4QH5A

The glic pentameric ligand-gated ion channel (wild-type) crystallized in phosphate buffer
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Structural characterization of potential modulation sites in the extracellular domain of the prokaryotic pentameric proton-gated ion channel GLIC
rcsb
source organism Gloeobacter violaceus
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4qh5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qh5A01
5HEUA 2YMEA 4IREA 4QAAA 5AFKA 4TNWA 4BFQA 4LMKA 2Y58A 3TLTA 3UU5A 3RI5A 3UQ4A 3U8NA 1OEDA 4TNVA 4X5TA 3SIOA 5AFNA 2PH9A 4UM1A 4XHEA 4ILBA 3TLWA 3RQUA 4D01A 2BYRA 4A98A 2W8FA 4DBMA 3SQ6A 3EI0A 3C79A 4HFBA 2M6IA 3TLVA 2C9TA 2Y54A 5AFMB 4ILCA 2QC1B 2BG9A 5AINA 4ALXA 2XQ3A 3WTMA 5LXBA 3JADA 3WTOA 4NZBA 3RHWA 2XYSA 5LG3A 4XK9A 3TLSA 4B5DA 2PGZA 3WTJA 2X00A 4LMJA 1OEDE 4IL4A 5FJVA 1OEDC 3C84A 4ZRUA 4ZJTA 5IUXA 2BJ0A 3UU6A 4TWHA 3UUBA 4ZZBA 2XQ6A 4HFEA 2WNJA 5J5GA 4QH1A 2W8GA 2BG9E 4IL9A 2BG9C 5HEGA 3RIAA 4FRRA 3U8MA 3RIFA 2XYTA 2XQ8A 1UV6A 2BR8A 4HFHA 4Z91A 3PMZA 2XQAA 3PEOA 3U8KA 5BRXA 5L4HA 1I9BA 2XQ9A 5KE4A 3UQ7A 5HEJA 2KSRA 2LM2A 4QH5A 2BYQA 5SYOA 5AFLA 2WNLA 4PIRA 5AFMA 2XQ7A 3LSVA 3U8LA 4BQTA 2XZ6A 5HEHA 5HEOA 4HFCA 5BP0A 3GUAA 3T4MA 5J5IA 5J5HA 4LMLA 3TLUA 2BYNA 4HFIA 4TWDA 2WZYA 3WTLA 4ILAA 3P50A 3ZKRA 4AFTA 4F8HA 2YMDA 4UM3P 4UY2A 4AFGA 3ZDHA 2YN6A 2ZJUA 2WNCA 3JAFA 2BYSA 3JAEA 2Y7YA 4UM3A 4HQPA 2BYPA 3SQ9A 2ZJVA 2XNTA 1OEDB 2VL0A 2BR7A 5JMEA 3P4WA 2UZ6A 5KZUA 3WIPA 5J5FA 2Y56A 5L47A 2LLYA 4AFHA 3IGQA 4TWFA 4ZK4A 5CO5A 4UXUA 5J0ZA 2XQ4A 2LKGA 3EHZA 3UU3A 5CFBA 1UX2A 5BW2A 4QABA 3WTNA 2BG9B 5HCMA 4Z90A 5L4EA 4WV9A 4COFA 3ZDGA 2XZ5A 3WTKA 2YKSA 2LKHA 2XNUA 3WTIA 5AFHA 4ZR6A 2M6BA 2WN9A 5AFJA 3EAMA 3RQWA 2MAWA 4QH4A 4A97A 4HFDA 4UM3S 5TVCA 3U8JA 2XQ5A 2XNVA 4EZ1A 1UW6A 5HCJA 2YOEA 3UU8A 3UU4A 4ZJSA 4ZK1A 2X00D 4QACA 4NPPA 3SH1A 3WTHA 4ZZCA 2Y57A
chains in the Genus database with same CATH superfamily
4Q25A 4JI8T 2VKOA 3QK6A 5JDHA 1X9BA 2CLYC 4ILCA 2W4XA 5LGTB 2PFVA 2CBIA 1YQ4A 4AKHA 2UUCT 5AQRB 2PGZA 3WTJA 1G73A 5FJVA 4DR7T 2NWBA 2BG9E 2JQHA 4PK4A 5ABFB 3M65A 3U8MA 2XQ8A 1HX1B 5L4HA 2XQ9A 4ZOLE 1WYBA 5FXWA 1KF6A 4PIRA 2JQKA 4DO0A 4DV7T 4LMLA 4JI0T 1CHUA 3WTLA 3PURA 4XBFB 2JRKA 4H63V 4X62T 2ACZA 2XAQB 4FI5A 1N33T 2YDQA 2YK0A 3BQLA 2WQYA 3N5LA 3AE4A 5JH7E 2X9XA 2IC9A 3EHZA 5BW2A 5J2UE 3ZDGA 4HFVA 2CWYA 4ADZA 5H6QB 3UTKA 4OFZA 3MK7C 2UUBT 3U8JA 5L3DB 5HCJA 3D0TA 1FMWA 4TV8E 4ZZCA 5AFKA 4QX8B 3AXJA 1E7PA 4E7ZA 4ZI3C 2GK9A 3Q5WA 4XHEA 4A98A 5L3EB 2D0UA 3E22E 5JRCA 4AQGA 5AINA 1KNZA 2XQ3A 3WTMA 3JCFA 5FL1A 4DR2T 2P9BA 3PUGA 3SRZA 3CVRA 3SWHA 5ADXL 2J1DG 3NZPA 1N32T 2LEHA 2WU2A 4OK0A 2CM0A 4O8SA 1T98A 1IZNB 2LRLA 2CHOA 4NIQA 3IA3A 3AECA 4K0KT 1R8IA 2FBWA 4H9PC 2EHOD 3NRYA 2XAHB 5J5IA 3TLUA 3WI3A 2XY8B 2RPAA 1D0ZA 3U78A 4I0UA 2YMDA 2CLYB 3KDSE 3MACA 3JAFA 4PJLA 3SQ9A 3H3MA 4DBQA 3CPZA 1JNZA 3QUJA 4DUYT 2UU9T 4ZEYA 1KNRA 2X0YA 3X1DA 1H7CA 4COFA 4EXTA 5AQJB 5AFHA 5LG4A 2BZBA 3RQWA 1YXRA 2E5LT 2VQFT 2BS2A 3C4WA 3AA0B 4EZ1A 4IE4A 3ZSSA 2RP4A 2QA7A 3UU8A 1I6ZA 3RKOA 2WY2A 2EHOA 4CN1A 3WTHA 1E2AA 4WBNE 4IREA 2VB6A 4H9OC 1XNQT 4DMWA 4DR5T 4IDOA 2QYWA 3N9QA 2W0GA 3O1JA 5L3GB 3KV9A 4I55E 5A1LA 2QC1B 3VHLA 3WTOA 2UXXB 3PUQA 4XK9A 3HR0A 4B5DA 4YTPA 1IJ5A 3ZN1B 5AQIB 3CKDA 2BVLA 3ZYLA 2CEAA 2E5VA 5LXTE 3K3NA 4PAGA 2V7KA 4U7IA 4X1IE 4FRRA 2X0HA 2LT3A 4OYJA 5CB4E 5C8YE 3W15B 2CXFA 2C5JA 2M67A 3TKLB 3QOFA 2V6YB 4UF0A 1YQ3A 2V6XA 5FXZA 2YN6A 5AQUB 3LG7A 1ZHCA 4DMVA 4UM3A 2JQ9A 4EYYR 3AEAA 2BR7A 2XHEB 2YU1A 4EZHA 2H3RA 3A8YC 2UXCT 1D1CA 2OV9A 4G2AA 3N9NA 5EK4A 4P0AA 1V9DA 2V7MA 5FXVA 3A7MA 3ZMUB 3CIRA 2LHRA 2NR4A 2IIUA 2FJAA 3V5SA 3AA6B 3SOLA 5M4YA 3AXJB 2D5UA 3LDQB 4YSXA 4ZHQE 5DQVA 5EZYE 3AE2A 5AFNA 3AA7B 5BR8T 4DUZT 5JQGE 3HL6A 4ALXA 2LHNA 5DABA 4I43B 4O4IE 1BR0A 1OEDE 1W9RA 2A2FX 2IMLA 3N9LA 1X79A 1S94A 4HFEA 2BBJA 3DP7A 4EZ4A 3AEEA 2BG9C 1MMAA 2UUAT 2MOZA 2ODUA 2KWHA 1IBMT 2WU5A 2VKDA 4TX5A 1HCIA 2KSRA 3MXZA 5SYOA 3GN5B 4CN4A 5HYAA 2DNXA 2XZ6A 4EAHA 4A56A 3RIUA 4AFGA 3ZDHA 2IDOB 3LJCA 3KBTA 2F4VT 2VL8A 2WNCA 4YHJA 1Y64B 2MYSA 4U74A 4EEBA 3AE7A 3EUHA 3RYCE 4TV9E 3WTNA 2E2AA 3J9X1 2CA5A 3KBUA 3RF1A 2WSSV 4YJ3E 2MTQA 3QNUA 3P4RA 2LSGA 3CK6A 4QACA 1YW0A 3RIUC 4LF4T 2Y58A 2XSBA 3VU7H 4DV3T 3H37A 5J1GA 4XZCA 4EIWA 3RQUA 2BKOA 2NP9A 3TLVA 2V5CA 3AE3A 3JADA 3RHWA 2WZHA 4MFRA 1HG2A 2DWKA 3C4ZA 4AIUA 4X65T 4DVDA 4IE0A 4CN6A 2W8GA 4DR1T 5LMUT 4BAYB 4U31A 2G0UA 5LB7B 1I9BA 2B1EA 5KE4A 1QUUA 2DL1A 3IEEA 5AQKB 1FMVA 4HN9A 5C2TA 2Y6XA 2LSYA 3NRXA 1VCTA 3J7Yq 4GOUA 2VK9A 4EGWA 4PW8A 4PK6A 3I9WA 2H7VC 2KZ7B 4DV4T 4BJMA 3LK3B 2ZJUA 4KHZF 2BYSA 1M62A 2Y7YA 2Y48B 5FP3A 4AXPA 1W09A 4BA9A 3I0OA 2LLYA 5CO5A 5J0ZA 2BG9B 2NOXA 3F2EA 1WFDA 3H3AA 4ZR6A 3P7IA 1SE7A 5KMGP 4DV1T 4QH4A 4A97A 4UM3S 4OX9T 2XQ5A 5FNVE 4YTNA 4EOZB 3ZSTA 4HWCA 3FBLA 4GYSA 5H6RB 5LBQB 4CI2B 3KINB 3U8NA 4IDNA 4JLEA 4L5GA 2VURA 3CWZB 4DBMA 3SFEA 2VWAA 1T8BA 2IAKA 4H9NC 5AQVB 4OYKA 3C84A 2BVMA 3UU6A 3UUBA 4A5XA 1MMNA 1J5ET 1OXZA 5HXSA 3FHNA 4U2ZA 2NTYA 2XYTA 5LOVE 1UV6A 4Z91A 2DLRA 3U8KA 4H9QC 4ZI3D 5BRXA 2ZM2A 1UCUA 2A72A 3U3IA 3Q9DA 3VKHA 3BQKA 1HX8A 1W0BA 2WNLA 3RC8A 1CUNA 2H7OA 3F57A 3FZHB 3P50A 3RPUA 5AQNB 2V1DB 4HE8A 4GK0E 1IBKT 5AFUL 2BYPA 3N9MA 1ZV4X 3WIPA 4CI3B 3MA9A 2LSJA 3WAJA 2XNUA 3ZT7A 1YKHB 3HI2A 1HR0T 3RLFF 2XM1A 2V6YA 2YEVC 2WWVA 4ISSA 4LFAT 2LSKA 5FXXA 4BFQA 2HHHT 3RI5A 3UQ4A 1WR0A 3GA8A 3P8CD 4WZXA 2DHRA 4HWFA 1IBLT 2PH9A 1NAFA 3VRAA 3QC9A 3ABVA 4HFBA 5LXBA 3IBPA 3ANWB 1O3XA 4ISTA 2XYSA 3CX7B 4JI4T 1UUSA 4HWDA 2RA1A 4JYAT 1OEDC 5IUXA 4B3TT 2IC6A 4YSYA 5JDNA 4ASKA 1SHZC 3VKGA 3Q5XA 3PMZA 5AQQB 3FBZA 4KP3C 5JTGA 5DQWA 4YXDA 4OHFA 4EYUA 4N78D 1HNWT 3LSVA 1KEYA 5AQGB 2QVAA 3LBXB 4KX6A 1XWMA 2BYNA 1QLBA 5AQOB 4F8HA 1ZEEA 3L3PA 5LGUB 3RYHE 4QXBB 4E7SA 2MBGA 2V7LA 3OJAA 4C90A 2IHR1 5FMNA 5KX5E 4KMCA 4AISA 3CMLA 3GN5A 1UGOA 3O1IA 2LKHA 2X9HA 3KVBA 2KINB 4GYRA 3JC6D 2MAWA 1D1AA 4XAXB 4YJ2E 4IDQA 4ZJSA 5IYZE 3L09A 1DU2A 2Q9QB 4LMKA 3QB5A 4WNKA 3HKDE 4X5TA 4I50E 3SIOA 3TLWA 3I1AA 5HXEA 1KK7A 3NZQA 4P0BA 5L3CB 5FY1A 1HNXT 3SQ6A 2VQET 4MALA 5FVLA 4NZBA 4AQFA 3OYXA 5C3JA 4CXYA 3DTOA 3HKBE 1I94T 4CZZB 4ZXLA 4KUMB 2K5BB 4HFHA 2V7IA 5LHHB 1WRDA 1E1HB 2XPKA 3LK2B 4JI2T 4JI5T 2WZIA 3B13A 5LHGB 1MNEA 3PUAA 4BQTA 2XZEA 2A3DA 4IE7A 4AKIA 3GUAA 3PU8A 1XNRT 4TWDA 2ZM8A 2Z6EA 4QXCB 3N2KE 3AE5A 2J62A 4AQFC 4PFPA 1KNPA 3RYFE 4O2AE 2N2NA 4EB6E 3JAEA 2ZJVA 4IE5A 3T8OA 3AVSA 4LF7T 1OEDB 5JDGA 4AKLA 1U4QA 5CA1E 1XDOA 4TWFA 3RC3A 3NWIA 3ZCJA 4X1KE 4QABA 5HCMA 3JC6C 4GKJT 3ZYKA 3R84B 3SS1A 2CRBA 5AFJA 4G63A 5JDMA 4CQIA 3A5XA 1UW6A 3FB2A 2YOEA 4IE6A 3N9OA 2YMEA 4U72A 2C5IT 2L3LA 4D01A 1QSDA 1HS7A 4C91A 3VR8A 2UXBT 2BG9A 1GQEA 4DR6T 4LFCT 2X51A 4NUUA 4P09A 2VVSA 2XQ6A 4YTMA 2WNJA 5HEGA 5LJMA 1VOMA 2XASB 4ZS3A 3IF8B 4L9IA 2ZLYA 2LM2A 4QH5A 3EVYA 3EDUA 4CXWA 3ZEFB 2D2SA 2L9QA 3ETUA 5HEHA 2NW7A 2UXDT 3FZLB 1LVKA 4WW0A 5BP0A 2V8SV 4IDZA 3AEDA 3RGLA 4TZ4C 2XM2A 2YDSA 4QWNB 4TUYE 4DV2T 4HQPA 3E0ZA 2XNTA 4U33A 2V26A 2VL0A 1MMGA 2X9WA 1MNDA 1EZ3A 5CFBA 3ONXA 4WV9A 3B5MA 2YKSA 3CQCB 2WM9A 4YHHT 5TVCA 1NEKA 1L0VA 4QKNA 4QAAA 2WWUA 2JJ9A 2N9DA 2I59A 4O4JE 5J2TE 2K9AA 3K3QC 3I0QA 4F6RC 2BYRA 4IDPA 4UIGA 1BR4A 1BR2A 2WBLA 3PTRB 2E8IA 2NW8A 2X67A 5LHIB 5LG3A 5L2LA 2X00A 4ZJTA 3FZKB 2PJQA 3NKZA 3O1HA 4YT0A 5HWYA 5AQPB 4GK5E 3CQGB 4NXMT 4K0UA 3KFWX 4U3CA 5HAXA 4B3RT 3ANWA 4TN7B 3AE6A 5EK3A 3FZMB 4YY3T 2HPJA 5E0OA 3ESLA 3ZMZB 1HG5A 2E9XC 3K8PC 3MZKB 3UFGA 3ONLC 1WLXA 4HGAA 1Y01A 3CQXC 5JMEA 3L39A 3P4WA 2ODVA 3B57A 5J5FA 2QRXA 4ZK4A 5ABGA 2XQYA 1UX2A 4GIWA 5L4EA 1VRBA 2XZ5A 1NENA 4AQYT 2IUBA 2CXLA 2Q9QD 3LBXA 2M6BA 5F8PA 5JR9C 3ETVA 5JDLA 2HN1A 4ZK1A 3HKEE 2MPKA 3AEGA 5LMNT 4YFSA 3ZT6A 2HN2A 1FJGT 3C4XA 5AFMB 4DIDB 3UFEA 3T1HT 3K1SA 4ZS2A 2BKNA 4X64T 3AAEB 3AE1A 4M1PA 4ZZBA 2WCAA 2LJLA 4QXHB 3ZCIA 4YLHA 2Q9QA 3KV4A 3ZC1A 2SPCA 2W00A 5FL0A 3PUYF 3UQ7A 3BK9A 4FJOA 2V7JA 4JEHB 5HEOA 4ANJA 2DCFA 3GWHA 3N2GE 4UM3P 1B7TA 2WS3A 1VCSA 4UEMA 4L0RA 2KT9A 2R6GF 4QX7B 5KZUA 2Y56A 4ZI2D 4DV6T 4KHPT 1S35A 2NTXA 3OVUA 3O9XA 5CJ5A 2XQ4A 3GMIA 2Q9QC 3WAKA 3RYIE 2C5KT 2X9YA 4U2YA 1ZKEA 1SUMB 4JEUB 2FJBA 1MIVA 2K24A 3EABA 5HXCA 2X66A 4H63H 3KV6A 5L3FB 4CXXA 3AEFA 3UUXB 1XMQT 2PTFA 3TLTA 2L8KA 4UV9B 5FKYA 1OEDA 4TNVA 2E9XB 2W2UA 2XJ7A 2XAGB 1JNRA 2DI4A 3EI0A 3PUXF 2H89A 2JMKA 2AE9A 4IL4A 5CA0E 4PJNA 2W61A 4ZRUA 2BJ0A 3UUMA 2KLQA 3I9YA 5J5GA 3O4XE 1OWAA 2WDQA 4LF6T 3RIAA 2BR8A 3PUWF 2XQAA 2KWIB 4PJMA 5JR9B 4JI3T 2CE7A 4IGUA 1HTJF 5ETWA 3T4MA 5J5HA 4ILAA 4DV5T 3OPCA 1SA0E 5FY0A 2WMNA 3E08A 2W62A 4ZI2C 4JUYA 4JBWF 1YD8G 1ZP0A 4UXUA 3C51A 1FEWA 4WBOA 3M3ZB 3VRBA 1UK5A 3EAMA 5LYJE 2OLTA 3SFDA 3ZMTB 2D9DA 4DBRA 2UXNB 4NPPA 5HEUA 5ABHA 2JPFA 1HF8A 1Z0PA 2V5DA 4UM1A 3CX6B 3QB5K 1G8XA 2HH7A 5L3BB 2C9TA 3HKCE 5F5WA 3KV5A 3ZJ2A 1AJ3A 3OTOT 3RKGA 4IHJE 2CCQA 4UVBB 4HEAA 4B3MT 5HWXA 2C0SA 2ES0A 4DR3T 2ZM6T 2YINA 3RX6A 2WMOA 2BKPA 2H88A 2LE8A 2CXDA 4H9SE 5BMVE 4AKRB 4MBQA 2WB5A 2XUEA 3UUNA 3UT5E 4X66T 2J47A 2QGSA 5AQLB 2BBHA 3AVRA 1NWMX 3PE0A 4UXNB 2HPLA 4UV8B 2I6HA 2VASA 3FXDB 3OKQA 5DJQC 3ZMVB 1MMDA 3UU3A 2VKJA 1YKEB 3EDVA 5LGNB 5AQSB 2YU2A 3NVOA 2W67A 4WYVA 4U7YA 4ERRA 2LRKA 4DNDA 2B76A 2PBIA 5CGMA 4B3ST 1IAPA 3K3OA 4DV0T 2D0TA 3RH3A 4LF9T 1LKXA 3PV0F 4PJJA 2W8FA 2A9UA 3PDYA 3VR9A 4HTEA 2WDVA 3PUZF 2EHOC 5LBMA 3AA1B 4DR4T 4PK5A 3TLSA 2W66A 4ILUA 2CMRA 1T7SA 3ZJ1A 3ZN0B 3LK42 1MIWA 5IHYA 3PUSA 3L8RA 3PEOA 5AQHB 2XAFB 2BS4A 1W0AA 2JIWA 2LSIA 4O4HE 5AFMA 3LFMA 2XQ7A 3AAAB 3Q2MA 3U8LA 4ZI7E 3AAIA 4HFCA 4HFIA 2KNDA 2CWOA 2WZYA 1KFYA 1US7B 4UY2A 1LRZA 1IJ6A 2CBJA 3V5UA 2K3WA 1UURA 3AB3B 5JDFA 4Z8XA 4B6XA 3R6NA 5AQTB 3S4UA 2ZM0A 3AEBA 2LOPA 5L47A 4AFHA 1HNZT 3FZFB 5FY7A 4JV5T 5JRCB 4Z90A 3Q5DA 4X20E 3WTKA 5ABEA 3WTIA 1D0YA 4PNIA 5FVKA 2WN9A 1LVFA 2YDRA 1FIOA 4UR9A 2XNVA 1WYCA 2E9XD 5TAOA 3P4PA 5AQMB 3UU4A 3MKDA 2X00D 1Z8UA 2W63A 1J5WA 4TNWA 5KDMC 1HFAA 3UU5A 3C50A 4YSZA 4LFBT 3BQIA 1UX5A 4ILBA 3KVAA 4NXNT 1BR1A 4LF8T 4LF5T 2WP9A 3RRCA 4TWHA 3UULA 1U5PA 4P1NA 4H9RC 4EV6A 4QH1A 2FJDA 2XTLA 2KMFA 5LP6E 3RIFA 4X1YE 3MJXA 4HWIB 2XSAA 1N36T 5ABFA 2PG8A 1MIYA 2E9XA 4KBMB 5AFLA 4MLKA 2I0MA 4IIJE 4BJNA 4CI1B 4HKAA 4AI6A 1WR6A 1N34T 2FUPA 2JMHA 3ZKRA 2ACXA 3AE8A 2EHOB 4V1Av 5F3JA 3FXEB 2J4GA 2K48A 5HXHA 2OA5A 2UZ6A 4AKGA 3C64A 5JR9A 3IGQA 4UVCB 4O4LE 5JREA 4QHOA 3OBVE 1WCRA 5IWAT 2JQQA 1UX4A 2CHNA 2X0LB 1J1JA 3F31A 4JI7T 1D1BA 5LCYA 3SH1A 3ONJA 5LNKA 3G06A 4UELA 2N1GA 5LJNA 3Q5EA 3ZT5A 5AQFB 2M6IA 3C79A 2Y54A 4MHCA 5JVDE 5LA6E 3N9PA 4GKKT 3DJBA 2NW9A 3C98B 4LMJA 2BS3A 4UF0B 3P4SA 3HA4A 4JI1T 2VVNA 4IL9A 3PJAA 3ZMSB 4EEDA 3AE9A 3CX8B 3T1YT 5HXRA 1ZOYA 2ZMAA 1M7KA 3ZC0A 5HEJA 2AXDS 2WAUA 4UVAB 3IHRA 5JDQA 2BYQA 2LOSA 2BDEA 1XDPA 2IW5B 2KXPB 2X68A 2VKHA 4AFTA 4I4TE 1XZYA 1D0XA 1XMOT 5KXJA 2FJEA 5EK2A 2CPTA 2LM9A 2XAJB 3OYZA 4J2CA 4NUVA 3PJAJ 3N2OA 4HWHA 4O2BE 3ZLIA 4JI6T 1T72A 3PUVF 3ZYMA 4IT4A 4PFOA 2LKGA 3PU3A 2Y8DA 4KI0F 5FYMA 3P4QA 4HFDA 2DWGA 2WDRA 3ZPOA 5GONE 3NBXX 3RRWA 2Y57A
chains in the Genus database with same CATH topology
5HEUA 2YMEA 4IREA 4QAAA 5AFKA 4TNWA 4BFQA 4LMKA 2Y58A 3TLTA 3UU5A 3RI5A 3UQ4A 3U8NA 1OEDA 4TNVA 4X5TA 3SIOA 5AFNA 2PH9A 4UM1A 4XHEA 4ILBA 3TLWA 3RQUA 4D01A 2BYRA 4A98A 2W8FA 4DBMA 3SQ6A 3EI0A 3C79A 4HFBA 2M6IA 3TLVA 2C9TA 2Y54A 5AFMB 4ILCA 2QC1B 2BG9A 5AINA 4ALXA 2XQ3A 3WTMA 5LXBA 3JADA 3WTOA 4NZBA 3RHWA 2XYSA 5LG3A 4XK9A 3TLSA 4B5DA 2PGZA 3WTJA 2X00A 4LMJA 1OEDE 4IL4A 5FJVA 1OEDC 3C84A 4ZRUA 4ZJTA 5IUXA 2BJ0A 3UU6A 4TWHA 3UUBA 4ZZBA 2XQ6A 4HFEA 2WNJA 5J5GA 4QH1A 2W8GA 2BG9E 4IL9A 2BG9C 5HEGA 3RIAA 4FRRA 3U8MA 3RIFA 2XYTA 2XQ8A 1UV6A 2BR8A 4HFHA 4Z91A 3PMZA 2XQAA 3PEOA 3U8KA 5BRXA 5L4HA 1I9BA 2XQ9A 5KE4A 3UQ7A 5HEJA 2KSRA 2LM2A 4QH5A 2BYQA 5SYOA 5AFLA 2WNLA 4PIRA 5AFMA 2XQ7A 3LSVA 3U8LA 4BQTA 2XZ6A 5HEHA 5HEOA 4HFCA 5BP0A 3GUAA 3T4MA 5J5IA 5J5HA 4LMLA 3TLUA 2BYNA 4HFIA 4TWDA 2WZYA 3WTLA 4ILAA 3P50A 3ZKRA 4AFTA 4F8HA 2YMDA 4UM3P 4UY2A 4AFGA 3ZDHA 2YN6A 2ZJUA 2WNCA 3JAFA 2BYSA 3JAEA 2Y7YA 4UM3A 4HQPA 2BYPA 3SQ9A 2ZJVA 2XNTA 1OEDB 2VL0A 2BR7A 5JMEA 3P4WA 2UZ6A 5KZUA 3WIPA 5J5FA 2Y56A 5L47A 2LLYA 4AFHA 3IGQA 4TWFA 4ZK4A 5CO5A 4UXUA 5J0ZA 2XQ4A 2LKGA 3EHZA 3UU3A 5CFBA 1UX2A 5BW2A 4QABA 3WTNA 2BG9B 5HCMA 4Z90A 5L4EA 4WV9A 4COFA 3ZDGA 2XZ5A 3WTKA 2YKSA 2LKHA 2XNUA 3WTIA 5AFHA 4ZR6A 2M6BA 2WN9A 5AFJA 3EAMA 3RQWA 2MAWA 4QH4A 4A97A 4HFDA 4UM3S 5TVCA 3U8JA 2XQ5A 2XNVA 4EZ1A 1UW6A 5HCJA 2YOEA 3UU8A 3UU4A 4ZJSA 4ZK1A 2X00D 4QACA 4NPPA 3SH1A 3WTHA 4ZZCA 2Y57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEU A;  2YME A;  4IRE A;  4QAA A;  5AFK A;  4TNW A;  4BFQ A;  4LMK A;  2Y58 A;  3TLT A;  3UU5 A;  3RI5 A;  3UQ4 A;  3U8N A;  1OED A;  4TNV A;  4X5T A;  3SIO A;  5AFN A;  2PH9 A;  4UM1 A;  4XHE A;  4ILB A;  3TLW A;  3RQU A;  4D01 A;  2BYR A;  4A98 A;  2W8F A;  4DBM A;  3SQ6 A;  3EI0 A;  3C79 A;  4HFB A;  2M6I A;  3TLV A;  2C9T A;  2Y54 A;  5AFM B;  4ILC A;  2QC1 B;  2BG9 A;  5AIN A;  4ALX A;  2XQ3 A;  3WTM A;  5LXB A;  3JAD A;  3WTO A;  4NZB A;  3RHW A;  2XYS A;  5LG3 A;  4XK9 A;  3TLS A;  4B5D A;  2PGZ A;  3WTJ A;  2X00 A;  4LMJ A;  1OED E;  4IL4 A;  5FJV A;  1OED C;  3C84 A;  4ZRU A;  4ZJT A;  5IUX A;  2BJ0 A;  3UU6 A;  4TWH A;  3UUB A;  4ZZB A;  2XQ6 A;  4HFE A;  2WNJ A;  5J5G A;  4QH1 A;  2W8G A;  2BG9 E;  4IL9 A;  2BG9 C;  5HEG A;  3RIA A;  4FRR A;  3U8M A;  3RIF A;  2XYT A;  2XQ8 A;  1UV6 A;  2BR8 A;  4HFH A;  4Z91 A;  3PMZ A;  2XQA A;  3PEO A;  3U8K A;  5BRX A;  5L4H A;  1I9B A;  2XQ9 A;  5KE4 A;  3UQ7 A;  5HEJ A;  2KSR A;  2LM2 A;  4QH5 A;  2BYQ A;  5SYO A;  5AFL A;  2WNL A;  4PIR A;  5AFM A;  2XQ7 A;  3LSV A;  3U8L A;  4BQT A;  2XZ6 A;  5HEH A;  5HEO A;  4HFC A;  5BP0 A;  3GUA A;  3T4M A;  5J5I A;  5J5H A;  4LML A;  3TLU A;  2BYN A;  4HFI A;  4TWD A;  2WZY A;  3WTL A;  4ILA A;  3P50 A;  3ZKR A;  4AFT A;  4F8H A;  2YMD A;  4UM3 P;  4UY2 A;  4AFG A;  3ZDH A;  2YN6 A;  2ZJU A;  2WNC A;  3JAF A;  2BYS A;  3JAE A;  2Y7Y A;  4UM3 A;  4HQP A;  2BYP A;  3SQ9 A;  2ZJV A;  2XNT A;  1OED B;  2VL0 A;  2BR7 A;  5JME A;  3P4W A;  2UZ6 A;  5KZU A;  3WIP A;  5J5F A;  2Y56 A;  5L47 A;  2LLY A;  4AFH A;  3IGQ A;  4TWF A;  4ZK4 A;  5CO5 A;  4UXU A;  5J0Z A;  2XQ4 A;  2LKG A;  3EHZ A;  3UU3 A;  5CFB A;  1UX2 A;  5BW2 A;  4QAB A;  3WTN A;  2BG9 B;  5HCM A;  4Z90 A;  5L4E A;  4WV9 A;  4COF A;  3ZDG A;  2XZ5 A;  3WTK A;  2YKS A;  2LKH A;  2XNU A;  3WTI A;  5AFH A;  4ZR6 A;  2M6B A;  2WN9 A;  5AFJ A;  3EAM A;  3RQW A;  2MAW A;  4QH4 A;  4A97 A;  4HFD A;  4UM3 S;  5TVC A;  3U8J A;  2XQ5 A;  2XNV A;  4EZ1 A;  1UW6 A;  5HCJ A;  2YOE A;  3UU8 A;  3UU4 A;  4ZJS A;  4ZK1 A;  2X00 D;  4QAC A;  4NPP A;  3SH1 A;  3WTH A;  4ZZC A;  2Y57 A; 
#chains in the Genus database with same CATH topology
 4Q25 A;  4JI8 T;  2VKO A;  3QK6 A;  5JDH A;  1X9B A;  2CLY C;  4ILC A;  2W4X A;  5LGT B;  2PFV A;  2CBI A;  1YQ4 A;  4AKH A;  2UUC T;  5AQR B;  2PGZ A;  3WTJ A;  1G73 A;  5FJV A;  4DR7 T;  2NWB A;  2BG9 E;  2JQH A;  4PK4 A;  5ABF B;  3M65 A;  3U8M A;  2XQ8 A;  1HX1 B;  5L4H A;  2XQ9 A;  4ZOL E;  1WYB A;  5FXW A;  1KF6 A;  4PIR A;  2JQK A;  4DO0 A;  4DV7 T;  4LML A;  4JI0 T;  1CHU A;  3WTL A;  3PUR A;  4XBF B;  2JRK A;  4H63 V;  4X62 T;  2ACZ A;  2XAQ B;  4FI5 A;  1N33 T;  2YDQ A;  2YK0 A;  3BQL A;  2WQY A;  3N5L A;  3AE4 A;  5JH7 E;  2X9X A;  2IC9 A;  3EHZ A;  5BW2 A;  5J2U E;  3ZDG A;  4HFV A;  2CWY A;  4ADZ A;  5H6Q B;  3UTK A;  4OFZ A;  3MK7 C;  2UUB T;  3U8J A;  5L3D B;  5HCJ A;  3D0T A;  1FMW A;  4TV8 E;  4ZZC A;  5AFK A;  4QX8 B;  3AXJ A;  1E7P A;  4E7Z A;  4ZI3 C;  2GK9 A;  3Q5W A;  4XHE A;  4A98 A;  5L3E B;  2D0U A;  3E22 E;  5JRC A;  4AQG A;  5AIN A;  1KNZ A;  2XQ3 A;  3WTM A;  3JCF A;  5FL1 A;  4DR2 T;  2P9B A;  3PUG A;  3SRZ A;  3CVR A;  3SWH A;  5ADX L;  2J1D G;  3NZP A;  1N32 T;  2LEH A;  2WU2 A;  4OK0 A;  2CM0 A;  4O8S A;  1T98 A;  1IZN B;  2LRL A;  2CHO A;  4NIQ A;  3IA3 A;  3AEC A;  4K0K T;  1R8I A;  2FBW A;  4H9P C;  2EHO D;  3NRY A;  2XAH B;  5J5I A;  3TLU A;  3WI3 A;  2XY8 B;  2RPA A;  1D0Z A;  3U78 A;  4I0U A;  2YMD A;  2CLY B;  3KDS E;  3MAC A;  3JAF A;  4PJL A;  3SQ9 A;  3H3M A;  4DBQ A;  3CPZ A;  1JNZ A;  3QUJ A;  4DUY T;  2UU9 T;  4ZEY A;  1KNR A;  2X0Y A;  3X1D A;  1H7C A;  4COF A;  4EXT A;  5AQJ B;  5AFH A;  5LG4 A;  2BZB A;  3RQW A;  1YXR A;  2E5L T;  2VQF T;  2BS2 A;  3C4W A;  3AA0 B;  4EZ1 A;  4IE4 A;  3ZSS A;  2RP4 A;  2QA7 A;  3UU8 A;  1I6Z A;  3RKO A;  2WY2 A;  2EHO A;  4CN1 A;  3WTH A;  1E2A A;  4WBN E;  4IRE A;  2VB6 A;  4H9O C;  1XNQ T;  4DMW A;  4DR5 T;  4IDO A;  2QYW A;  3N9Q A;  2W0G A;  3O1J A;  5L3G B;  3KV9 A;  4I55 E;  5A1L A;  2QC1 B;  3VHL A;  3WTO A;  2UXX B;  3PUQ A;  4XK9 A;  3HR0 A;  4B5D A;  4YTP A;  1IJ5 A;  3ZN1 B;  5AQI B;  3CKD A;  2BVL A;  3ZYL A;  2CEA A;  2E5V A;  5LXT E;  3K3N A;  4PAG A;  2V7K A;  4U7I A;  4X1I E;  4FRR A;  2X0H A;  2LT3 A;  4OYJ A;  5CB4 E;  5C8Y E;  3W15 B;  2CXF A;  2C5J A;  2M67 A;  3TKL B;  3QOF A;  2V6Y B;  4UF0 A;  1YQ3 A;  2V6X A;  5FXZ A;  2YN6 A;  5AQU B;  3LG7 A;  1ZHC A;  4DMV A;  4UM3 A;  2JQ9 A;  4EYY R;  3AEA A;  2BR7 A;  2XHE B;  2YU1 A;  4EZH A;  2H3R A;  3A8Y C;  2UXC T;  1D1C A;  2OV9 A;  4G2A A;  3N9N A;  5EK4 A;  4P0A A;  1V9D A;  2V7M A;  5FXV A;  3A7M A;  3ZMU B;  3CIR A;  2LHR A;  2NR4 A;  2IIU A;  2FJA A;  3V5S A;  3AA6 B;  3SOL A;  5M4Y A;  3AXJ B;  2D5U A;  3LDQ B;  4YSX A;  4ZHQ E;  5DQV A;  5EZY E;  3AE2 A;  5AFN A;  3AA7 B;  5BR8 T;  4DUZ T;  5JQG E;  3HL6 A;  4ALX A;  2LHN A;  5DAB A;  4I43 B;  4O4I E;  1BR0 A;  1OED E;  1W9R A;  2A2F X;  2IML A;  3N9L A;  1X79 A;  1S94 A;  4HFE A;  2BBJ A;  3DP7 A;  4EZ4 A;  3AEE A;  2BG9 C;  1MMA A;  2UUA T;  2MOZ A;  2ODU A;  2KWH A;  1IBM T;  2WU5 A;  2VKD A;  4TX5 A;  1HCI A;  2KSR A;  3MXZ A;  5SYO A;  3GN5 B;  4CN4 A;  5HYA A;  2DNX A;  2XZ6 A;  4EAH A;  4A56 A;  3RIU A;  4AFG A;  3ZDH A;  2IDO B;  3LJC A;  3KBT A;  2F4V T;  2VL8 A;  2WNC A;  4YHJ A;  1Y64 B;  2MYS A;  4U74 A;  4EEB A;  3AE7 A;  3EUH A;  3RYC E;  4TV9 E;  3WTN A;  2E2A A;  3J9X 1;  2CA5 A;  3KBU A;  3RF1 A;  2WSS V;  4YJ3 E;  2MTQ A;  3QNU A;  3P4R A;  2LSG A;  3CK6 A;  4QAC A;  1YW0 A;  3RIU C;  4LF4 T;  2Y58 A;  2XSB A;  3VU7 H;  4DV3 T;  3H37 A;  5J1G A;  4XZC A;  4EIW A;  3RQU A;  2BKO A;  2NP9 A;  3TLV A;  2V5C A;  3AE3 A;  3JAD A;  3RHW A;  2WZH A;  4MFR A;  1HG2 A;  2DWK A;  3C4Z A;  4AIU A;  4X65 T;  4DVD A;  4IE0 A;  4CN6 A;  2W8G A;  4DR1 T;  5LMU T;  4BAY B;  4U31 A;  2G0U A;  5LB7 B;  1I9B A;  2B1E A;  5KE4 A;  1QUU A;  2DL1 A;  3IEE A;  5AQK B;  1FMV A;  4HN9 A;  5C2T A;  2Y6X A;  2LSY A;  3NRX A;  1VCT A;  3J7Y q;  4GOU A;  2VK9 A;  4EGW A;  4PW8 A;  4PK6 A;  3I9W A;  2H7V C;  2KZ7 B;  4DV4 T;  4BJM A;  3LK3 B;  2ZJU A;  4KHZ F;  2BYS A;  1M62 A;  2Y7Y A;  2Y48 B;  5FP3 A;  4AXP A;  1W09 A;  4BA9 A;  3I0O A;  2LLY A;  5CO5 A;  5J0Z A;  2BG9 B;  2NOX A;  3F2E A;  1WFD A;  3H3A A;  4ZR6 A;  3P7I A;  1SE7 A;  5KMG P;  4DV1 T;  4QH4 A;  4A97 A;  4UM3 S;  4OX9 T;  2XQ5 A;  5FNV E;  4YTN A;  4EOZ B;  3ZST A;  4HWC A;  3FBL A;  4GYS A;  5H6R B;  5LBQ B;  4CI2 B;  3KIN B;  3U8N A;  4IDN A;  4JLE A;  4L5G A;  2VUR A;  3CWZ B;  4DBM A;  3SFE A;  2VWA A;  1T8B A;  2IAK A;  4H9N C;  5AQV B;  4OYK A;  3C84 A;  2BVM A;  3UU6 A;  3UUB A;  4A5X A;  1MMN A;  1J5E T;  1OXZ A;  5HXS A;  3FHN A;  4U2Z A;  2NTY A;  2XYT A;  5LOV E;  1UV6 A;  4Z91 A;  2DLR A;  3U8K A;  4H9Q C;  4ZI3 D;  5BRX A;  2ZM2 A;  1UCU A;  2A72 A;  3U3I A;  3Q9D A;  3VKH A;  3BQK A;  1HX8 A;  1W0B A;  2WNL A;  3RC8 A;  1CUN A;  2H7O A;  3F57 A;  3FZH B;  3P50 A;  3RPU A;  5AQN B;  2V1D B;  4HE8 A;  4GK0 E;  1IBK T;  5AFU L;  2BYP A;  3N9M A;  1ZV4 X;  3WIP A;  4CI3 B;  3MA9 A;  2LSJ A;  3WAJ A;  2XNU A;  3ZT7 A;  1YKH B;  3HI2 A;  1HR0 T;  3RLF F;  2XM1 A;  2V6Y A;  2YEV C;  2WWV A;  4ISS A;  4LFA T;  2LSK A;  5FXX A;  4BFQ A;  2HHH T;  3RI5 A;  3UQ4 A;  1WR0 A;  3GA8 A;  3P8C D;  4WZX A;  2DHR A;  4HWF A;  1IBL T;  2PH9 A;  1NAF A;  3VRA A;  3QC9 A;  3ABV A;  4HFB A;  5LXB A;  3IBP A;  3ANW B;  1O3X A;  4IST A;  2XYS A;  3CX7 B;  4JI4 T;  1UUS A;  4HWD A;  2RA1 A;  4JYA T;  1OED C;  5IUX A;  4B3T T;  2IC6 A;  4YSY A;  5JDN A;  4ASK A;  1SHZ C;  3VKG A;  3Q5X A;  3PMZ A;  5AQQ B;  3FBZ A;  4KP3 C;  5JTG A;  5DQW A;  4YXD A;  4OHF A;  4EYU A;  4N78 D;  1HNW T;  3LSV A;  1KEY A;  5AQG B;  2QVA A;  3LBX B;  4KX6 A;  1XWM A;  2BYN A;  1QLB A;  5AQO B;  4F8H A;  1ZEE A;  3L3P A;  5LGU B;  3RYH E;  4QXB B;  4E7S A;  2MBG A;  2V7L A;  3OJA A;  4C90 A;  2IHR 1;  5FMN A;  5KX5 E;  4KMC A;  4AIS A;  3CML A;  3GN5 A;  1UGO A;  3O1I A;  2LKH A;  2X9H A;  3KVB A;  2KIN B;  4GYR A;  3JC6 D;  2MAW A;  1D1A A;  4XAX B;  4YJ2 E;  4IDQ A;  4ZJS A;  5IYZ E;  3L09 A;  1DU2 A;  2Q9Q B;  4LMK A;  3QB5 A;  4WNK A;  3HKD E;  4X5T A;  4I50 E;  3SIO A;  3TLW A;  3I1A A;  5HXE A;  1KK7 A;  3NZQ A;  4P0B A;  5L3C B;  5FY1 A;  1HNX T;  3SQ6 A;  2VQE T;  4MAL A;  5FVL A;  4NZB A;  4AQF A;  3OYX A;  5C3J A;  4CXY A;  3DTO A;  3HKB E;  1I94 T;  4CZZ B;  4ZXL A;  4KUM B;  2K5B B;  4HFH A;  2V7I A;  5LHH B;  1WRD A;  1E1H B;  2XPK A;  3LK2 B;  4JI2 T;  4JI5 T;  2WZI A;  3B13 A;  5LHG B;  1MNE A;  3PUA A;  4BQT A;  2XZE A;  2A3D A;  4IE7 A;  4AKI A;  3GUA A;  3PU8 A;  1XNR T;  4TWD A;  2ZM8 A;  2Z6E A;  4QXC B;  3N2K E;  3AE5 A;  2J62 A;  4AQF C;  4PFP A;  1KNP A;  3RYF E;  4O2A E;  2N2N A;  4EB6 E;  3JAE A;  2ZJV A;  4IE5 A;  3T8O A;  3AVS A;  4LF7 T;  1OED B;  5JDG A;  4AKL A;  1U4Q A;  5CA1 E;  1XDO A;  4TWF A;  3RC3 A;  3NWI A;  3ZCJ A;  4X1K E;  4QAB A;  5HCM A;  3JC6 C;  4GKJ T;  3ZYK A;  3R84 B;  3SS1 A;  2CRB A;  5AFJ A;  4G63 A;  5JDM A;  4CQI A;  3A5X A;  1UW6 A;  3FB2 A;  2YOE A;  4IE6 A;  3N9O A;  2YME A;  4U72 A;  2C5I T;  2L3L A;  4D01 A;  1QSD A;  1HS7 A;  4C91 A;  3VR8 A;  2UXB T;  2BG9 A;  1GQE A;  4DR6 T;  4LFC T;  2X51 A;  4NUU A;  4P09 A;  2VVS A;  2XQ6 A;  4YTM A;  2WNJ A;  5HEG A;  5LJM A;  1VOM A;  2XAS B;  4ZS3 A;  3IF8 B;  4L9I A;  2ZLY A;  2LM2 A;  4QH5 A;  3EVY A;  3EDU A;  4CXW A;  3ZEF B;  2D2S A;  2L9Q A;  3ETU A;  5HEH A;  2NW7 A;  2UXD T;  3FZL B;  1LVK A;  4WW0 A;  5BP0 A;  2V8S V;  4IDZ A;  3AED A;  3RGL A;  4TZ4 C;  2XM2 A;  2YDS A;  4QWN B;  4TUY E;  4DV2 T;  4HQP A;  3E0Z A;  2XNT A;  4U33 A;  2V26 A;  2VL0 A;  1MMG A;  2X9W A;  1MND A;  1EZ3 A;  5CFB A;  3ONX A;  4WV9 A;  3B5M A;  2YKS A;  3CQC B;  2WM9 A;  4YHH T;  5TVC A;  1NEK A;  1L0V A;  4QKN A;  4QAA A;  2WWU A;  2JJ9 A;  2N9D A;  2I59 A;  4O4J E;  5J2T E;  2K9A A;  3K3Q C;  3I0Q A;  4F6R C;  2BYR A;  4IDP A;  4UIG A;  1BR4 A;  1BR2 A;  2WBL A;  3PTR B;  2E8I A;  2NW8 A;  2X67 A;  5LHI B;  5LG3 A;  5L2L A;  2X00 A;  4ZJT A;  3FZK B;  2PJQ A;  3NKZ A;  3O1H A;  4YT0 A;  5HWY A;  5AQP B;  4GK5 E;  3CQG B;  4NXM T;  4K0U A;  3KFW X;  4U3C A;  5HAX A;  4B3R T;  3ANW A;  4TN7 B;  3AE6 A;  5EK3 A;  3FZM B;  4YY3 T;  2HPJ A;  5E0O A;  3ESL A;  3ZMZ B;  1HG5 A;  2E9X C;  3K8P C;  3MZK B;  3UFG A;  3ONL C;  1WLX A;  4HGA A;  1Y01 A;  3CQX C;  5JME A;  3L39 A;  3P4W A;  2ODV A;  3B57 A;  5J5F A;  2QRX A;  4ZK4 A;  5ABG A;  2XQY A;  1UX2 A;  4GIW A;  5L4E A;  1VRB A;  2XZ5 A;  1NEN A;  4AQY T;  2IUB A;  2CXL A;  2Q9Q D;  3LBX A;  2M6B A;  5F8P A;  5JR9 C;  3ETV A;  5JDL A;  2HN1 A;  4ZK1 A;  3HKE E;  2MPK A;  3AEG A;  5LMN T;  4YFS A;  3ZT6 A;  2HN2 A;  1FJG T;  3C4X A;  5AFM B;  4DID B;  3UFE A;  3T1H T;  3K1S A;  4ZS2 A;  2BKN A;  4X64 T;  3AAE B;  3AE1 A;  4M1P A;  4ZZB A;  2WCA A;  2LJL A;  4QXH B;  3ZCI A;  4YLH A;  2Q9Q A;  3KV4 A;  3ZC1 A;  2SPC A;  2W00 A;  5FL0 A;  3PUY F;  3UQ7 A;  3BK9 A;  4FJO A;  2V7J A;  4JEH B;  5HEO A;  4ANJ A;  2DCF A;  3GWH A;  3N2G E;  4UM3 P;  1B7T A;  2WS3 A;  1VCS A;  4UEM A;  4L0R A;  2KT9 A;  2R6G F;  4QX7 B;  5KZU A;  2Y56 A;  4ZI2 D;  4DV6 T;  4KHP T;  1S35 A;  2NTX A;  3OVU A;  3O9X A;  5CJ5 A;  2XQ4 A;  3GMI A;  2Q9Q C;  3WAK A;  3RYI E;  2C5K T;  2X9Y A;  4U2Y A;  1ZKE A;  1SUM B;  4JEU B;  2FJB A;  1MIV A;  2K24 A;  3EAB A;  5HXC A;  2X66 A;  4H63 H;  3KV6 A;  5L3F B;  4CXX A;  3AEF A;  3UUX B;  1XMQ T;  2PTF A;  3TLT A;  2L8K A;  4UV9 B;  5FKY A;  1OED A;  4TNV A;  2E9X B;  2W2U A;  2XJ7 A;  2XAG B;  1JNR A;  2DI4 A;  3EI0 A;  3PUX F;  2H89 A;  2JMK A;  2AE9 A;  4IL4 A;  5CA0 E;  4PJN A;  2W61 A;  4ZRU A;  2BJ0 A;  3UUM A;  2KLQ A;  3I9Y A;  5J5G A;  3O4X E;  1OWA A;  2WDQ A;  4LF6 T;  3RIA A;  2BR8 A;  3PUW F;  2XQA A;  2KWI B;  4PJM A;  5JR9 B;  4JI3 T;  2CE7 A;  4IGU A;  1HTJ F;  5ETW A;  3T4M A;  5J5H A;  4ILA A;  4DV5 T;  3OPC A;  1SA0 E;  5FY0 A;  2WMN A;  3E08 A;  2W62 A;  4ZI2 C;  4JUY A;  4JBW F;  1YD8 G;  1ZP0 A;  4UXU A;  3C51 A;  1FEW A;  4WBO A;  3M3Z B;  3VRB A;  1UK5 A;  3EAM A;  5LYJ E;  2OLT A;  3SFD A;  3ZMT B;  2D9D A;  4DBR A;  2UXN B;  4NPP A;  5HEU A;  5ABH A;  2JPF A;  1HF8 A;  1Z0P A;  2V5D A;  4UM1 A;  3CX6 B;  3QB5 K;  1G8X A;  2HH7 A;  5L3B B;  2C9T A;  3HKC E;  5F5W A;  3KV5 A;  3ZJ2 A;  1AJ3 A;  3OTO T;  3RKG A;  4IHJ E;  2CCQ A;  4UVB B;  4HEA A;  4B3M T;  5HWX A;  2C0S A;  2ES0 A;  4DR3 T;  2ZM6 T;  2YIN A;  3RX6 A;  2WMO A;  2BKP A;  2H88 A;  2LE8 A;  2CXD A;  4H9S E;  5BMV E;  4AKR B;  4MBQ A;  2WB5 A;  2XUE A;  3UUN A;  3UT5 E;  4X66 T;  2J47 A;  2QGS A;  5AQL B;  2BBH A;  3AVR A;  1NWM X;  3PE0 A;  4UXN B;  2HPL A;  4UV8 B;  2I6H A;  2VAS A;  3FXD B;  3OKQ A;  5DJQ C;  3ZMV B;  1MMD A;  3UU3 A;  2VKJ A;  1YKE B;  3EDV A;  5LGN B;  5AQS B;  2YU2 A;  3NVO A;  2W67 A;  4WYV A;  4U7Y A;  4ERR A;  2LRK A;  4DND A;  2B76 A;  2PBI A;  5CGM A;  4B3S T;  1IAP A;  3K3O A;  4DV0 T;  2D0T A;  3RH3 A;  4LF9 T;  1LKX A;  3PV0 F;  4PJJ A;  2W8F A;  2A9U A;  3PDY A;  3VR9 A;  4HTE A;  2WDV A;  3PUZ F;  2EHO C;  5LBM A;  3AA1 B;  4DR4 T;  4PK5 A;  3TLS A;  2W66 A;  4ILU A;  2CMR A;  1T7S A;  3ZJ1 A;  3ZN0 B;  3LK4 2;  1MIW A;  5IHY A;  3PUS A;  3L8R A;  3PEO A;  5AQH B;  2XAF B;  2BS4 A;  1W0A A;  2JIW A;  2LSI A;  4O4H E;  5AFM A;  3LFM A;  2XQ7 A;  3AAA B;  3Q2M A;  3U8L A;  4ZI7 E;  3AAI A;  4HFC A;  4HFI A;  2KND A;  2CWO A;  2WZY A;  1KFY A;  1US7 B;  4UY2 A;  1LRZ A;  1IJ6 A;  2CBJ A;  3V5U A;  2K3W A;  1UUR A;  3AB3 B;  5JDF A;  4Z8X A;  4B6X A;  3R6N A;  5AQT B;  3S4U A;  2ZM0 A;  3AEB A;  2LOP A;  5L47 A;  4AFH A;  1HNZ T;  3FZF B;  5FY7 A;  4JV5 T;  5JRC B;  4Z90 A;  3Q5D A;  4X20 E;  3WTK A;  5ABE A;  3WTI A;  1D0Y A;  4PNI A;  5FVK A;  2WN9 A;  1LVF A;  2YDR A;  1FIO A;  4UR9 A;  2XNV A;  1WYC A;  2E9X D;  5TAO A;  3P4P A;  5AQM B;  3UU4 A;  3MKD A;  2X00 D;  1Z8U A;  2W63 A;  1J5W A;  4TNW A;  5KDM C;  1HFA A;  3UU5 A;  3C50 A;  4YSZ A;  4LFB T;  3BQI A;  1UX5 A;  4ILB A;  3KVA A;  4NXN T;  1BR1 A;  4LF8 T;  4LF5 T;  2WP9 A;  3RRC A;  4TWH A;  3UUL A;  1U5P A;  4P1N A;  4H9R C;  4EV6 A;  4QH1 A;  2FJD A;  2XTL A;  2KMF A;  5LP6 E;  3RIF A;  4X1Y E;  3MJX A;  4HWI B;  2XSA A;  1N36 T;  5ABF A;  2PG8 A;  1MIY A;  2E9X A;  4KBM B;  5AFL A;  4MLK A;  2I0M A;  4IIJ E;  4BJN A;  4CI1 B;  4HKA A;  4AI6 A;  1WR6 A;  1N34 T;  2FUP A;  2JMH A;  3ZKR A;  2ACX A;  3AE8 A;  2EHO B;  4V1A v;  5F3J A;  3FXE B;  2J4G A;  2K48 A;  5HXH A;  2OA5 A;  2UZ6 A;  4AKG A;  3C64 A;  5JR9 A;  3IGQ A;  4UVC B;  4O4L E;  5JRE A;  4QHO A;  3OBV E;  1WCR A;  5IWA T;  2JQQ A;  1UX4 A;  2CHN A;  2X0L B;  1J1J A;  3F31 A;  4JI7 T;  1D1B A;  5LCY A;  3SH1 A;  3ONJ A;  5LNK A;  3G06 A;  4UEL A;  2N1G A;  5LJN A;  3Q5E A;  3ZT5 A;  5AQF B;  2M6I A;  3C79 A;  2Y54 A;  4MHC A;  5JVD E;  5LA6 E;  3N9P A;  4GKK T;  3DJB A;  2NW9 A;  3C98 B;  4LMJ A;  2BS3 A;  4UF0 B;  3P4S A;  3HA4 A;  4JI1 T;  2VVN A;  4IL9 A;  3PJA A;  3ZMS B;  4EED A;  3AE9 A;  3CX8 B;  3T1Y T;  5HXR A;  1ZOY A;  2ZMA A;  1M7K A;  3ZC0 A;  5HEJ A;  2AXD S;  2WAU A;  4UVA B;  3IHR A;  5JDQ A;  2BYQ A;  2LOS A;  2BDE A;  1XDP A;  2IW5 B;  2KXP B;  2X68 A;  2VKH A;  4AFT A;  4I4T E;  1XZY A;  1D0X A;  1XMO T;  5KXJ A;  2FJE A;  5EK2 A;  2CPT A;  2LM9 A;  2XAJ B;  3OYZ A;  4J2C A;  4NUV A;  3PJA J;  3N2O A;  4HWH A;  4O2B E;  3ZLI A;  4JI6 T;  1T72 A;  3PUV F;  3ZYM A;  4IT4 A;  4PFO A;  2LKG A;  3PU3 A;  2Y8D A;  4KI0 F;  5FYM A;  3P4Q A;  4HFD A;  2DWG A;  2WDR A;  3ZPO A;  5GON E;  3NBX X;  3RRW A;  2Y57 A; 
#chains in the Genus database with same CATH homology
 5HEU A;  2YME A;  4IRE A;  4QAA A;  5AFK A;  4TNW A;  4BFQ A;  4LMK A;  2Y58 A;  3TLT A;  3UU5 A;  3RI5 A;  3UQ4 A;  3U8N A;  1OED A;  4TNV A;  4X5T A;  3SIO A;  5AFN A;  2PH9 A;  4UM1 A;  4XHE A;  4ILB A;  3TLW A;  3RQU A;  4D01 A;  2BYR A;  4A98 A;  2W8F A;  4DBM A;  3SQ6 A;  3EI0 A;  3C79 A;  4HFB A;  2M6I A;  3TLV A;  2C9T A;  2Y54 A;  5AFM B;  4ILC A;  2QC1 B;  2BG9 A;  5AIN A;  4ALX A;  2XQ3 A;  3WTM A;  5LXB A;  3JAD A;  3WTO A;  4NZB A;  3RHW A;  2XYS A;  5LG3 A;  4XK9 A;  3TLS A;  4B5D A;  2PGZ A;  3WTJ A;  2X00 A;  4LMJ A;  1OED E;  4IL4 A;  5FJV A;  1OED C;  3C84 A;  4ZRU A;  4ZJT A;  5IUX A;  2BJ0 A;  3UU6 A;  4TWH A;  3UUB A;  4ZZB A;  2XQ6 A;  4HFE A;  2WNJ A;  5J5G A;  4QH1 A;  2W8G A;  2BG9 E;  4IL9 A;  2BG9 C;  5HEG A;  3RIA A;  4FRR A;  3U8M A;  3RIF A;  2XYT A;  2XQ8 A;  1UV6 A;  2BR8 A;  4HFH A;  4Z91 A;  3PMZ A;  2XQA A;  3PEO A;  3U8K A;  5BRX A;  5L4H A;  1I9B A;  2XQ9 A;  5KE4 A;  3UQ7 A;  5HEJ A;  2KSR A;  2LM2 A;  4QH5 A;  2BYQ A;  5SYO A;  5AFL A;  2WNL A;  4PIR A;  5AFM A;  2XQ7 A;  3LSV A;  3U8L A;  4BQT A;  2XZ6 A;  5HEH A;  5HEO A;  4HFC A;  5BP0 A;  3GUA A;  3T4M A;  5J5I A;  5J5H A;  4LML A;  3TLU A;  2BYN A;  4HFI A;  4TWD A;  2WZY A;  3WTL A;  4ILA A;  3P50 A;  3ZKR A;  4AFT A;  4F8H A;  2YMD A;  4UM3 P;  4UY2 A;  4AFG A;  3ZDH A;  2YN6 A;  2ZJU A;  2WNC A;  3JAF A;  2BYS A;  3JAE A;  2Y7Y A;  4UM3 A;  4HQP A;  2BYP A;  3SQ9 A;  2ZJV A;  2XNT A;  1OED B;  2VL0 A;  2BR7 A;  5JME A;  3P4W A;  2UZ6 A;  5KZU A;  3WIP A;  5J5F A;  2Y56 A;  5L47 A;  2LLY A;  4AFH A;  3IGQ A;  4TWF A;  4ZK4 A;  5CO5 A;  4UXU A;  5J0Z A;  2XQ4 A;  2LKG A;  3EHZ A;  3UU3 A;  5CFB A;  1UX2 A;  5BW2 A;  4QAB A;  3WTN A;  2BG9 B;  5HCM A;  4Z90 A;  5L4E A;  4WV9 A;  4COF A;  3ZDG A;  2XZ5 A;  3WTK A;  2YKS A;  2LKH A;  2XNU A;  3WTI A;  5AFH A;  4ZR6 A;  2M6B A;  2WN9 A;  5AFJ A;  3EAM A;  3RQW A;  2MAW A;  4QH4 A;  4A97 A;  4HFD A;  4UM3 S;  5TVC A;  3U8J A;  2XQ5 A;  2XNV A;  4EZ1 A;  1UW6 A;  5HCJ A;  2YOE A;  3UU8 A;  3UU4 A;  4ZJS A;  4ZK1 A;  2X00 D;  4QAC A;  4NPP A;  3SH1 A;  3WTH A;  4ZZC A;  2Y57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...