4QH5A

The glic pentameric ligand-gated ion channel (wild-type) crystallized in phosphate buffer
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh5A01
4EZ1A 3SQ9A 3WTOA 2X00D 2XQAA 4ZRUA 4UM1A 3P4WA 3SQ6A 3JAEA 3UU5A 2Y57A 4UM3P 5KE4A 1OEDC 3JADA 4HFCA 3UU3A 2XNVA 3U8KA 4UXUA 2XQ7A 1OEDB 2BR8A 2XNUA 3WTMA 3UU4A 3TLTA 2BG9B 1OEDA 3WTHA 5HCJA 5FJVA 4TWFA 2BG9A 3WTNA 4ILBA 4QH1A 4LMJA 5CFBA 3P50A 4TWDA 3UUBA 3U8JA 2LM2A 2UZ6A 5HCMA 4D01A 4A97A 2KSRA 2XQ4A 4ILAA 2Y58A 4AFGA 3T4MA 2BYRA 4TWHA 5L47A 4DBMA 5J5IA 2XYSA 3EI0A 2BR7A 5AINA 4Z91A 5J5FA 4UM3S 4IL4A 3RQWA 5HEHA 3PMZA 4F8HA 1UX2A 4PIRA 2W8GA 2Y54A 5BW2A 5SYOA 4FRRA 4AFHA 2BYPA 4HFBA 3ZDGA 3ZKRA 3GUAA 3WTIA 5KZUA 3TLSA 2BG9C 2BYQA 4QH5A 2WN9A 5LXBA 5TVCA 4BQTA 4UY2A 4HFHA 2WNCA 5AFLA 5HEUA 4HFEA 2PH9A 4XK9A 2XQ9A 2XQ8A 3TLUA 4NPPA 2XQ3A 3IGQA 5L4EA 2PGZA 4TNVA 2Y56A 2MAWA 3TLVA 4ZK1A 3WTLA 2XYTA 3SIOA 2WNLA 3JAFA 2YN6A 3U8NA 5AFKA 1OEDE 3EAMA 2WNJA 3PEOA 3WTJA 4Z90A 5IUXA 4ZJTA 3ZDHA 5AFMB 4WV9A 2BYSA 2BG9E 3UQ4A 4ALXA 4ZR6A 5HEJA 2BJ0A 4HQPA 4ZJSA 3U8LA 5AFMA 5J5HA 4LMLA 4ZZBA 4UM3A 2YKSA 2XQ5A 3RQUA 3C79A 5L4HA 4XHEA 3C84A 3EHZA 4QH4A 2QC1B 2WZYA 4B5DA 2X00A 2C9TA 4ZK4A 2VL0A 2ZJVA 2XQ6A 2YMDA 2ZJUA 3UU6A 3SH1A 3WTKA 2LKGA 1UW6A 2LLYA 3UQ7A 1UV6A 3RI5A 5J0ZA 3U8MA 2XNTA 2M6BA 3TLWA 4LMKA 4X5TA 5CO5A 4ILCA 4TNWA 4A98A 4QABA 4QAAA 4AFTA 3RIAA 3RIFA 5AFHA 1I9BA 3WIPA 4BFQA 5AFNA 2XZ6A 2BYNA 4IL9A 5HEGA 5JMEA 3LSVA 5BP0A 3RHWA 4IREA 2Y7YA 2YOEA 4NZBA 5BRXA 2XZ5A 5HEOA 5J5GA 4QACA 2W8FA 4HFIA 5LG3A 3UU8A 5AFJA 2YMEA 4ZZCA 4HFDA 4COFA 2M6IA 2LKHA
chains in the Genus database with same CATH superfamily
2PJQA 2RP4A 1LKXA 4MFRA 4CQIA 3ZT6A 1W0AA 4U2ZA 1HNWT 4E7ZA 5FJVA 4DR1T 2Q9QA 5AQQB 4HWCA 2RA1A 5EZYE 3HI2A 4EEDA 5FVLA 3RQWA 2CMRA 2LE8A 1XZYA 4KP3C 3AE3A 3AEEA 3UULA 4DBQA 2VASA 5L2LA 3AB3B 3P7IA 4IDZA 4AKHA 2I6HA 1XMOT 4PW8A 2ZM0A 3AAAB 4AQYT 2CPTA 3ZC1A 3PEOA 4HGAA 4WV9A 2BYSA 2W0GA 2V7IA 2JMHA 5EK2A 4ZR6A 4BJMA 3TKLB 4ZZBA 3IF8B 2X9HA 3EHZA 4U3CA 3UU6A 2NW8A 4DR2T 4ISSA 5L3FB 1WR6A 3CIRA 2LRLA 3ONJA 4X5TA 2WDRA 4A98A 3RRWA 3U3IA 2BYNA 3K8PC 5HXSA 2CBIA 4MBQA 1KFYA 5ABEA 1Y01A 2ZM8A 3P8CD 2XZ5A 5FNVE 2DI4A 2LKHA 4N78D 3LK2B 3JAEA 2FJEA 3SOLA 3AVSA 4HFCA 3WTMA 5JR9C 2BBJA 1L0VA 4QX8B 5FY7A 3TLTA 2V5CA 4I55E 2CM0A 3OYXA 1DU2A 5LOVE 1M7KA 2N9DA 5HAXA 4UF0A 2X0HA 4NUUA 5JTGA 1T7SA 4DV7T 2W8GA 2BYPA 1UURA 4P09A 2JMKA 2CE7A 1WCRA 3NZPA 3N9LA 1FIOA 1O3XA 2VQET 4KX6A 2XPKA 2LOSA 1JNRA 2IUBA 4Z90A 1IJ6A 1H7CA 2BG9E 2L3LA 4ALXA 2CA5A 3JC6C 5LGNB 4JI6T 3LFMA 2LSKA 3RQUA 2JQ9A 3SFDA 2QC1B 2H7VC 3ZJ1A 4QHOA 3LBXA 2EHOB 4JYAT 3VKGA 1UV6A 5HXHA 4NXNT 3AE1A 5ABHA 3CK6A 3OYZA 4IT4A 2WM9A 3ZYLA 4IGUA 3HR0A 4AFTA 2N1GA 3L3PA 5AFHA 4UVBB 3RYIE 5JR9A 4QXBB 4I50E 5J5GA 2CHNA 3IBPA 2V7MA 1VCTA 2XSAA 4IHJE 4OHFA 3UUXB 3M3ZB 4ZHQE 1KNZA 4U7YA 3ONLC 4X62T 2ES0A 3WTNA 4CZZB 1HX1B 2QA7A 4K0UA 3KINB 5LB7B 5L47A 3PTRB 3OTOT 3AEBA 5DQWA 3AAEB 2LRKA 5BW2A 2D0UA 1HNZT 3DJBA 1IBMT 3RIUA 3KBTA 2BBHA 2E5VA 4H9OC 4PK5A 4TNVA 1MNDA 3VR9A 3UFEA 2AE9A 2OA5A 4JI8T 5LHGB 3QNUA 2RPAA 1US7B 3QOFA 3ZMVB 2YKSA 2YDSA 3NZQA 4DUYT 3KDSE 4F6RC 5C2TA 4XHEA 4ZS2A 3O1IA 2A3DA 4YTMA 2ZJVA 5LJMA 5L3GB 4I0UA 2CEAA 1UW6A 3AA1B 2X9WA 4PFOA 1QSDA 4EXTA 5LP6E 4PFPA 3N2GE 3KV9A 3ZLIA 3P4PA 3VU7H 2PBIA 2NP9A 2KMFA 4UVCB 2X67A 1FMWA 3RYHE 3W15B 3KV6A 5HEGA 4AIUA 1G8XA 2UXXB 3V5UA 1GQEA 3AVRA 4OFZA 3MXZA 2XTLA 4YSYA 2M6IA 3T8OA 2YU2A 3WTOA 2B76A 2CCQA 2YDQA 3UU5A 5KE4A 3U8KA 1R8IA 3UU3A 3ZCJA 2EHOD 2BKPA 4LF6T 5F5WA 1D1CA 1JNZA 1J1JA 3P50A 3Q5EA 3UUBA 5HCMA 1BR2A 1LRZA 2KLQA 4Z8XA 2BR7A 3PUWF 4DBRA 4EIWA 3PMZA 5AQHB 4CXYA 5E0OA 2LSIA 5HEUA 2PH9A 2XQ9A 2IC9A 4IE4A 1UUSA 3ANWB 3T1YT 4JI7T 1LVFA 1AJ3A 3SS1A 1YKEB 1MMGA 2XAGB 3CWZB 5HXEA 2UUCT 1FJGT 4ZI2C 4HQPA 1UGOA 3FXEB 2J4GA 5AQJB 2DLRA 4UELA 5LGTB 5ADXL 4UIGA 3N2OA 3C98B 3KV4A 4ADZA 4KHPT 2ZMAA 2VL0A 1KK7A 3SH1A 5LBMA 3ZN1B 3RI5A 2L9QA 1T98A 2Y48B 1CHUA 3CQCB 2KINB 5ETWA 3QB5A 5AQVB 3PURA 3ZYMA 4GK5E 4XZCA 4EZHA 2D2SA 3PU8A 1HR0T 2BKNA 2I59A 3IEEA 3MZKB 3EABA 2V26A 3GN5A 3PUSA 4AI6A 4AKGA 2HN1A 1G73A 4O4IE 4UM3P 1OEDC 4UV8B 4H9RC 2C5IT 2BG9B 2H88A 5CFBA 4YY3T 4A97A 4DNDA 2F4VT 1N36T 2YK0A 3FBZA 1YQ3A 1T72A 3HA4A 4WBNE 4IL4A 4MHCA 3M65A 2V6XA 2VWAA 5LNKA 5ABFA 1Z8UA 5CB4E 5TVCA 1KNPA 1UX4A 2X0YA 2K24A 4HFEA 2XQ3A 3RKOA 3L09A 4EZ4A 2DWKA 1B7TA 1XMQT 1UK5A 5HWYA 3ABVA 2XAJB 4B3RT 2XSBA 5DJQC 2XJ7A 2XQ6A 4EB6E 3MACA 3HKCE 3E08A 4OYKA 4O4JE 4GK0E 5J0ZA 4CN1A 4JLEA 3ZT5A 2WCAA 2C5KT 1N34T 1SE7A 5H6RB 2VURA 1BR1A 5AFNA 2V1DB 3VHLA 4IE7A 4H63H 4DV1T 1HFAA 4O4LE 4X1IE 4YT0A 3O1HA 2NTXA 1MMNA 2SPCA 3KV5A 4P1NA 2MYSA 4HWHA 2XNVA 3I1AA 3KVBA 3Q5DA 4AKLA 2Q9QB 3WTHA 2R6GF 3ETVA 4LMJA 4PAGA 3F2EA 2UZ6A 2NW9A 4I43B 2V6YB 3AAIA 3H3MA 1XDPA 2W2UA 3RGLA 3N9PA 4HKAA 5SYOA 3ZDGA 2WBLA 2WN9A 2W62A 4ZEYA 5AFLA 2QYWA 4IDQA 3C4ZA 5JVDE 1YQ4A 4C90A 4DO0A 4GKKT 2WNLA 1ZOYA 3N9QA 2V6YA 4L0RA 4DVDA 3WTJA 5LCYA 5JDMA 3U8LA 2CHOA 4LMLA 2J1DG 2XQ5A 3O1JA 2NOXA 3H37A 2E9XC 2YMDA 3CKDA 2LKGA 2K9AA 4BJNA 5FXWA 4C91A 1W0BA 4QXHB 2CXFA 2XAQB 5LGUB 5CA1E 3WAKA 5ABGA 2CRBA 4IE5A 2VKDA 3ESLA 2IAKA 1OWAA 5J1GA 3RHWA 4AKIA 2NW7A 4HWIB 3RC3A 3FBLA 3AA6B 5JQGE 4COFA 5AQOB 4AQGA 3ZC0A 3VRBA 3PDYA 2XM1A 4U33A 2W61A 2WWVA 2XY8B 4GYRA 5LHHB 3PUQA 5AQNB 4TX5A 1E1HB 3Q9DA 3T4MA 4UF0B 2WP9A 3AXJA 3BQKA 4AFHA 3ZKRA 3WTIA 5TAOA 2G0UA 5LXBA 2VKJA 5JDFA 3PV0F 2MAWA 3K3OA 1MIYA 4DR6T 3QUJA 1W09A 2HH7A 4A5XA 2Q9QD 3LJCA 3HL6A 4H9PC 4ZI3D 5FMNA 3C50A 5J5HA 3C79A 1ZHCA 4CI1B 2UXDT 3UUMA 3LBXB 4ZK4A 2EHOC 2V7LA 4CI2B 5DABA 1MNEA 1MMAA 2HPJA 2DCFA 2DL1A 2BZBA 1ZEEA 3AA0B 4MALA 3IHRA 2MOZA 3RLFF 3QK6A 4IE6A 3RIFA 5JR9B 2PFVA 4BFQA 2FJBA 3LSVA 2J47A 2GK9A 2V7KA 3MJXA 3AE7A 2CLYC 1VCSA 5L3DB 3Q5XA 3JADA 4LF8T 1D0ZA 2XQ7A 2KWIB 3RKGA 3FZFB 3ZN0B 3VKHA 3U8JA 1MIWA 3PU3A 1UCUA 2W67A 2BYRA 3Q2MA 2ODUA 4Z91A 3RPUA 4PIRA 4A56A 4GIWA 3BQLA 1Y64B 2Y8DA 4FRRA 2MTQA 5AQFB 4QH5A 4K0KT 3S4UA 2LSJA 5CJ5A 4UY2A 3C51A 5L4EA 3IGQA 2WSSV 5EK3A 2LHRA 4ZK1A 4UV9B 1I94T 2H89A 1M62A 4PK6A 5J2UE 3LK3B 2JRKA 2W00A 1HTJF 2UU9T 2X00A 4G2AA 2V5DA 1W9RA 2ODVA 3ZJ2A 3ZMZB 2H3RA 4X66T 5H6QB 3TLWA 3HKDE 5AQKB 3AEDA 5KDMC 4TNWA 3I9YA 2KZ7B 4J2CA 5JMEA 2OV9A 3FHNA 4YLHA 5HEOA 4QACA 1IZNB 4DR3T 4UM1A 3SQ6A 4JI2T 5GONE 3AEFA 1XWMA 2D9DA 1SHZC 1CUNA 2OLTA 3V5SA 2E8IA 3R6NA 4V1Av 3ZPOA 4L5GA 3AE2A 1IJ5A 1UX2A 1YKHB 3PE0A 2M67A 5IYZE 4HE8A 4YTNA 5LYJE 5BMVE 4HFHA 4B6XA 2KNDA 2XQ8A 4NPPA 3FXDB 5JREA 3ETUA 5AQMB 3RYFE 2K5BB 4LFBT 3KBUA 4IDNA 1MIVA 5JDHA 5AQTB 1NWMX 1ZV4X 5AQGB 2BKOA 2YEVC 5AFMA 4H9SE 4LFAT 4DR7T 4ZS3A 4Q25A 2WS3A 5L3CB 1BR0A 4B5DA 5HXCA 5FL1A 3N5LA 4O2BE 1YXRA 4M1PA 3JC6D 1VOMA 3UFGA 4P0AA 4EOZB 4P0BA 5CO5A 3RYCE 2A72A 4QAAA 4UVAB 2W4XA 3PUAA 2WU2A 2Y7YA 3GN5B 3SWHA 5LG3A 4WBOA 1NEKA 4WNKA 2E5LT 4IDPA 5J2TE 4ZRUA 4CXWA 4YJ2E 3ZMTB 2XAFB 4TZ4C 4NIQA 5FXXA 1X9BA 4LF5T 4X1KE 3P4QA 3AEAA 3UT5E 2LEHA 3C4WA 1WRDA 2KSRA 2WWUA 5C3JA 4DUZT 1N32T 5LJNA 4JI0T 4E7SA 5ABFB 3IA3A 3OKQA 2ZM6T 3N2KE 2JPFA 2CBJA 4H63V 2X9XA 2D0TA 3TLVA 2XYTA 1U4QA 3F31A 5AFKA 4O8SA 1HX8A 2WZHA 5FXZA 3AE5A 3ZDHA 4L9IA 4TUYE 1KF6A 4AXPA 4KMCA 1QLBA 3A8YC 4DIDB 2NR4A 1WLXA 2ZJUA 3OPCA 2A2FX 2FUPA 2X0LB 3EDVA 1QUUA 2W63A 4LMKA 3CQGB 2DHRA 2W66A 2QRXA 5EK4A 3K1SA 5KX5E 4HFIA 3BQIA 4ZZCA 3FZLB 1SUMB 3PUZF 3DTOA 2XUEA 2XQAA 3P4WA 4IDOA 4DMVA 3D0TA 4X1YE 2Q9QC 1OEDA 4CN6A 4TWFA 4AQFC 3J7Yq 2LM2A 2MBGA 2NTYA 1FEWA 5LBQB 4JI5T 5J5IA 1IBLT 3LG7A 4GKJT 2Z6EA 5HEHA 3H3AA 5M4YA 3GWHA 4HTEA 2H7OA 2UXBT 3GUAA 2BYQA 3A7MA 2CWOA 3BK9A 1HCIA 4OK0A 4DV3T 3QB5K 4O4HE 4QWNB 2V7JA 2VVSA 2Y56A 2JIWA 3WTLA 1EZ3A 4JV5T 3U8NA 1HF8A 3EAMA 2WNJA 4QX7B 1WFDA 3UQ4A 4EYUA 4QXCB 3ONXA 4TV9E 3CVRA 4ZI7E 2LSYA 4YXDA 2BS3A 4NXMT 4MLKA 4TV8E 4ISTA 2JJ9A 2C9TA 3ZSTA 2D5UA 2BS4A 2FBWA 3AE4A 3WTKA 3CMLA 2K3WA 2E2AA 1J5ET 3PUGA 1D1AA 3RRCA 3KVAA 4JBWF 4H9NC 5JRCA 4KBMB 4ZXLA 4IL9A 4LF9T 3Q5WA 5AQRB 1ZP0A 4DR5T 4AQFA 5AQLB 2W8FA 2JQHA 2YMEA 3JCFA 5F3JA 3F57A 5FKYA 2BR8A 2WY2A 3NKZA 3L8RA 3VR8A 4ILUA 5DQVA 2QGSA 4HFVA 4LF4T 2Y58A 2YU1A 4TWHA 2X9YA 3E0ZA 1U5PA 4U31A 2ACXA 3AXJB 4WYVA 4CI3B 4U7IA 2FJAA 3N9OA 2Y54A 2CXLA 4HFBA 5KZUA 1VRBA 4DV4T 1T8BA 4GYSA 3ZYKA 5FY0A 2BVMA 3TLUA 3K3QC 3MA9A 2CXDA 2LHNA 4EYYR 2E9XB 2XM2A 3JAFA 3PJAA 4YHJA 5AQUB 2WMOA 3B5MA 4YFSA 3T1HT 5FY1A 1MMDA 2WU5A 4AISA 5IUXA 5HEJA 2C5JA 4DV2T 2VL8A 4UM3A 4DR4T 5L4HA 2BS2A 3AECA 5JDQA 1SA0E 2XQYA 4NUVA 2UXNB 3AEGA 4JEUB 1V9DA 1XNRT 2E9XA 2IDOB 4LF7T 5FVKA 2KXPB 3U8MA 4I4TE 5KXJA 5FP3A 2M6BA 2VVNA 1BR4A 5CGMA 1J5WA 4QKNA 5AQIB 1E7PA 5LHIB 3MK7C 2V8SV 3GMIA 3EUHA 2VB6A 5AFJA 4HFDA 4YHHT 3C4XA 5C8YE 4JI1T 4CN4A 5HCJA 3ZCIA 3ZEFB 5JDGA 4JI4T 2I0MA 1IBKT 2L8KA 1HNXT 3PUVF 3RF1A 1XNQT 4OX9T 3AE9A 3AA7B 3FZMB 3GA8A 4UM3S 1NENA 2WDVA 3N9MA 4U72A 5F8PA 2C0SA 1YD8G 3RIUC 4AKRB 2BVLA 2X68A 1N33T 2LJLA 1NAFA 2CWYA 4B3TT 3HKEE 2WZIA 3FZHB 5L3BB 4ERRA 3RH3A 4KUMB 2QVAA 1OEDE 5LMNT 4GOUA 4IE0A 3RX6A 3C84A 4KI0F 2WZYA 2UXCT 2YINA 4PNIA 2NWBA 1OXZA 4ZOLE 2EHOA 2UUBT 3UQ7A 2CLYB 2JQKA 1KNRA 1KEYA 3NWIA 4UR9A 4B3MT 5HYAA 2E9XD 4QABA 2IHR1 3ZMSB 3WI3A 3PJAJ 4B3ST 5BP0A 2YOEA 4UEMA 5BRXA 1UX5A 2XAHB 3UUNA 1HS7A 3U78A 2Y57A 5IHYA 3DP7A 2KT9A 2WQYA 2DWGA 3UU4A 3FZKB 4PJNA 4WW0A 2LSGA 3J9X1 2WAUA 2YDRA 4HWFA 4BA9A 3N9NA 4EAHA 3EI0A 5J5FA 5FL0A 1XDOA 2BDEA 5L3EB 2LOPA 3NVOA 5JDLA 2WMNA 3TLSA 1D1BA 2ACZA 2IMLA 4HWDA 1D0YA 3CPZA 5BR8T 2YN6A 3ZT7A 4WZXA 4EGWA 5JDNA 4DV5T 5AFMB 4ZJTA 3L39A 1WR0A 4ZJSA 2BJ0A 4LFCT 3QC9A 4YTPA 2HPLA 3CQXC 3ZSSA 3O4XE 3P4SA 4YSZA 2XZEA 2XHEB 2JQQA 5LMUT 4PK4A 4BAYB 2LLYA 4G63A 2AXDS 1X79A 3LDQB 5AQSB 5FYMA 2B1EA 2XASB 3P4RA 4PJJA 1FMVA 3OJAA 4X64T 1YW0A 3UU8A 4X65T 4XBFB 4DV6T 4JI3T 3SQ9A 2ZLYA 3EVYA 4ASKA 2X00D 4UXUA 4UXNB 2PG8A 2LM9A 1WYCA 3AE6A 4TWDA 4D01A 4CXXA 4YSXA 4ILAA 2KWHA 4OYJA 3CX8B 4AFGA 2VKOA 5LXTE 3NBXX 4DBMA 2XYSA 4HEAA 5AINA 3A5XA 3E22E 4F8HA 5KMGP 2ZM2A 2BG9C 4DV0T 2WNCA 2X51A 4TN7B 3X1DA 2PGZA 4X20E 5FXVA 3NRYA 3B57A 2FJDA 3ANWA 3KFWX 3OBVE 5HXRA 2DNXA 3LK42 5LG4A 4PJLA 3OVUA 4QH4A 4PJMA 1E2AA 3ZMUB 2WDQA 1I6ZA 2IC6A 2VKHA 4JUYA 2K48A 4H9QC 3MKDA 4ILCA 1D0XA 1I9BA 2XZ6A 3SFEA 5A1LA 4ANJA 3NRXA 3SRZA 3R84B 3HKBE 2J62A 4EZ1A 3FB2A 3VRAA 4DMWA 2VK9A 1OEDB 2XNUA 1S35A 3I0QA 2LT3A 2BG9A 4ILBA 4QH1A 3G06A 3CX7B 5JH7E 4HN9A 2X66A 2XQ4A 4YJ3E 3I9WA 3K3NA 3PUXF 2IIUA 3EDUA 3C64A 4EV6A 4BQTA 4IIJE 4ZI3C 5AFUL 4XK9A 3RC8A 3AE8A 2UUAT 4EEBA 2N2NA 3SIOA 5IWAT 1LVKA 2HN2A 3B13A 2Y6XA 1IAPA 2WB5A 4O2AE 5LA6E 5CA0E 2A9UA 2P9BA 5HWXA 1WYBA 3PUYF 5AQPB 3CX6B 4XAXB 1S94A 3WAJA 2MPKA 1HG5A 2IW5B 1HG2A 2XNTA 4U2YA 1Z0PA 5JRCB 3UTKA 3RIAA 3WIPA 3I0OA 2VQFT 4KHZF 4IREA 1ZKEA 4FI5A 3O9XA 4U74A 2HHHT 4NZBA 4JEHB 4FJOA 4ZI2D 2PTFA
chains in the Genus database with same CATH topology
4EZ1A 3SQ9A 3WTOA 2X00D 2XQAA 4ZRUA 4UM1A 3P4WA 3SQ6A 3JAEA 3UU5A 2Y57A 4UM3P 5KE4A 1OEDC 3JADA 4HFCA 3UU3A 2XNVA 3U8KA 4UXUA 2XQ7A 1OEDB 2BR8A 2XNUA 3WTMA 3UU4A 3TLTA 2BG9B 1OEDA 3WTHA 5HCJA 5FJVA 4TWFA 2BG9A 3WTNA 4ILBA 4QH1A 4LMJA 5CFBA 3P50A 4TWDA 3UUBA 3U8JA 2LM2A 2UZ6A 5HCMA 4D01A 4A97A 2KSRA 2XQ4A 4ILAA 2Y58A 4AFGA 3T4MA 2BYRA 4TWHA 5L47A 4DBMA 5J5IA 2XYSA 3EI0A 2BR7A 5AINA 4Z91A 5J5FA 4UM3S 4IL4A 3RQWA 5HEHA 3PMZA 4F8HA 1UX2A 4PIRA 2W8GA 2Y54A 5BW2A 5SYOA 4FRRA 4AFHA 2BYPA 4HFBA 3ZDGA 3ZKRA 3GUAA 3WTIA 5KZUA 3TLSA 2BG9C 2BYQA 4QH5A 2WN9A 5LXBA 5TVCA 4BQTA 4UY2A 4HFHA 2WNCA 5AFLA 5HEUA 4HFEA 2PH9A 4XK9A 2XQ9A 2XQ8A 3TLUA 4NPPA 2XQ3A 3IGQA 5L4EA 2PGZA 4TNVA 2Y56A 2MAWA 3TLVA 4ZK1A 3WTLA 2XYTA 3SIOA 2WNLA 3JAFA 2YN6A 3U8NA 5AFKA 1OEDE 3EAMA 2WNJA 3PEOA 3WTJA 4Z90A 5IUXA 4ZJTA 3ZDHA 5AFMB 4WV9A 2BYSA 2BG9E 3UQ4A 4ALXA 4ZR6A 5HEJA 2BJ0A 4HQPA 4ZJSA 3U8LA 5AFMA 5J5HA 4LMLA 4ZZBA 4UM3A 2YKSA 2XQ5A 3RQUA 3C79A 5L4HA 4XHEA 3C84A 3EHZA 4QH4A 2QC1B 2WZYA 4B5DA 2X00A 2C9TA 4ZK4A 2VL0A 2ZJVA 2XQ6A 2YMDA 2ZJUA 3UU6A 3SH1A 3WTKA 2LKGA 1UW6A 2LLYA 3UQ7A 1UV6A 3RI5A 5J0ZA 3U8MA 2XNTA 2M6BA 3TLWA 4LMKA 4X5TA 5CO5A 4ILCA 4TNWA 4A98A 4QABA 4QAAA 4AFTA 3RIAA 3RIFA 5AFHA 1I9BA 3WIPA 4BFQA 5AFNA 2XZ6A 2BYNA 4IL9A 5HEGA 5JMEA 3LSVA 5BP0A 3RHWA 4IREA 2Y7YA 2YOEA 4NZBA 5BRXA 2XZ5A 5HEOA 5J5GA 4QACA 2W8FA 4HFIA 5LG3A 3UU8A 5AFJA 2YMEA 4ZZCA 4HFDA 4COFA 2M6IA 2LKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZ1 A;  3SQ9 A;  3WTO A;  2X00 D;  2XQA A;  4ZRU A;  4UM1 A;  3P4W A;  3SQ6 A;  3JAE A;  3UU5 A;  2Y57 A;  4UM3 P;  5KE4 A;  1OED C;  3JAD A;  4HFC A;  3UU3 A;  2XNV A;  3U8K A;  4UXU A;  2XQ7 A;  1OED B;  2BR8 A;  2XNU A;  3WTM A;  3UU4 A;  3TLT A;  2BG9 B;  1OED A;  3WTH A;  5HCJ A;  5FJV A;  4TWF A;  2BG9 A;  3WTN A;  4ILB A;  4QH1 A;  4LMJ A;  5CFB A;  3P50 A;  4TWD A;  3UUB A;  3U8J A;  2LM2 A;  2UZ6 A;  5HCM A;  4D01 A;  4A97 A;  2KSR A;  2XQ4 A;  4ILA A;  2Y58 A;  4AFG A;  3T4M A;  2BYR A;  4TWH A;  5L47 A;  4DBM A;  5J5I A;  2XYS A;  3EI0 A;  2BR7 A;  5AIN A;  4Z91 A;  5J5F A;  4UM3 S;  4IL4 A;  3RQW A;  5HEH A;  3PMZ A;  4F8H A;  1UX2 A;  4PIR A;  2W8G A;  2Y54 A;  5BW2 A;  5SYO A;  4FRR A;  4AFH A;  2BYP A;  4HFB A;  3ZDG A;  3ZKR A;  3GUA A;  3WTI A;  5KZU A;  3TLS A;  2BG9 C;  2BYQ A;  4QH5 A;  2WN9 A;  5LXB A;  5TVC A;  4BQT A;  4UY2 A;  4HFH A;  2WNC A;  5AFL A;  5HEU A;  4HFE A;  2PH9 A;  4XK9 A;  2XQ9 A;  2XQ8 A;  3TLU A;  4NPP A;  2XQ3 A;  3IGQ A;  5L4E A;  2PGZ A;  4TNV A;  2Y56 A;  2MAW A;  3TLV A;  4ZK1 A;  3WTL A;  2XYT A;  3SIO A;  2WNL A;  3JAF A;  2YN6 A;  3U8N A;  5AFK A;  1OED E;  3EAM A;  2WNJ A;  3PEO A;  3WTJ A;  4Z90 A;  5IUX A;  4ZJT A;  3ZDH A;  5AFM B;  4WV9 A;  2BYS A;  2BG9 E;  3UQ4 A;  4ALX A;  4ZR6 A;  5HEJ A;  2BJ0 A;  4HQP A;  4ZJS A;  3U8L A;  5AFM A;  5J5H A;  4LML A;  4ZZB A;  4UM3 A;  2YKS A;  2XQ5 A;  3RQU A;  3C79 A;  5L4H A;  4XHE A;  3C84 A;  3EHZ A;  4QH4 A;  2QC1 B;  2WZY A;  4B5D A;  2X00 A;  2C9T A;  4ZK4 A;  2VL0 A;  2ZJV A;  2XQ6 A;  2YMD A;  2ZJU A;  3UU6 A;  3SH1 A;  3WTK A;  2LKG A;  1UW6 A;  2LLY A;  3UQ7 A;  1UV6 A;  3RI5 A;  5J0Z A;  3U8M A;  2XNT A;  2M6B A;  3TLW A;  4LMK A;  4X5T A;  5CO5 A;  4ILC A;  4TNW A;  4A98 A;  4QAB A;  4QAA A;  4AFT A;  3RIA A;  3RIF A;  5AFH A;  1I9B A;  3WIP A;  4BFQ A;  5AFN A;  2XZ6 A;  2BYN A;  4IL9 A;  5HEG A;  5JME A;  3LSV A;  5BP0 A;  3RHW A;  4IRE A;  2Y7Y A;  2YOE A;  4NZB A;  5BRX A;  2XZ5 A;  5HEO A;  5J5G A;  4QAC A;  2W8F A;  4HFI A;  5LG3 A;  3UU8 A;  5AFJ A;  2YME A;  4ZZC A;  4HFD A;  4COF A;  2M6I A;  2LKH A; 
#chains in the Genus database with same CATH topology
 2PJQ A;  2RP4 A;  1LKX A;  4MFR A;  4CQI A;  3ZT6 A;  1W0A A;  4U2Z A;  1HNW T;  4E7Z A;  5FJV A;  4DR1 T;  2Q9Q A;  5AQQ B;  4HWC A;  2RA1 A;  5EZY E;  3HI2 A;  4EED A;  5FVL A;  3RQW A;  2CMR A;  2LE8 A;  1XZY A;  4KP3 C;  3AE3 A;  3AEE A;  3UUL A;  4DBQ A;  2VAS A;  5L2L A;  3AB3 B;  3P7I A;  4IDZ A;  4AKH A;  2I6H A;  1XMO T;  4PW8 A;  2ZM0 A;  3AAA B;  4AQY T;  2CPT A;  3ZC1 A;  3PEO A;  4HGA A;  4WV9 A;  2BYS A;  2W0G A;  2V7I A;  2JMH A;  5EK2 A;  4ZR6 A;  4BJM A;  3TKL B;  4ZZB A;  3IF8 B;  2X9H A;  3EHZ A;  4U3C A;  3UU6 A;  2NW8 A;  4DR2 T;  4ISS A;  5L3F B;  1WR6 A;  3CIR A;  2LRL A;  3ONJ A;  4X5T A;  2WDR A;  4A98 A;  3RRW A;  3U3I A;  2BYN A;  3K8P C;  5HXS A;  2CBI A;  4MBQ A;  1KFY A;  5ABE A;  1Y01 A;  2ZM8 A;  3P8C D;  2XZ5 A;  5FNV E;  2DI4 A;  2LKH A;  4N78 D;  3LK2 B;  3JAE A;  2FJE A;  3SOL A;  3AVS A;  4HFC A;  3WTM A;  5JR9 C;  2BBJ A;  1L0V A;  4QX8 B;  5FY7 A;  3TLT A;  2V5C A;  4I55 E;  2CM0 A;  3OYX A;  1DU2 A;  5LOV E;  1M7K A;  2N9D A;  5HAX A;  4UF0 A;  2X0H A;  4NUU A;  5JTG A;  1T7S A;  4DV7 T;  2W8G A;  2BYP A;  1UUR A;  4P09 A;  2JMK A;  2CE7 A;  1WCR A;  3NZP A;  3N9L A;  1FIO A;  1O3X A;  2VQE T;  4KX6 A;  2XPK A;  2LOS A;  1JNR A;  2IUB A;  4Z90 A;  1IJ6 A;  1H7C A;  2BG9 E;  2L3L A;  4ALX A;  2CA5 A;  3JC6 C;  5LGN B;  4JI6 T;  3LFM A;  2LSK A;  3RQU A;  2JQ9 A;  3SFD A;  2QC1 B;  2H7V C;  3ZJ1 A;  4QHO A;  3LBX A;  2EHO B;  4JYA T;  3VKG A;  1UV6 A;  5HXH A;  4NXN T;  3AE1 A;  5ABH A;  3CK6 A;  3OYZ A;  4IT4 A;  2WM9 A;  3ZYL A;  4IGU A;  3HR0 A;  4AFT A;  2N1G A;  3L3P A;  5AFH A;  4UVB B;  3RYI E;  5JR9 A;  4QXB B;  4I50 E;  5J5G A;  2CHN A;  3IBP A;  2V7M A;  1VCT A;  2XSA A;  4IHJ E;  4OHF A;  3UUX B;  3M3Z B;  4ZHQ E;  1KNZ A;  4U7Y A;  3ONL C;  4X62 T;  2ES0 A;  3WTN A;  4CZZ B;  1HX1 B;  2QA7 A;  4K0U A;  3KIN B;  5LB7 B;  5L47 A;  3PTR B;  3OTO T;  3AEB A;  5DQW A;  3AAE B;  2LRK A;  5BW2 A;  2D0U A;  1HNZ T;  3DJB A;  1IBM T;  3RIU A;  3KBT A;  2BBH A;  2E5V A;  4H9O C;  4PK5 A;  4TNV A;  1MND A;  3VR9 A;  3UFE A;  2AE9 A;  2OA5 A;  4JI8 T;  5LHG B;  3QNU A;  2RPA A;  1US7 B;  3QOF A;  3ZMV B;  2YKS A;  2YDS A;  3NZQ A;  4DUY T;  3KDS E;  4F6R C;  5C2T A;  4XHE A;  4ZS2 A;  3O1I A;  2A3D A;  4YTM A;  2ZJV A;  5LJM A;  5L3G B;  4I0U A;  2CEA A;  1UW6 A;  3AA1 B;  2X9W A;  4PFO A;  1QSD A;  4EXT A;  5LP6 E;  4PFP A;  3N2G E;  3KV9 A;  3ZLI A;  3P4P A;  3VU7 H;  2PBI A;  2NP9 A;  2KMF A;  4UVC B;  2X67 A;  1FMW A;  3RYH E;  3W15 B;  3KV6 A;  5HEG A;  4AIU A;  1G8X A;  2UXX B;  3V5U A;  1GQE A;  3AVR A;  4OFZ A;  3MXZ A;  2XTL A;  4YSY A;  2M6I A;  3T8O A;  2YU2 A;  3WTO A;  2B76 A;  2CCQ A;  2YDQ A;  3UU5 A;  5KE4 A;  3U8K A;  1R8I A;  3UU3 A;  3ZCJ A;  2EHO D;  2BKP A;  4LF6 T;  5F5W A;  1D1C A;  1JNZ A;  1J1J A;  3P50 A;  3Q5E A;  3UUB A;  5HCM A;  1BR2 A;  1LRZ A;  2KLQ A;  4Z8X A;  2BR7 A;  3PUW F;  4DBR A;  4EIW A;  3PMZ A;  5AQH B;  4CXY A;  5E0O A;  2LSI A;  5HEU A;  2PH9 A;  2XQ9 A;  2IC9 A;  4IE4 A;  1UUS A;  3ANW B;  3T1Y T;  4JI7 T;  1LVF A;  1AJ3 A;  3SS1 A;  1YKE B;  1MMG A;  2XAG B;  3CWZ B;  5HXE A;  2UUC T;  1FJG T;  4ZI2 C;  4HQP A;  1UGO A;  3FXE B;  2J4G A;  5AQJ B;  2DLR A;  4UEL A;  5LGT B;  5ADX L;  4UIG A;  3N2O A;  3C98 B;  3KV4 A;  4ADZ A;  4KHP T;  2ZMA A;  2VL0 A;  1KK7 A;  3SH1 A;  5LBM A;  3ZN1 B;  3RI5 A;  2L9Q A;  1T98 A;  2Y48 B;  1CHU A;  3CQC B;  2KIN B;  5ETW A;  3QB5 A;  5AQV B;  3PUR A;  3ZYM A;  4GK5 E;  4XZC A;  4EZH A;  2D2S A;  3PU8 A;  1HR0 T;  2BKN A;  2I59 A;  3IEE A;  3MZK B;  3EAB A;  2V26 A;  3GN5 A;  3PUS A;  4AI6 A;  4AKG A;  2HN1 A;  1G73 A;  4O4I E;  4UM3 P;  1OED C;  4UV8 B;  4H9R C;  2C5I T;  2BG9 B;  2H88 A;  5CFB A;  4YY3 T;  4A97 A;  4DND A;  2F4V T;  1N36 T;  2YK0 A;  3FBZ A;  1YQ3 A;  1T72 A;  3HA4 A;  4WBN E;  4IL4 A;  4MHC A;  3M65 A;  2V6X A;  2VWA A;  5LNK A;  5ABF A;  1Z8U A;  5CB4 E;  5TVC A;  1KNP A;  1UX4 A;  2X0Y A;  2K24 A;  4HFE A;  2XQ3 A;  3RKO A;  3L09 A;  4EZ4 A;  2DWK A;  1B7T A;  1XMQ T;  1UK5 A;  5HWY A;  3ABV A;  2XAJ B;  4B3R T;  2XSB A;  5DJQ C;  2XJ7 A;  2XQ6 A;  4EB6 E;  3MAC A;  3HKC E;  3E08 A;  4OYK A;  4O4J E;  4GK0 E;  5J0Z A;  4CN1 A;  4JLE A;  3ZT5 A;  2WCA A;  2C5K T;  1N34 T;  1SE7 A;  5H6R B;  2VUR A;  1BR1 A;  5AFN A;  2V1D B;  3VHL A;  4IE7 A;  4H63 H;  4DV1 T;  1HFA A;  4O4L E;  4X1I E;  4YT0 A;  3O1H A;  2NTX A;  1MMN A;  2SPC A;  3KV5 A;  4P1N A;  2MYS A;  4HWH A;  2XNV A;  3I1A A;  3KVB A;  3Q5D A;  4AKL A;  2Q9Q B;  3WTH A;  2R6G F;  3ETV A;  4LMJ A;  4PAG A;  3F2E A;  2UZ6 A;  2NW9 A;  4I43 B;  2V6Y B;  3AAI A;  3H3M A;  1XDP A;  2W2U A;  3RGL A;  3N9P A;  4HKA A;  5SYO A;  3ZDG A;  2WBL A;  2WN9 A;  2W62 A;  4ZEY A;  5AFL A;  2QYW A;  4IDQ A;  3C4Z A;  5JVD E;  1YQ4 A;  4C90 A;  4DO0 A;  4GKK T;  2WNL A;  1ZOY A;  3N9Q A;  2V6Y A;  4L0R A;  4DVD A;  3WTJ A;  5LCY A;  5JDM A;  3U8L A;  2CHO A;  4LML A;  2J1D G;  2XQ5 A;  3O1J A;  2NOX A;  3H37 A;  2E9X C;  2YMD A;  3CKD A;  2LKG A;  2K9A A;  4BJN A;  5FXW A;  4C91 A;  1W0B A;  4QXH B;  2CXF A;  2XAQ B;  5LGU B;  5CA1 E;  3WAK A;  5ABG A;  2CRB A;  4IE5 A;  2VKD A;  3ESL A;  2IAK A;  1OWA A;  5J1G A;  3RHW A;  4AKI A;  2NW7 A;  4HWI B;  3RC3 A;  3FBL A;  3AA6 B;  5JQG E;  4COF A;  5AQO B;  4AQG A;  3ZC0 A;  3VRB A;  3PDY A;  2XM1 A;  4U33 A;  2W61 A;  2WWV A;  2XY8 B;  4GYR A;  5LHH B;  3PUQ A;  5AQN B;  4TX5 A;  1E1H B;  3Q9D A;  3T4M A;  4UF0 B;  2WP9 A;  3AXJ A;  3BQK A;  4AFH A;  3ZKR A;  3WTI A;  5TAO A;  2G0U A;  5LXB A;  2VKJ A;  5JDF A;  3PV0 F;  2MAW A;  3K3O A;  1MIY A;  4DR6 T;  3QUJ A;  1W09 A;  2HH7 A;  4A5X A;  2Q9Q D;  3LJC A;  3HL6 A;  4H9P C;  4ZI3 D;  5FMN A;  3C50 A;  5J5H A;  3C79 A;  1ZHC A;  4CI1 B;  2UXD T;  3UUM A;  3LBX B;  4ZK4 A;  2EHO C;  2V7L A;  4CI2 B;  5DAB A;  1MNE A;  1MMA A;  2HPJ A;  2DCF A;  2DL1 A;  2BZB A;  1ZEE A;  3AA0 B;  4MAL A;  3IHR A;  2MOZ A;  3RLF F;  3QK6 A;  4IE6 A;  3RIF A;  5JR9 B;  2PFV A;  4BFQ A;  2FJB A;  3LSV A;  2J47 A;  2GK9 A;  2V7K A;  3MJX A;  3AE7 A;  2CLY C;  1VCS A;  5L3D B;  3Q5X A;  3JAD A;  4LF8 T;  1D0Z A;  2XQ7 A;  2KWI B;  3RKG A;  3FZF B;  3ZN0 B;  3VKH A;  3U8J A;  1MIW A;  3PU3 A;  1UCU A;  2W67 A;  2BYR A;  3Q2M A;  2ODU A;  4Z91 A;  3RPU A;  4PIR A;  4A56 A;  4GIW A;  3BQL A;  1Y64 B;  2Y8D A;  4FRR A;  2MTQ A;  5AQF B;  4QH5 A;  4K0K T;  3S4U A;  2LSJ A;  5CJ5 A;  4UY2 A;  3C51 A;  5L4E A;  3IGQ A;  2WSS V;  5EK3 A;  2LHR A;  4ZK1 A;  4UV9 B;  1I94 T;  2H89 A;  1M62 A;  4PK6 A;  5J2U E;  3LK3 B;  2JRK A;  2W00 A;  1HTJ F;  2UU9 T;  2X00 A;  4G2A A;  2V5D A;  1W9R A;  2ODV A;  3ZJ2 A;  3ZMZ B;  2H3R A;  4X66 T;  5H6Q B;  3TLW A;  3HKD E;  5AQK B;  3AED A;  5KDM C;  4TNW A;  3I9Y A;  2KZ7 B;  4J2C A;  5JME A;  2OV9 A;  3FHN A;  4YLH A;  5HEO A;  4QAC A;  1IZN B;  4DR3 T;  4UM1 A;  3SQ6 A;  4JI2 T;  5GON E;  3AEF A;  1XWM A;  2D9D A;  1SHZ C;  1CUN A;  2OLT A;  3V5S A;  2E8I A;  3R6N A;  4V1A v;  3ZPO A;  4L5G A;  3AE2 A;  1IJ5 A;  1UX2 A;  1YKH B;  3PE0 A;  2M67 A;  5IYZ E;  4HE8 A;  4YTN A;  5LYJ E;  5BMV E;  4HFH A;  4B6X A;  2KND A;  2XQ8 A;  4NPP A;  3FXD B;  5JRE A;  3ETU A;  5AQM B;  3RYF E;  2K5B B;  4LFB T;  3KBU A;  4IDN A;  1MIV A;  5JDH A;  5AQT B;  1NWM X;  1ZV4 X;  5AQG B;  2BKO A;  2YEV C;  5AFM A;  4H9S E;  4LFA T;  4DR7 T;  4ZS3 A;  4Q25 A;  2WS3 A;  5L3C B;  1BR0 A;  4B5D A;  5HXC A;  5FL1 A;  3N5L A;  4O2B E;  1YXR A;  4M1P A;  3JC6 D;  1VOM A;  3UFG A;  4P0A A;  4EOZ B;  4P0B A;  5CO5 A;  3RYC E;  2A72 A;  4QAA A;  4UVA B;  2W4X A;  3PUA A;  2WU2 A;  2Y7Y A;  3GN5 B;  3SWH A;  5LG3 A;  4WBO A;  1NEK A;  4WNK A;  2E5L T;  4IDP A;  5J2T E;  4ZRU A;  4CXW A;  4YJ2 E;  3ZMT B;  2XAF B;  4TZ4 C;  4NIQ A;  5FXX A;  1X9B A;  4LF5 T;  4X1K E;  3P4Q A;  3AEA A;  3UT5 E;  2LEH A;  3C4W A;  1WRD A;  2KSR A;  2WWU A;  5C3J A;  4DUZ T;  1N32 T;  5LJN A;  4JI0 T;  4E7S A;  5ABF B;  3IA3 A;  3OKQ A;  2ZM6 T;  3N2K E;  2JPF A;  2CBJ A;  4H63 V;  2X9X A;  2D0T A;  3TLV A;  2XYT A;  1U4Q A;  3F31 A;  5AFK A;  4O8S A;  1HX8 A;  2WZH A;  5FXZ A;  3AE5 A;  3ZDH A;  4L9I A;  4TUY E;  1KF6 A;  4AXP A;  4KMC A;  1QLB A;  3A8Y C;  4DID B;  2NR4 A;  1WLX A;  2ZJU A;  3OPC A;  2A2F X;  2FUP A;  2X0L B;  3EDV A;  1QUU A;  2W63 A;  4LMK A;  3CQG B;  2DHR A;  2W66 A;  2QRX A;  5EK4 A;  3K1S A;  5KX5 E;  4HFI A;  3BQI A;  4ZZC A;  3FZL B;  1SUM B;  3PUZ F;  3DTO A;  2XUE A;  2XQA A;  3P4W A;  4IDO A;  4DMV A;  3D0T A;  4X1Y E;  2Q9Q C;  1OED A;  4CN6 A;  4TWF A;  4AQF C;  3J7Y q;  2LM2 A;  2MBG A;  2NTY A;  1FEW A;  5LBQ B;  4JI5 T;  5J5I A;  1IBL T;  3LG7 A;  4GKJ T;  2Z6E A;  5HEH A;  3H3A A;  5M4Y A;  3GWH A;  4HTE A;  2H7O A;  2UXB T;  3GUA A;  2BYQ A;  3A7M A;  2CWO A;  3BK9 A;  1HCI A;  4OK0 A;  4DV3 T;  3QB5 K;  4O4H E;  4QWN B;  2V7J A;  2VVS A;  2Y56 A;  2JIW A;  3WTL A;  1EZ3 A;  4JV5 T;  3U8N A;  1HF8 A;  3EAM A;  2WNJ A;  4QX7 B;  1WFD A;  3UQ4 A;  4EYU A;  4QXC B;  3ONX A;  4TV9 E;  3CVR A;  4ZI7 E;  2LSY A;  4YXD A;  2BS3 A;  4NXM T;  4MLK A;  4TV8 E;  4IST A;  2JJ9 A;  2C9T A;  3ZST A;  2D5U A;  2BS4 A;  2FBW A;  3AE4 A;  3WTK A;  3CML A;  2K3W A;  2E2A A;  1J5E T;  3PUG A;  1D1A A;  3RRC A;  3KVA A;  4JBW F;  4H9N C;  5JRC A;  4KBM B;  4ZXL A;  4IL9 A;  4LF9 T;  3Q5W A;  5AQR B;  1ZP0 A;  4DR5 T;  4AQF A;  5AQL B;  2W8F A;  2JQH A;  2YME A;  3JCF A;  5F3J A;  3F57 A;  5FKY A;  2BR8 A;  2WY2 A;  3NKZ A;  3L8R A;  3VR8 A;  4ILU A;  5DQV A;  2QGS A;  4HFV A;  4LF4 T;  2Y58 A;  2YU1 A;  4TWH A;  2X9Y A;  3E0Z A;  1U5P A;  4U31 A;  2ACX A;  3AXJ B;  4WYV A;  4CI3 B;  4U7I A;  2FJA A;  3N9O A;  2Y54 A;  2CXL A;  4HFB A;  5KZU A;  1VRB A;  4DV4 T;  1T8B A;  4GYS A;  3ZYK A;  5FY0 A;  2BVM A;  3TLU A;  3K3Q C;  3MA9 A;  2CXD A;  2LHN A;  4EYY R;  2E9X B;  2XM2 A;  3JAF A;  3PJA A;  4YHJ A;  5AQU B;  2WMO A;  3B5M A;  4YFS A;  3T1H T;  5FY1 A;  1MMD A;  2WU5 A;  4AIS A;  5IUX A;  5HEJ A;  2C5J A;  4DV2 T;  2VL8 A;  4UM3 A;  4DR4 T;  5L4H A;  2BS2 A;  3AEC A;  5JDQ A;  1SA0 E;  2XQY A;  4NUV A;  2UXN B;  3AEG A;  4JEU B;  1V9D A;  1XNR T;  2E9X A;  2IDO B;  4LF7 T;  5FVK A;  2KXP B;  3U8M A;  4I4T E;  5KXJ A;  5FP3 A;  2M6B A;  2VVN A;  1BR4 A;  5CGM A;  1J5W A;  4QKN A;  5AQI B;  1E7P A;  5LHI B;  3MK7 C;  2V8S V;  3GMI A;  3EUH A;  2VB6 A;  5AFJ A;  4HFD A;  4YHH T;  3C4X A;  5C8Y E;  4JI1 T;  4CN4 A;  5HCJ A;  3ZCI A;  3ZEF B;  5JDG A;  4JI4 T;  2I0M A;  1IBK T;  2L8K A;  1HNX T;  3PUV F;  3RF1 A;  1XNQ T;  4OX9 T;  3AE9 A;  3AA7 B;  3FZM B;  3GA8 A;  4UM3 S;  1NEN A;  2WDV A;  3N9M A;  4U72 A;  5F8P A;  2C0S A;  1YD8 G;  3RIU C;  4AKR B;  2BVL A;  2X68 A;  1N33 T;  2LJL A;  1NAF A;  2CWY A;  4B3T T;  3HKE E;  2WZI A;  3FZH B;  5L3B B;  4ERR A;  3RH3 A;  4KUM B;  2QVA A;  1OED E;  5LMN T;  4GOU A;  4IE0 A;  3RX6 A;  3C84 A;  4KI0 F;  2WZY A;  2UXC T;  2YIN A;  4PNI A;  2NWB A;  1OXZ A;  4ZOL E;  2EHO A;  2UUB T;  3UQ7 A;  2CLY B;  2JQK A;  1KNR A;  1KEY A;  3NWI A;  4UR9 A;  4B3M T;  5HYA A;  2E9X D;  4QAB A;  2IHR 1;  3ZMS B;  3WI3 A;  3PJA J;  4B3S T;  5BP0 A;  2YOE A;  4UEM A;  5BRX A;  1UX5 A;  2XAH B;  3UUN A;  1HS7 A;  3U78 A;  2Y57 A;  5IHY A;  3DP7 A;  2KT9 A;  2WQY A;  2DWG A;  3UU4 A;  3FZK B;  4PJN A;  4WW0 A;  2LSG A;  3J9X 1;  2WAU A;  2YDR A;  4HWF A;  4BA9 A;  3N9N A;  4EAH A;  3EI0 A;  5J5F A;  5FL0 A;  1XDO A;  2BDE A;  5L3E B;  2LOP A;  3NVO A;  5JDL A;  2WMN A;  3TLS A;  1D1B A;  2ACZ A;  2IML A;  4HWD A;  1D0Y A;  3CPZ A;  5BR8 T;  2YN6 A;  3ZT7 A;  4WZX A;  4EGW A;  5JDN A;  4DV5 T;  5AFM B;  4ZJT A;  3L39 A;  1WR0 A;  4ZJS A;  2BJ0 A;  4LFC T;  3QC9 A;  4YTP A;  2HPL A;  3CQX C;  3ZSS A;  3O4X E;  3P4S A;  4YSZ A;  2XZE A;  2XHE B;  2JQQ A;  5LMU T;  4PK4 A;  4BAY B;  2LLY A;  4G63 A;  2AXD S;  1X79 A;  3LDQ B;  5AQS B;  5FYM A;  2B1E A;  2XAS B;  3P4R A;  4PJJ A;  1FMV A;  3OJA A;  4X64 T;  1YW0 A;  3UU8 A;  4X65 T;  4XBF B;  4DV6 T;  4JI3 T;  3SQ9 A;  2ZLY A;  3EVY A;  4ASK A;  2X00 D;  4UXU A;  4UXN B;  2PG8 A;  2LM9 A;  1WYC A;  3AE6 A;  4TWD A;  4D01 A;  4CXX A;  4YSX A;  4ILA A;  2KWH A;  4OYJ A;  3CX8 B;  4AFG A;  2VKO A;  5LXT E;  3NBX X;  4DBM A;  2XYS A;  4HEA A;  5AIN A;  3A5X A;  3E22 E;  4F8H A;  5KMG P;  2ZM2 A;  2BG9 C;  4DV0 T;  2WNC A;  2X51 A;  4TN7 B;  3X1D A;  2PGZ A;  4X20 E;  5FXV A;  3NRY A;  3B57 A;  2FJD A;  3ANW A;  3KFW X;  3OBV E;  5HXR A;  2DNX A;  3LK4 2;  5LG4 A;  4PJL A;  3OVU A;  4QH4 A;  4PJM A;  1E2A A;  3ZMU B;  2WDQ A;  1I6Z A;  2IC6 A;  2VKH A;  4JUY A;  2K48 A;  4H9Q C;  3MKD A;  4ILC A;  1D0X A;  1I9B A;  2XZ6 A;  3SFE A;  5A1L A;  4ANJ A;  3NRX A;  3SRZ A;  3R84 B;  3HKB E;  2J62 A;  4EZ1 A;  3FB2 A;  3VRA A;  4DMW A;  2VK9 A;  1OED B;  2XNU A;  1S35 A;  3I0Q A;  2LT3 A;  2BG9 A;  4ILB A;  4QH1 A;  3G06 A;  3CX7 B;  5JH7 E;  4HN9 A;  2X66 A;  2XQ4 A;  4YJ3 E;  3I9W A;  3K3N A;  3PUX F;  2IIU A;  3EDU A;  3C64 A;  4EV6 A;  4BQT A;  4IIJ E;  4ZI3 C;  5AFU L;  4XK9 A;  3RC8 A;  3AE8 A;  2UUA T;  4EEB A;  2N2N A;  3SIO A;  5IWA T;  1LVK A;  2HN2 A;  3B13 A;  2Y6X A;  1IAP A;  2WB5 A;  4O2A E;  5LA6 E;  5CA0 E;  2A9U A;  2P9B A;  5HWX A;  1WYB A;  3PUY F;  5AQP B;  3CX6 B;  4XAX B;  1S94 A;  3WAJ A;  2MPK A;  1HG5 A;  2IW5 B;  1HG2 A;  2XNT A;  4U2Y A;  1Z0P A;  5JRC B;  3UTK A;  3RIA A;  3WIP A;  3I0O A;  2VQF T;  4KHZ F;  4IRE A;  1ZKE A;  4FI5 A;  3O9X A;  4U74 A;  2HHH T;  4NZB A;  4JEH B;  4FJO A;  4ZI2 D;  2PTF A; 
#chains in the Genus database with same CATH homology
 4EZ1 A;  3SQ9 A;  3WTO A;  2X00 D;  2XQA A;  4ZRU A;  4UM1 A;  3P4W A;  3SQ6 A;  3JAE A;  3UU5 A;  2Y57 A;  4UM3 P;  5KE4 A;  1OED C;  3JAD A;  4HFC A;  3UU3 A;  2XNV A;  3U8K A;  4UXU A;  2XQ7 A;  1OED B;  2BR8 A;  2XNU A;  3WTM A;  3UU4 A;  3TLT A;  2BG9 B;  1OED A;  3WTH A;  5HCJ A;  5FJV A;  4TWF A;  2BG9 A;  3WTN A;  4ILB A;  4QH1 A;  4LMJ A;  5CFB A;  3P50 A;  4TWD A;  3UUB A;  3U8J A;  2LM2 A;  2UZ6 A;  5HCM A;  4D01 A;  4A97 A;  2KSR A;  2XQ4 A;  4ILA A;  2Y58 A;  4AFG A;  3T4M A;  2BYR A;  4TWH A;  5L47 A;  4DBM A;  5J5I A;  2XYS A;  3EI0 A;  2BR7 A;  5AIN A;  4Z91 A;  5J5F A;  4UM3 S;  4IL4 A;  3RQW A;  5HEH A;  3PMZ A;  4F8H A;  1UX2 A;  4PIR A;  2W8G A;  2Y54 A;  5BW2 A;  5SYO A;  4FRR A;  4AFH A;  2BYP A;  4HFB A;  3ZDG A;  3ZKR A;  3GUA A;  3WTI A;  5KZU A;  3TLS A;  2BG9 C;  2BYQ A;  4QH5 A;  2WN9 A;  5LXB A;  5TVC A;  4BQT A;  4UY2 A;  4HFH A;  2WNC A;  5AFL A;  5HEU A;  4HFE A;  2PH9 A;  4XK9 A;  2XQ9 A;  2XQ8 A;  3TLU A;  4NPP A;  2XQ3 A;  3IGQ A;  5L4E A;  2PGZ A;  4TNV A;  2Y56 A;  2MAW A;  3TLV A;  4ZK1 A;  3WTL A;  2XYT A;  3SIO A;  2WNL A;  3JAF A;  2YN6 A;  3U8N A;  5AFK A;  1OED E;  3EAM A;  2WNJ A;  3PEO A;  3WTJ A;  4Z90 A;  5IUX A;  4ZJT A;  3ZDH A;  5AFM B;  4WV9 A;  2BYS A;  2BG9 E;  3UQ4 A;  4ALX A;  4ZR6 A;  5HEJ A;  2BJ0 A;  4HQP A;  4ZJS A;  3U8L A;  5AFM A;  5J5H A;  4LML A;  4ZZB A;  4UM3 A;  2YKS A;  2XQ5 A;  3RQU A;  3C79 A;  5L4H A;  4XHE A;  3C84 A;  3EHZ A;  4QH4 A;  2QC1 B;  2WZY A;  4B5D A;  2X00 A;  2C9T A;  4ZK4 A;  2VL0 A;  2ZJV A;  2XQ6 A;  2YMD A;  2ZJU A;  3UU6 A;  3SH1 A;  3WTK A;  2LKG A;  1UW6 A;  2LLY A;  3UQ7 A;  1UV6 A;  3RI5 A;  5J0Z A;  3U8M A;  2XNT A;  2M6B A;  3TLW A;  4LMK A;  4X5T A;  5CO5 A;  4ILC A;  4TNW A;  4A98 A;  4QAB A;  4QAA A;  4AFT A;  3RIA A;  3RIF A;  5AFH A;  1I9B A;  3WIP A;  4BFQ A;  5AFN A;  2XZ6 A;  2BYN A;  4IL9 A;  5HEG A;  5JME A;  3LSV A;  5BP0 A;  3RHW A;  4IRE A;  2Y7Y A;  2YOE A;  4NZB A;  5BRX A;  2XZ5 A;  5HEO A;  5J5G A;  4QAC A;  2W8F A;  4HFI A;  5LG3 A;  3UU8 A;  5AFJ A;  2YME A;  4ZZC A;  4HFD A;  4COF A;  2M6I A;  2LKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...