A 1UK5A 2QRXA 4LF4T 1XMQT 3Q5EA 3HR0A 5HEOA 3RC8A 1J5WA 2WS3A 2YMEA 3Q2MA 2BJ0A 5L3BB 5CO5A 3ZJ1A 4JI1T 2J62A 4GYSA 2XNVA 2XQ7A 5AINA 2GK9A 3RLFF 4YHHT 4DUZT 2LSJA 1IZNB 2DI4A 2UXDT 2PG8A 4AKRB 4AKLA 5J0ZA 4PAGA 4XK9A 4BFQA 2OLTA 4A56A 2Q9QC 2VKJA 3I9YA 3ZMSB 4HFDA 4U7YA 2BS2A 4U31A 5DQWA 5JDNA 3I0OA 4F8HA 2KSRA 2F4VT 4ILUA 5LBQB 3AXJA 3EVYA 2C5KT 4DR5T 3L09A 4ZS3A 2CBIA 2Q9QA 1T7SA 1WFDA 2C5JA 2VB6A 2K24A 4TNWA 4PJMA 3M3ZB 3UUMA 5LG3A 4IDZA 2HH7A 4JEHB 2VK9A 3AVSA 1H7CA 3UFEA 3KVBA 4EV6A 1US7B 2KZ7B 2M67A 2P9BA 2I0MA 1HNXT 2FJDA 4EOZB 4DV2T 1UV6A 2W4XA 3RIUC 3U78A 3C4XA 4EZ4A 4UM3A 2BYSA 4DV6T 4AFHA 1E1HB 5HYAA 4IIJE 2FJAA 4PK6A 3P4PA 2XYSA 1Z8UA 3AEEA 3RIUA 1X79A 2VKOA 4ZI3C 5J5GA 2UUBT 4UXUA 3OBVE 4DMVA 5JMEA 4V1Av 4AXPA 2WB5A 3C4ZA 5FVLA 1EZ3A 1OEDE 2G0UA 4WYVA 2HN2A 3I1AA 2QC1B 3H37A 3AE9A 2VKDA 1XMOT 2SPCA 5AFMB 3UTKA 1NEKA 5HEGA 5L3DB 4KHPT 4I50E 3I9WA 4YSXA 3KBUA 4B3ST 2ACZA 4DR4T 3QUJA 5KX5E 3IEEA 2ZMAA 5AQTB 4IE6A 1T98A 5AFHA 3AE3A 4O4HE 1ZKEA 5LBMA 3SQ9A 4E7SA 2JQQA 4HFVA 4U3CA 1W0BA 1MMGA 5JDHA 1FMWA 3EDUA 3UU6A 4AIUA 2WWVA 5DABA 1HX8A 3ZYKA 2KINB 3LK2B 2LOSA 1T72A 1I6ZA 2LOPA 3UUBA 4BJMA 4N78D 2WQYA 2PH9A 2XHEB 5JRCA 3K1SA 4IGUA 3CIRA 2LSKA 3C79A 2MTQA 3JC6D 4ILAA 4I4TE 3N2GE 5FXVA 1HCIA 5JDMA 1WRDA 3ANWB 3MJXA 2IDOB 4EIWA 2VL8A 3QOFA 2J4GA 4X1KE 3SIOA 2LSIA 3VR9A 2PTFA 4DO0A 4GKKT 3QK6A 5HEJA 4O4JE 2A2FX 4A5XA 2XYTA 3ZYLA 2YDSA 4X65T 2LKGA 5CA1E 5FJVA 3CQXC 4DR3T 5AQVB 3ETUA 2BDEA 4UVAB 4DR6T 4I43B 5JQGE 4IDQA 3FZMB 1D1CA 2X0YA 3CQGB 1KF6A 4LF6T 2BR8A 1UUSA 3P4WA 2XPKA 3UQ7A 4P09A 3RI5A 2Q9QD 2LLYA 1D0ZA 1B7TA 2XQAA 1WLXA 1LVKA 4UELA 4MLKA 3N9NA 3MA9A 2BG9C 2KXPB 2VQET 4OFZA 2KWHA 3E08A 3AEBA 2E2AA 5JR9B 3VKGA 3AAIA 4QACA 2BG9A 1ZHCA 2BYNA 3PUXF 1FEWA 4HN9A 2X0HA 2I6HA 3UFGA 5AFKA 3HKBE 4H63H 5TVCA 2LEHA 2IMLA 3DJBA 2XNUA 3AECA 5CFBA 2UXNB 3BQIA 3ZSTA 1KK7A 3E22E 2ODUA 2CA5A 2ZM0A 1IAPA 3N9PA 4COFA 4PFPA 3PUWF 2BKNA 5AQKB 2CEAA 5CA0E 4OX9T 3P8CD 1N36T 4ZI3D 4GK5E 2V7MA 1SE7A 4XAXB 5BP0A 2XQ9A 2BS4A 3UU3A 5L3CB 3AEFA 3DTOA 4ZS2A 2HPLA 5JTGA 3QB5K 4YSYA 2DNXA 2WCAA 2ZJUA 3OYXA 4AKGA 3U8NA 1MIWA 3ONXA 4NXMT 1YXRA 4IHJE 2CWYA 3SRZA 5LB7B 2YKSA 1UX4A 1G8XA 4P1NA 2ZJVA 4DV7T 5CB4E 2ZLYA 4TV8E 2LSGA 2HN1A 3RH3A 3NKZA 3IF8B 4Z8XA 2BVMA 3ZMVB 4X66T 5H6RB 3AE2A 3JAFA 3PE0A 5C2TA 4WBOA 2XQ8A 3ZMUB 2V7IA 3BQLA 4O2BE 4WBNE 2RA1A 3PU3A 2BYRA 3N2KE 3SQ6A 2VQFT 2IHR1 5C8YE 2H7OA 2PFVA 2IAKA 3PTRB 1MIVA 3VKHA 5JDLA 2NTYA 4QXCB 5HCJA 3GMIA 2IUBA 4ZJTA 2KWIB 4UM1A 3WTIA 2JQ9A 3U8KA 5JDFA 5EK4A 5FL1A 5AFUL 4ERRA 2NOXA 3N9QA 2Y57A 4EEDA 4B5DA 2RP4A 4Q25A 4KHZF 4EB6E 5EZYE 2XM2A 3AE1A 4KBMB 4PK4A 4H9PC 4U7IA 3RIFA 2E9XC 1I94T 4KP3C 4P0AA 4IDPA 4AQYT 4ZK1A 2CXDA 2LJLA 3RYCE 3TLSA 4FRRA 5LGNB 2WSSV 4XBFB 2FJEA 3WI3A 5L2LA 3WTKA 3KV4A 3RGLA 4B3TT 4ZRUA 3A7MA 4JI6T 2VVNA 2WZIA 2XUEA 3PUYF 3RKOA 1OWAA 4OYKA 2IC6A 2E9XA 1D1BA 5LP6E 2Y48B 2UUCT 1UCUA 3IGQA 1XWMA 1HFAA 2D2SA 1IBMT 2XAFB 5LYJE 1ZOYA 4LMJA 2W2UA 2Y8DA 2WDQA 2WNJA 5C3JA 2CPTA 1J5ET 2X67A 4HFEA 2MPKA 2XQ3A 2XQ4A 1E7PA 3LFMA 3EUHA 1LVFA 4WNKA 2LRKA 2E5LT 1WYCA 4PNIA 1N33T 2MAWA 3TLVA 3WTMA 4HWHA 1L0VA 1UURA 4MALA 4NIQA 3AXJB 4YLHA 2NW8A 2CE7A 3EHZA 2L8KA
chains in the Genus database with same CATH topology
4ZJTA 4COFA 2PGZA 4QAAA 3UQ4A 3WTJA 2XQ5A 4LMLA 5HEJA 1OEDE 2M6BA 4IREA 3TLUA 2W8FA 2Y54A 4UM1A 3U8KA 3WTIA 3EAMA 5J0ZA 4XK9A 2VL0A 5SYOA 3SH1A 2XYTA 4BFQA 2QC1B 2LKHA 5HCMA 4A98A 2LKGA 4IL9A 2Y7YA 5FJVA 4ALXA 2BYQA 1OEDA 4ZZCA 4HFBA 4HFDA 3PEOA 1I9BA 4UM3S 4NPPA 3JADA 2WNLA 5KZUA 2Y57A 2UZ6A 3P50A 4UM3P 4F8HA 2KSRA 5HEUA 2C9TA 2W8GA 5AFMA 5AFMB 4B5DA 5BP0A 4D01A 4HFHA 5HEGA 2XQ9A 3ZDGA 4Z90A 3UU3A 3TLTA 4ZK4A 4HFIA 3WTLA 2LM2A 2M6IA 4NZBA 3WTOA 2WN9A 4AFTA 3UU8A 4AFGA 3T4MA 4TNWA 2YMDA 2BR8A 3P4WA 3RIAA 3JAEA 3UQ7A 3UU4A 2ZJUA 4DBMA 3RI5A 3RIFA 4ILCA 4TWFA 4XHEA 3U8NA 5LG3A 4BQTA 2BG9B 2LLYA 5AFHA 3WTHA 4ZK1A 2YOEA 2Y58A 2XQAA 3SQ9A 4EZ1A 5L4HA 3TLSA 2XQ6A 4FRRA 1UW6A 2BG9C 3U8MA 3C84A 3WTKA 5J5FA 2YKSA 5IUXA 5L47A 4ZRUA 2BYPA 3WIPA 5J5IA 5J5HA 3UU6A 2BR7A 2ZJVA 3GUAA 4X5TA 2WNCA 3ZDHA 5HEHA 1UV6A 2BG9E 5AFNA 5BW2A 4LMKA 2WZYA 3IGQA 4TWDA 3RQUA 4IL4A 1UX2A 4QACA 3UUBA 5LXBA 2Y56A 3EI0A 4HFCA 2BG9A 2PH9A 4UM3A 4ILBA 4Z91A 2BYSA 4LMJA 3LSVA 2BYNA 4HQPA 4AFHA 4UY2A 3JAFA 5AFLA 4TNVA 3C79A 5HEOA 2XQ8A 2WNJA 5AFKA 2XZ5A 4PIRA 5TVCA 2XYSA 2YMEA 4ILAA 2X00A 2BJ0A 2YN6A 4HFEA 2XQ3A 2BYRA 4A97A 3PMZA 5BRXA 3SQ6A 2XQ4A 2XNTA 5KE4A 1OEDB 5L4EA 4QH1A 5CO5A 5J5GA 4QABA 2XNUA 3U8LA 4ZJSA 4UXUA 4WV9A 2XNVA 2XQ7A 3RHWA 3UU5A 5CFBA 2X00D 5AINA 2MAWA 4QH5A 4TWHA 3TLVA 3WTMA 4ZZBA 1OEDC 3WTNA 5JMEA 2XZ6A 3TLWA 4ZR6A 3U8JA 5AFJA 3ZKRA 5HCJA 4QH4A 3EHZA 3SIOA 3RQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZJT A;  4COF A;  2PGZ A;  4QAA A;  3UQ4 A;  3WTJ A;  2XQ5 A;  4LML A;  5HEJ A;  1OED E;  2M6B A;  4IRE A;  3TLU A;  2W8F A;  2Y54 A;  4UM1 A;  3U8K A;  3WTI A;  3EAM A;  5J0Z A;  4XK9 A;  2VL0 A;  5SYO A;  3SH1 A;  2XYT A;  4BFQ A;  2QC1 B;  2LKH A;  5HCM A;  4A98 A;  2LKG A;  4IL9 A;  2Y7Y A;  5FJV A;  4ALX A;  2BYQ A;  1OED A;  4ZZC A;  4HFB A;  4HFD A;  3PEO A;  1I9B A;  4UM3 S;  4NPP A;  3JAD A;  2WNL A;  5KZU A;  2Y57 A;  2UZ6 A;  3P50 A;  4UM3 P;  4F8H A;  2KSR A;  5HEU A;  2C9T A;  2W8G A;  5AFM A;  5AFM B;  4B5D A;  5BP0 A;  4D01 A;  4HFH A;  5HEG A;  2XQ9 A;  3ZDG A;  4Z90 A;  3UU3 A;  3TLT A;  4ZK4 A;  4HFI A;  3WTL A;  2LM2 A;  2M6I A;  4NZB A;  3WTO A;  2WN9 A;  4AFT A;  3UU8 A;  4AFG A;  3T4M A;  4TNW A;  2YMD A;  2BR8 A;  3P4W A;  3RIA A;  3JAE A;  3UQ7 A;  3UU4 A;  2ZJU A;  4DBM A;  3RI5 A;  3RIF A;  4ILC A;  4TWF A;  4XHE A;  3U8N A;  5LG3 A;  4BQT A;  2BG9 B;  2LLY A;  5AFH A;  3WTH A;  4ZK1 A;  2YOE A;  2Y58 A;  2XQA A;  3SQ9 A;  4EZ1 A;  5L4H A;  3TLS A;  2XQ6 A;  4FRR A;  1UW6 A;  2BG9 C;  3U8M A;  3C84 A;  3WTK A;  5J5F A;  2YKS A;  5IUX A;  5L47 A;  4ZRU A;  2BYP A;  3WIP A;  5J5I A;  5J5H A;  3UU6 A;  2BR7 A;  2ZJV A;  3GUA A;  4X5T A;  2WNC A;  3ZDH A;  5HEH A;  1UV6 A;  2BG9 E;  5AFN A;  5BW2 A;  4LMK A;  2WZY A;  3IGQ A;  4TWD A;  3RQU A;  4IL4 A;  1UX2 A;  4QAC A;  3UUB A;  5LXB A;  2Y56 A;  3EI0 A;  4HFC A;  2BG9 A;  2PH9 A;  4UM3 A;  4ILB A;  4Z91 A;  2BYS A;  4LMJ A;  3LSV A;  2BYN A;  4HQP A;  4AFH A;  4UY2 A;  3JAF A;  5AFL A;  4TNV A;  3C79 A;  5HEO A;  2XQ8 A;  2WNJ A;  5AFK A;  2XZ5 A;  4PIR A;  5TVC A;  2XYS A;  2YME A;  4ILA A;  2X00 A;  2BJ0 A;  2YN6 A;  4HFE A;  2XQ3 A;  2BYR A;  4A97 A;  3PMZ A;  5BRX A;  3SQ6 A;  2XQ4 A;  2XNT A;  5KE4 A;  1OED B;  5L4E A;  4QH1 A;  5CO5 A;  5J5G A;  4QAB A;  2XNU A;  3U8L A;  4ZJS A;  4UXU A;  4WV9 A;  2XNV A;  2XQ7 A;  3RHW A;  3UU5 A;  5CFB A;  2X00 D;  5AIN A;  2MAW A;  4QH5 A;  4TWH A;  3TLV A;  3WTM A;  4ZZB A;  1OED C;  3WTN A;  5JME A;  2XZ6 A;  3TLW A;  4ZR6 A;  3U8J A;  5AFJ A;  3ZKR A;  5HCJ A;  4QH4 A;  3EHZ A;  3SIO A;  3RQW A; 
#chains in the Genus database with same CATH topology
 1IJ5 A;  4QAA A;  2Q9Q B;  2JRK A;  3AE7 A;  2W66 A;  3EAB A;  3N2O A;  5IHY A;  3RYF E;  1I9B A;  4X64 T;  3T1H T;  3JAD A;  3SFE A;  2X9Y A;  4TX5 A;  2QGS A;  3RC3 A;  1YKH B;  1Y01 A;  4MHC A;  3K8P C;  2KLQ A;  2IIU A;  2WM9 A;  2LM2 A;  3NZQ A;  3OPC A;  1MIY A;  2YK0 A;  4EXT A;  2NW7 A;  2WMO A;  2X9X A;  2YOE A;  4LF8 T;  5L4H A;  2WDR A;  2A3D A;  3T8O A;  3L8R A;  1KFY A;  1S35 A;  2ZM6 T;  2K3W A;  5LA6 E;  4LMK A;  1KNR A;  1X9B A;  3PUQ A;  4K0U A;  2KT9 A;  2X68 A;  4HQP A;  5FVK A;  4UY2 A;  3HL6 A;  4KUM B;  2XZ5 A;  4NUV A;  5HXH A;  4AQG A;  4EYY R;  2WBL A;  3RHW A;  3UU5 A;  5HXR A;  1E2A A;  5AQN B;  4CI1 B;  2XZ6 A;  4ZR6 A;  5HAX A;  5ADX L;  2K48 A;  3ZKR A;  2B76 A;  2WU5 A;  5KDM C;  1MND A;  1KNZ A;  3KVA A;  4PJN A;  2VL0 A;  3FBL A;  4ALX A;  5AQH B;  1XNR T;  4DR2 T;  4JV5 T;  4NPP A;  4UF0 A;  2FJB A;  5AQG B;  1HX1 B;  2V6X A;  2YIN A;  2VVS A;  2VAS A;  2KMF A;  1LRZ A;  4ZK4 A;  2LSY A;  2CBJ A;  1MMA A;  4UXN B;  3GN5 A;  3IA3 A;  3ONJ A;  2D5U A;  5JRC B;  4H63 V;  3WAK A;  3PDY A;  3AAE B;  3RX6 A;  3LDQ B;  3U8M A;  2CWO A;  1D0X A;  3BK9 A;  2UXX B;  4KI0 F;  5LMN T;  3MAC A;  3O4X E;  4C90 A;  3W15 B;  3KV6 A;  4IE5 A;  5JRE A;  3SWH A;  3CX8 B;  2DLR A;  4HFC A;  2E9X D;  4PW8 A;  5KMG P;  4Z91 A;  1IBK T;  4ADZ A;  4OK0 A;  5FMN A;  3PMZ A;  5BRX A;  2CHN A;  3U3I A;  3S4U A;  4PK5 A;  2XNT A;  4QH1 A;  5FY7 A;  3T1Y T;  2XSB A;  4QH5 A;  5M4Y A;  2LT3 A;  1G73 A;  3HKD E;  4ASK A;  5AFJ A;  5FXZ A;  3CML A;  4X1I E;  4UV8 B;  1FIO A;  2XQ5 A;  4IRE A;  2Y54 A;  1HNW T;  2V7J A;  3WAJ A;  3SH1 A;  1MNE A;  3VR8 A;  2UXB T;  4IL9 A;  2D0U A;  5TAO A;  2R6G F;  4DV4 T;  4U33 A;  2JQK A;  4XZC A;  2XAS B;  5AFM A;  2W8G A;  2AXD S;  1ZEE A;  3KFW X;  2XQY A;  2V7K A;  4NZB A;  2JQH A;  4HWC A;  4JI5 T;  2UU9 T;  2QYW A;  3RIA A;  3JAE A;  5AQI B;  2VKH A;  4I0U A;  3AAA B;  2BG9 B;  4LF9 T;  5HXE A;  2Y58 A;  4EZH A;  4PJJ A;  3O1J A;  4DR7 T;  2XAG B;  4X1Y E;  1WYB A;  4CN6 A;  3C84 A;  5IUX A;  3G06 A;  1HR0 T;  1FJG T;  5FKY A;  2XSA A;  2V8S V;  3MK7 C;  4IDO A;  3AVR A;  1QLB A;  4TWD A;  2XZE A;  2NW9 A;  1W9R A;  5ETW A;  2BKO A;  3LSV A;  1KEY A;  3L39 A;  2MYS A;  1SA0 E;  4LFA T;  2X00 A;  2FBW A;  2YN6 A;  1JNR A;  2WU2 A;  2V6Y A;  5EK2 A;  2XM1 A;  4GKJ T;  2YDR A;  4PJL A;  1ZV4 X;  1BR4 A;  5AQM B;  4GIW A;  3WTN A;  3X1D A;  3AB3 B;  3GA8 A;  4CN4 A;  2I59 A;  2PGZ A;  4IE7 A;  4I55 E;  3V5S A;  5SYO A;  4DV5 T;  4A98 A;  4CXY A;  3NRX A;  3PUS A;  3AE8 A;  3PV0 F;  2K9A A;  2WNL A;  4BAY B;  1YW0 A;  2DL1 A;  3SFD A;  5HEU A;  4UVC B;  3ZSS A;  4J2C A;  3RRC A;  2X51 A;  3NVO A;  3UU8 A;  2BKP A;  4L9I A;  2BVL A;  4TWF A;  5AQO B;  3AED A;  5HWY A;  3SS1 A;  4DV0 T;  4QHO A;  3IBP A;  2N9D A;  3VRA A;  4ZI7 E;  2UUA T;  2UXC T;  3ZLI A;  5JH7 E;  3OVU A;  4K0K T;  5LNK A;  4B3M T;  2ZM8 A;  1CHU A;  2N1G A;  5ABF A;  3FZH B;  4X20 E;  2CMR A;  4YY3 T;  3RRW A;  4DV1 T;  4B6X A;  1M62 A;  3LBX A;  4ILB A;  4U72 A;  3C4W A;  3EDV A;  4JBW F;  3B5M A;  3FB2 A;  3OTO T;  1HF8 A;  5AFL A;  4H9S E;  3N5L A;  3HA4 A;  5AQU B;  1OXZ A;  5LHI B;  4KMC A;  1YD8 G;  5F5W A;  1UX5 A;  2LRL A;  3N9O A;  1OED C;  3ZCJ A;  4YHJ A;  3CKD A;  3PJA J;  3M65 A;  1O3X A;  2JPF A;  4JI4 T;  4LML A;  3TLU A;  2A72 A;  2CLY B;  2D0T A;  1YQ3 A;  2BYQ A;  1OED A;  4EAH A;  3OKQ A;  4IE0 A;  2W61 A;  4CZZ B;  4GOU A;  2AE9 A;  1JNZ A;  4QWN B;  5DJQ C;  3ETV A;  2XJ7 A;  3CK6 A;  4HE8 A;  3PUR A;  4AQF C;  2ACX A;  4ZOL E;  4HWF A;  2XY8 B;  2WN9 A;  2E9X B;  2XAJ B;  5FXW A;  1V9D A;  1WCR A;  4YTP A;  4C91 A;  3ZEF B;  4BQT A;  4AQF A;  3NZP A;  4EZ1 A;  3P4S A;  4H9R C;  1YKE B;  3RYI E;  4H9Q C;  1IJ6 A;  3FZF B;  4DR1 T;  3KDS E;  4DVD A;  3PUA A;  2NR4 A;  5AQL B;  3DP7 A;  3ZPO A;  5BR8 T;  3D0T A;  5JVD E;  5AQJ B;  1WR6 A;  3ZYM A;  2X00 D;  1XNQ T;  4JYA T;  4ZI2 C;  3TLW A;  3QNU A;  2JIW A;  4QH4 A;  3B57 A;  4TZ4 C;  3O1H A;  3AE6 A;  3CVR A;  3WTJ A;  3EAM A;  1T8B A;  2LKH A;  2C0S A;  1UGO A;  3AA6 B;  3RKG A;  4UM3 P;  2ZM2 A;  5AQF B;  2ODV A;  5AQP B;  4JUY A;  4UVB B;  1MMN A;  4CI3 B;  3WTL A;  2BZB A;  4DBQ A;  4B3R T;  1VCS A;  4CI2 B;  2X66 A;  1VCT A;  3ZCI A;  2XTL A;  3AA0 B;  2H7V C;  4TN7 B;  2V7L A;  5L3F B;  1S94 A;  4E7Z A;  5J5I A;  2CHO A;  3PU8 A;  5FY0 A;  4HWI B;  2LHN A;  2BG9 E;  5LJN A;  5BW2 A;  2N2N A;  5FNV E;  2EHO C;  2B1E A;  2MOZ A;  4L5G A;  2HPJ A;  2WMN A;  2IW5 B;  4MBQ A;  4EYU A;  4U2Y A;  3PJA A;  3B13 A;  5KE4 A;  3UUN A;  2EHO A;  2XAQ B;  1NAF A;  3VHL A;  3Q9D A;  3U8L A;  1XDO A;  4UF0 B;  4YTN A;  3N9L A;  4HEA A;  1NWM X;  4O4I E;  1LKX A;  4GK0 E;  5HXC A;  3ONL C;  4JI3 T;  3IHR A;  3BQK A;  4CXW A;  3R6N A;  3UT5 E;  5HCM A;  5ABE A;  2BS3 A;  4ZZC A;  3ZN0 B;  3GN5 B;  3FHN A;  4HKA A;  1KNP A;  3I0Q A;  3ZC1 A;  1HG5 A;  4HWD A;  4AFT A;  2WP9 A;  5IYZ E;  4AKI A;  4XHE A;  4CN1 A;  4U2Z A;  2VWA A;  5KXJ A;  4UR9 A;  3H3M A;  1QUU A;  1D0Y A;  3ESL A;  1GQE A;  1UW6 A;  3P4R A;  3NRY A;  4G63 A;  5J5F A;  3CX6 B;  2BR7 A;  3KIN B;  4EGW A;  3NWI A;  2CXL A;  2X0L B;  4X5T A;  1J1J A;  4IE4 A;  4GYR A;  5AFN A;  2W0G A;  2NWB A;  3RQU A;  1SUM B;  5LOV E;  5HXS A;  3ZN1 B;  5HWX A;  5AQR B;  1HNZ T;  3CX7 B;  4JI2 T;  3L3P A;  4JLE A;  2VUR A;  4BJN A;  4H9O C;  3H3A A;  2V26 A;  3R84 B;  1W09 A;  5KZU A;  1MMD A;  2K5B B;  3ZMZ B;  2IC9 A;  5L3E B;  5A1L A;  5F8P A;  3A5X A;  4AIS A;  5J2U E;  5L3G B;  3J9X 1;  2JMH A;  3F31 A;  1BR2 A;  5J1G A;  4QX8 B;  4QXH B;  3UQ4 A;  3AE4 A;  2W8F A;  3ZT5 A;  4G2A A;  1SHZ C;  3KV5 A;  2NTX A;  2W00 A;  2BBH A;  4EEB A;  4LF5 T;  4ZXL A;  4LFC T;  4HFB A;  4HTE A;  3TKL B;  4JI0 T;  3K3O A;  5FYM A;  5CGM A;  3A8Y C;  4ZI2 D;  4Z90 A;  4YXD A;  2X9W A;  3MKD A;  2PJQ A;  5ABG A;  2H88 A;  3F57 A;  3ZMT B;  3T4M A;  1D1A A;  2DWG A;  3C51 A;  4QX7 B;  4U74 A;  1DU2 A;  3O1I A;  1HTJ F;  4UIG A;  3C98 B;  5FXX A;  5F3J A;  5BMV E;  2XQ6 A;  3SOL A;  4YJ3 E;  5L47 A;  2OV9 A;  4DUY T;  2V6Y B;  5FY1 A;  1Z0P A;  2WNC A;  3ZDH A;  4YSZ A;  2H89 A;  2E5V A;  5LGU B;  4IL4 A;  1UX2 A;  5IWA T;  5LXB A;  3EI0 A;  5JDG A;  2NP9 A;  4O4L E;  2WWU A;  4LFB T;  5LGT B;  4YFS A;  3VRB A;  4DID B;  1HG2 A;  1W0A A;  3MZK B;  4ZJS A;  3HI2 A;  3FXE B;  2PBI A;  4H9N C;  2EHO D;  1XDP A;  4L0R A;  2XAH B;  2W67 A;  4NUU A;  5EK3 A;  4CXX A;  2V5C A;  3AEA A;  2DWK A;  2YDQ A;  3RF1 A;  2Y7Y A;  4F6R C;  3UUL A;  3PEO A;  2OA5 A;  3AA7 B;  3N9M A;  3C64 A;  3ANW A;  1WR0 A;  3J7Y q;  4DV3 T;  4WW0 A;  5LHG B;  3K3Q C;  4HFI A;  5AQS B;  3WTO A;  2X9H A;  4AFG A;  3RPU A;  5CJ5 A;  3O9X A;  5E0O A;  5LXT E;  4MFR A;  5ABF B;  5H6Q B;  4DBM A;  4ILC A;  4JI7 T;  3KV9 A;  3LBX B;  3WTH A;  4YJ2 E;  3Q5X A;  1HS7 A;  2E8I A;  4FI5 A;  5J2T E;  4ISS A;  4QXB B;  3ZT7 A;  5J5H A;  2V1D B;  3GUA A;  4ZHQ E;  5HEH A;  2KND A;  1U4Q A;  2QA7 A;  1NEN A;  3NBX X;  3V5U A;  4ZEY A;  2Y56 A;  2CM0 A;  2J1D G;  2RPA A;  5JR9 C;  1QSD A;  3LJC A;  1N34 T;  4TNV A;  2W63 A;  1AJ3 A;  3UUX B;  3ABV A;  2D9D A;  1OED B;  5L4E A;  2Z6E A;  4JI8 T;  4O8S A;  5JR9 A;  4QAB A;  2WDV A;  2Y6X A;  4WV9 A;  4TUY E;  3Q5D A;  4TV9 E;  4YT0 A;  5LG4 A;  3U8J A;  4UV9 B;  4DMW A;  3VU7 H;  2QVA A;  3LG7 A;  5GON E;  2M6B A;  2C5I T;  2L9Q A;  2JJ9 A;  1XZY A;  3FXD B;  2LE8 A;  3FBZ A;  3PUZ F;  4HGA A;  2YU2 A;  3PUG A;  3P50 A;  2C9T A;  1IBL T;  4YTM A;  3LK4 2;  4HFH A;  3OYZ A;  2DCF A;  3ZDG A;  2ES0 A;  2M6I A;  2DHR A;  3P4Q A;  2BBJ A;  5DQV A;  2LM9 A;  5LJM A;  4QKN A;  3FZK B;  4JEU B;  3KBT A;  5FP3 A;  3QB5 A;  4KX6 A;  5LHH B;  2WY2 A;  3HKC E;  4IST A;  4DND A;  5LCY A;  4X62 T;  4UEM A;  3F2E A;  2WZH A;  2HHH T;  2CCQ A;  4P0B A;  4LF7 T;  3QC9 A;  3MXZ A;  1R8I A;  3P7I A;  2V5D A;  1FMV A;  3LK3 B;  3ZJ2 A;  3AE5 A;  1ZP0 A;  3E0Z A;  4PFO A;  4PIR A;  3CPZ A;  5LMU T;  1Y64 B;  1N32 T;  2LHR A;  5JDQ A;  4A97 A;  3PUV F;  3AA1 B;  4CQI A;  5FL0 A;  2MBG A;  4ANJ A;  2CLY C;  2A9U A;  4OHF A;  1U5P A;  4TWH A;  4WZX A;  4ZZB A;  4FJO A;  2J47 A;  1M7K A;  3CQC B;  4IDN A;  4AKH A;  3RQW A;  1BR1 A;  2L3L A;  3ZT6 A;  3JCF A;  4O2A E;  3HKE E;  3Q5W A;  4AI6 A;  2H3R A;  3OJA A;  3K3N A;  4UM3 S;  3RYH E;  2UZ6 A;  2CRB A;  2W62 A;  3ZC0 A;  2FUP A;  4D01 A;  2CXF A;  3C50 A;  3GWH A;  3TLT A;  5ABH A;  1CUN A;  4M1P A;  2YMD A;  2YEV C;  1VOM A;  3UU4 A;  2YU1 A;  4NXN T;  1BR0 A;  1YQ4 A;  1VRB A;  4IT4 A;  2JMK A;  3JC6 C;  3AEG A;  3FZL B;  4DBR A;  3CWZ B;  2BYP A;  4OYJ A;  3WIP A;  2EHO B;  2WAU A;  2WZY A;  5AQQ B;  4BA9 A;  1UK5 A;  2QRX A;  4LF4 T;  1XMQ T;  3Q5E A;  3HR0 A;  5HEO A;  3RC8 A;  1J5W A;  2WS3 A;  2YME A;  3Q2M A;  2BJ0 A;  5L3B B;  5CO5 A;  3ZJ1 A;  4JI1 T;  2J62 A;  4GYS A;  2XNV A;  2XQ7 A;  5AIN A;  2GK9 A;  3RLF F;  4YHH T;  4DUZ T;  2LSJ A;  1IZN B;  2DI4 A;  2UXD T;  2PG8 A;  4AKR B;  4AKL A;  5J0Z A;  4PAG A;  4XK9 A;  4BFQ A;  2OLT A;  4A56 A;  2Q9Q C;  2VKJ A;  3I9Y A;  3ZMS B;  4HFD A;  4U7Y A;  2BS2 A;  4U31 A;  5DQW A;  5JDN A;  3I0O A;  4F8H A;  2KSR A;  2F4V T;  4ILU A;  5LBQ B;  3AXJ A;  3EVY A;  2C5K T;  4DR5 T;  3L09 A;  4ZS3 A;  2CBI A;  2Q9Q A;  1T7S A;  1WFD A;  2C5J A;  2VB6 A;  2K24 A;  4TNW A;  4PJM A;  3M3Z B;  3UUM A;  5LG3 A;  4IDZ A;  2HH7 A;  4JEH B;  2VK9 A;  3AVS A;  1H7C A;  3UFE A;  3KVB A;  4EV6 A;  1US7 B;  2KZ7 B;  2M67 A;  2P9B A;  2I0M A;  1HNX T;  2FJD A;  4EOZ B;  4DV2 T;  1UV6 A;  2W4X A;  3RIU C;  3U78 A;  3C4X A;  4EZ4 A;  4UM3 A;  2BYS A;  4DV6 T;  4AFH A;  1E1H B;  5HYA A;  4IIJ E;  2FJA A;  4PK6 A;  3P4P A;  2XYS A;  1Z8U A;  3AEE A;  3RIU A;  1X79 A;  2VKO A;  4ZI3 C;  5J5G A;  2UUB T;  4UXU A;  3OBV E;  4DMV A;  5JME A;  4V1A v;  4AXP A;  2WB5 A;  3C4Z A;  5FVL A;  1EZ3 A;  1OED E;  2G0U A;  4WYV A;  2HN2 A;  3I1A A;  2QC1 B;  3H37 A;  3AE9 A;  2VKD A;  1XMO T;  2SPC A;  5AFM B;  3UTK A;  1NEK A;  5HEG A;  5L3D B;  4KHP T;  4I50 E;  3I9W A;  4YSX A;  3KBU A;  4B3S T;  2ACZ A;  4DR4 T;  3QUJ A;  5KX5 E;  3IEE A;  2ZMA A;  5AQT B;  4IE6 A;  1T98 A;  5AFH A;  3AE3 A;  4O4H E;  1ZKE A;  5LBM A;  3SQ9 A;  4E7S A;  2JQQ A;  4HFV A;  4U3C A;  1W0B A;  1MMG A;  5JDH A;  1FMW A;  3EDU A;  3UU6 A;  4AIU A;  2WWV A;  5DAB A;  1HX8 A;  3ZYK A;  2KIN B;  3LK2 B;  2LOS A;  1T72 A;  1I6Z A;  2LOP A;  3UUB A;  4BJM A;  4N78 D;  2WQY A;  2PH9 A;  2XHE B;  5JRC A;  3K1S A;  4IGU A;  3CIR A;  2LSK A;  3C79 A;  2MTQ A;  3JC6 D;  4ILA A;  4I4T E;  3N2G E;  5FXV A;  1HCI A;  5JDM A;  1WRD A;  3ANW B;  3MJX A;  2IDO B;  4EIW A;  2VL8 A;  3QOF A;  2J4G A;  4X1K E;  3SIO A;  2LSI A;  3VR9 A;  2PTF A;  4DO0 A;  4GKK T;  3QK6 A;  5HEJ A;  4O4J E;  2A2F X;  4A5X A;  2XYT A;  3ZYL A;  2YDS A;  4X65 T;  2LKG A;  5CA1 E;  5FJV A;  3CQX C;  4DR3 T;  5AQV B;  3ETU A;  2BDE A;  4UVA B;  4DR6 T;  4I43 B;  5JQG E;  4IDQ A;  3FZM B;  1D1C A;  2X0Y A;  3CQG B;  1KF6 A;  4LF6 T;  2BR8 A;  1UUS A;  3P4W A;  2XPK A;  3UQ7 A;  4P09 A;  3RI5 A;  2Q9Q D;  2LLY A;  1D0Z A;  1B7T A;  2XQA A;  1WLX A;  1LVK A;  4UEL A;  4MLK A;  3N9N A;  3MA9 A;  2BG9 C;  2KXP B;  2VQE T;  4OFZ A;  2KWH A;  3E08 A;  3AEB A;  2E2A A;  5JR9 B;  3VKG A;  3AAI A;  4QAC A;  2BG9 A;  1ZHC A;  2BYN A;  3PUX F;  1FEW A;  4HN9 A;  2X0H A;  2I6H A;  3UFG A;  5AFK A;  3HKB E;  4H63 H;  5TVC A;  2LEH A;  2IML A;  3DJB A;  2XNU A;  3AEC A;  5CFB A;  2UXN B;  3BQI A;  3ZST A;  1KK7 A;  3E22 E;  2ODU A;  2CA5 A;  2ZM0 A;  1IAP A;  3N9P A;  4COF A;  4PFP A;  3PUW F;  2BKN A;  5AQK B;  2CEA A;  5CA0 E;  4OX9 T;  3P8C D;  1N36 T;  4ZI3 D;  4GK5 E;  2V7M A;  1SE7 A;  4XAX B;  5BP0 A;  2XQ9 A;  2BS4 A;  3UU3 A;  5L3C B;  3AEF A;  3DTO A;  4ZS2 A;  2HPL A;  5JTG A;  3QB5 K;  4YSY A;  2DNX A;  2WCA A;  2ZJU A;  3OYX A;  4AKG A;  3U8N A;  1MIW A;  3ONX A;  4NXM T;  1YXR A;  4IHJ E;  2CWY A;  3SRZ A;  5LB7 B;  2YKS A;  1UX4 A;  1G8X A;  4P1N A;  2ZJV A;  4DV7 T;  5CB4 E;  2ZLY A;  4TV8 E;  2LSG A;  2HN1 A;  3RH3 A;  3NKZ A;  3IF8 B;  4Z8X A;  2BVM A;  3ZMV B;  4X66 T;  5H6R B;  3AE2 A;  3JAF A;  3PE0 A;  5C2T A;  4WBO A;  2XQ8 A;  3ZMU B;  2V7I A;  3BQL A;  4O2B E;  4WBN E;  2RA1 A;  3PU3 A;  2BYR A;  3N2K E;  3SQ6 A;  2VQF T;  2IHR 1;  5C8Y E;  2H7O A;  2PFV A;  2IAK A;  3PTR B;  1MIV A;  3VKH A;  5JDL A;  2NTY A;  4QXC B;  5HCJ A;  3GMI A;  2IUB A;  4ZJT A;  2KWI B;  4UM1 A;  3WTI A;  2JQ9 A;  3U8K A;  5JDF A;  5EK4 A;  5FL1 A;  5AFU L;  4ERR A;  2NOX A;  3N9Q A;  2Y57 A;  4EED A;  4B5D A;  2RP4 A;  4Q25 A;  4KHZ F;  4EB6 E;  5EZY E;  2XM2 A;  3AE1 A;  4KBM B;  4PK4 A;  4H9P C;  4U7I A;  3RIF A;  2E9X C;  1I94 T;  4KP3 C;  4P0A A;  4IDP A;  4AQY T;  4ZK1 A;  2CXD A;  2LJL A;  3RYC E;  3TLS A;  4FRR A;  5LGN B;  2WSS V;  4XBF B;  2FJE A;  3WI3 A;  5L2L A;  3WTK A;  3KV4 A;  3RGL A;  4B3T T;  4ZRU A;  3A7M A;  4JI6 T;  2VVN A;  2WZI A;  2XUE A;  3PUY F;  3RKO A;  1OWA A;  4OYK A;  2IC6 A;  2E9X A;  1D1B A;  5LP6 E;  2Y48 B;  2UUC T;  1UCU A;  3IGQ A;  1XWM A;  1HFA A;  2D2S A;  1IBM T;  2XAF B;  5LYJ E;  1ZOY A;  4LMJ A;  2W2U A;  2Y8D A;  2WDQ A;  2WNJ A;  5C3J A;  2CPT A;  1J5E T;  2X67 A;  4HFE A;  2MPK A;  2XQ3 A;  2XQ4 A;  1E7P A;  3LFM A;  3EUH A;  1LVF A;  4WNK A;  2LRK A;  2E5L T;  1WYC A;  4PNI A;  1N33 T;  2MAW A;  3TLV A;  3WTM A;  4HWH A;  1L0V A;  1UUR A;  4MAL A;  4NIQ A;  3AXJ B;  4YLH A;  2NW8 A;  2CE7 A;  3EHZ A;  2L8K A; 
#chains in the Genus database with same CATH homology
 4ZJT A;  4COF A;  2PGZ A;  4QAA A;  3UQ4 A;  3WTJ A;  2XQ5 A;  4LML A;  5HEJ A;  1OED E;  2M6B A;  4IRE A;  3TLU A;  2W8F A;  2Y54 A;  4UM1 A;  3U8K A;  3WTI A;  3EAM A;  5J0Z A;  4XK9 A;  2VL0 A;  5SYO A;  3SH1 A;  2XYT A;  4BFQ A;  2QC1 B;  2LKH A;  5HCM A;  4A98 A;  2LKG A;  4IL9 A;  2Y7Y A;  5FJV A;  4ALX A;  2BYQ A;  1OED A;  4ZZC A;  4HFB A;  4HFD A;  3PEO A;  1I9B A;  4UM3 S;  4NPP A;  3JAD A;  2WNL A;  5KZU A;  2Y57 A;  2UZ6 A;  3P50 A;  4UM3 P;  4F8H A;  2KSR A;  5HEU A;  2C9T A;  2W8G A;  5AFM A;  5AFM B;  4B5D A;  5BP0 A;  4D01 A;  4HFH A;  5HEG A;  2XQ9 A;  3ZDG A;  4Z90 A;  3UU3 A;  3TLT A;  4ZK4 A;  4HFI A;  3WTL A;  2LM2 A;  2M6I A;  4NZB A;  3WTO A;  2WN9 A;  4AFT A;  3UU8 A;  4AFG A;  3T4M A;  4TNW A;  2YMD A;  2BR8 A;  3P4W A;  3RIA A;  3JAE A;  3UQ7 A;  3UU4 A;  2ZJU A;  4DBM A;  3RI5 A;  3RIF A;  4ILC A;  4TWF A;  4XHE A;  3U8N A;  5LG3 A;  4BQT A;  2BG9 B;  2LLY A;  5AFH A;  3WTH A;  4ZK1 A;  2YOE A;  2Y58 A;  2XQA A;  3SQ9 A;  4EZ1 A;  5L4H A;  3TLS A;  2XQ6 A;  4FRR A;  1UW6 A;  2BG9 C;  3U8M A;  3C84 A;  3WTK A;  5J5F A;  2YKS A;  5IUX A;  5L47 A;  4ZRU A;  2BYP A;  3WIP A;  5J5I A;  5J5H A;  3UU6 A;  2BR7 A;  2ZJV A;  3GUA A;  4X5T A;  2WNC A;  3ZDH A;  5HEH A;  1UV6 A;  2BG9 E;  5AFN A;  5BW2 A;  4LMK A;  2WZY A;  3IGQ A;  4TWD A;  3RQU A;  4IL4 A;  1UX2 A;  4QAC A;  3UUB A;  5LXB A;  2Y56 A;  3EI0 A;  4HFC A;  2BG9 A;  2PH9 A;  4UM3 A;  4ILB A;  4Z91 A;  2BYS A;  4LMJ A;  3LSV A;  2BYN A;  4HQP A;  4AFH A;  4UY2 A;  3JAF A;  5AFL A;  4TNV A;  3C79 A;  5HEO A;  2XQ8 A;  2WNJ A;  5AFK A;  2XZ5 A;  4PIR A;  5TVC A;  2XYS A;  2YME A;  4ILA A;  2X00 A;  2BJ0 A;  2YN6 A;  4HFE A;  2XQ3 A;  2BYR A;  4A97 A;  3PMZ A;  5BRX A;  3SQ6 A;  2XQ4 A;  2XNT A;  5KE4 A;  1OED B;  5L4E A;  4QH1 A;  5CO5 A;  5J5G A;  4QAB A;  2XNU A;  3U8L A;  4ZJS A;  4UXU A;  4WV9 A;  2XNV A;  2XQ7 A;  3RHW A;  3UU5 A;  5CFB A;  2X00 D;  5AIN A;  2MAW A;  4QH5 A;  4TWH A;  3TLV A;  3WTM A;  4ZZB A;  1OED C;  3WTN A;  5JME A;  2XZ6 A;  3TLW A;  4ZR6 A;  3U8J A;  5AFJ A;  3ZKR A;  5HCJ A;  4QH4 A;  3EHZ A;  3SIO A;  3RQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...