3LSVA

Structure of the a237f mutant of the pentameric ligand gated ion channel from gloeobacter violaceus
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Ligand-gated ion channel
publication title One-microsecond molecular dynamics simulation of channel gating in a nicotinic receptor homologue.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 99
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3lsvA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3lsvA01
4ILCA 3WTKA 3RIAA 3UU8A 2C9TA 4UM3A 2BYSA 3P50A 4XHEA 5CO5A 1UW6A 4A98A 4HFHA 3UU6A 3PMZA 4HFIA 2QC1B 5HEGA 4QH4A 3C79A 3C84A 2MAWA 2BYPA 4D01A 5LG3A 4QACA 5HCMA 5HEOA 2M6BA 4IREA 2ZJUA 4UM1A 2XQ9A 4COFA 2LKHA 5BP0A 5KZUA 2Y56A 3SH1A 3UUBA 5AFKA 1UV6A 4BQTA 3TLTA 4IL4A 3EAMA 4DBMA 4ZRUA 2XYTA 2YMDA 2XNVA 2XZ6A 4F8HA 4TNVA 4PIRA 4LMLA 5L4HA 3UU5A 4FRRA 2XQ4A 3TLSA 5L4EA 4Z91A 2WNJA 3WTHA 5J5FA 4ZR6A 2YOEA 3LSVA 3JAEA 2M6IA 2BR7A 4QH5A 3RQWA 2X00A 2BYRA 3WIPA 5TVCA 4AFHA 5AFMA 5KE4A 3IGQA 2LM2A 5J5IA 4TNWA 2KSRA 4LMKA 2Y58A 2WNLA 3U8LA 3TLVA 5SYOA 3PEOA 4BFQA 1OEDA 2XQAA 2Y57A 3UU4A 5HEUA 1OEDC 2WNCA 4NZBA 2YMEA 2XQ5A 4UM3S 2Y7YA 2ZJVA 5CFBA 5BRXA 2YN6A 5AFHA 5L47A 2XQ3A 3ZKRA 2BG9C 3SIOA 2XQ8A 1UX2A 2W8FA 3UQ4A 3JAFA 4HFCA 4NPPA 5HCJA 2BR8A 2BYQA 4QABA 5J5HA 4ZJSA 3TLUA 2WN9A 4IL9A 2PGZA 4QAAA 4LMJA 4Z90A 4UY2A 5FJVA 2YKSA 4HFEA 4TWFA 2W8GA 5AFMB 3RQUA 2XYSA 4AFTA 3RIFA 3U8JA 3RHWA 3RI5A 4ZK4A 4UXUA 4ZK1A 5AFNA 4TWHA 3WTOA 4B5DA 4UM3P 3TLWA 3WTMA 3WTJA 3UU3A 1OEDB 1OEDE 3WTIA 5BW2A 3GUAA 2LLYA 5J5GA 2XQ6A 5HEHA 3T4MA 5IUXA 4EZ1A 2BG9B 2BG9E 2BG9A 2LKGA 3EHZA 4A97A 4WV9A 5J0ZA 1I9BA 4XK9A 3SQ9A 3ZDHA 2X00D 2XNUA 4ZZBA 2VL0A 4X5TA 2WZYA 3ZDGA 4AFGA 4ALXA 4ZJTA 4HQPA 5HEJA 3U8NA 3UQ7A 2XQ7A 3WTNA 4TWDA 2PH9A 5LXBA 5AFJA 5AINA 5AFLA 4HFBA 4HFDA 4ILBA 4ILAA 3JADA 2XNTA 5JMEA 3SQ6A 2BYNA 3WTLA 4QH1A 3EI0A 3U8MA 3P4WA 2BJ0A 2Y54A 3U8KA 2UZ6A 2XZ5A 4ZZCA
chains in the Genus database with same CATH superfamily
2ES0A 2VASA 3FXDB 1YKHB 2QGSA 3HKEE 5JDMA 4U33A 3N9PA 5DQVA 3CMLA 1XWMA 4BJNA 3AXJA 2H3RA 4TX5A 3UUBA 4UF0A 4DNDA 3C98B 1D1BA 3EAMA 2CPTA 4HN9A 3ABVA 2VKOA 2XQ4A 5L4EA 1KNRA 3AEAA 2WNJA 3L09A 3FBLA 2YOEA 3ZMVB 3R6NA 2KZ7B 4ZHQE 4L5GA 3H3MA 3AXJB 3MXZA 4DV0T 3FZMB 4UF0B 4OYKA 3VRBA 2Y57A 4OK0A 4QXCB 4HWHA 3ZSSA 2W0GA 1ZOYA 2E9XD 2WZIA 4UVCB 1HTJF 3JAFA 3RLFF 3RKGA 1MMGA 4U31A 3TLUA 2IIUA 2UU9T 2LJLA 4ZOLE 2W63A 5JH7E 4AQGA 4IE7A 3L3PA 4TN7B 2WDRA 5IUXA 4EZ1A 4V1Av 1G73A 3C50A 5L3FB 1J5WA 5DABA 1E2AA 4PK5A 4LFCT 4PJNA 2E9XC 2XAJB 4NXNT 4H9RC 2HPLA 4LF9T 2FJEA 2YDSA 3AA6B 4KMCA 3OVUA 3AAIA 1Z0PA 2V7KA 2WZHA 3KV4A 2W66A 4DUZT 4X1YE 2QC1B 5BP0A 2HH7A 3RIUA 4YTPA 3K8PC 2PFVA 3N9MA 3NRXA 5EK3A 2Y6XA 5AQNB 4ADZA 3RH3A 4EYUA 2LE8A 4BA9A 3PU3A 1FIOA 3JAEA 3HL6A 4YT0A 3WIPA 2P9BA 2X66A 3U3IA 5J5IA 2XUEA 4I55E 1DU2A 3UUXB 4CN6A 2GK9A 4O2BE 5AFHA 1FJGT 1WLXA 1WR0A 5HCJA 3HI2A 4UY2A 5FP3A 4X66T 4U2ZA 4I43B 3FZKB 4IE5A 4ZK1A 2YK0A 3NKZA 1IBLT 4AKIA 2C0SA 2LLYA 3FB2A 3EDUA 2V26A 2XSAA 2X00D 4YTMA 4AFGA 4OYJA 1XNRT 4WZXA 1FEWA 2D0UA 5LJMA 2WWVA 5LXBA 4HFDA 2ZLYA 3JADA 5EZYE 3EI0A 1LRZA 4O4HE 3ZC1A 3I1AA 5EK2A 1FMVA 3WTKA 1T8BA 1NAFA 3O4XE 5CO5A 2XTLA 1HR0T 4IHJE 4QH4A 1CHUA 2LSKA 4B3TT 4UV8B 4COFA 3JC6C 4JI0T 2E5VA 4HKAA 2LOSA 4P0BA 3EABA 2XASB 2YMDA 2G0UA 4F8HA 1J5ET 5L4HA 5FY7A 1ZEEA 1HS7A 4HTEA 4EOZB 5KX5E 3LSVA 1HF8A 1N34T 3JCFA 4JI7T 4GK5E 2XAHB 3LFMA 4IT4A 5AQOB 1KNPA 2CRBA 1UX2A 2Z6EA 1GQEA 4X1KE 2ZMAA 4H9QC 2WN9A 4IL9A 3KV5A 3ONJA 2JRKA 4AFTA 2QRXA 2K24A 5AQRB 3N2GE 4HFVA 2IDOB 2CCQA 3P4PA 1WCRA 3OBVE 5HXCA 5KMGP 4GK0E 1YXRA 3DP7A 3OKQA 1KEYA 4X1IE 4ZJTA 4HQPA 3UQ7A 2CE7A 3J9X1 4PJJA 2BBJA 5AINA 2X67A 4YJ3E 4LF7T 4X20E 2VKDA 3J7Yq 2UZ6A 2H7VC 5C2TA 3QNUA 4OFZA 2C9TA 3D0TA 1B7TA 1HG2A 3C4ZA 3PUZF 4H9SE 4DVDA 2WMNA 2EHOB 4D01A 5FXZA 5HCMA 4B3ST 1HNWT 3ZYMA 2WQYA 4PAGA 5FVKA 2LHNA 1SA0E 4K0KT 1AJ3A 3RYIE 4IGUA 5HWXA 4DV3T 3CPZA 3C4XA 3SOLA 4ISTA 4LF5T 2X00A 5AFUL 2WCAA 1SUMB 1G8XA 3IGQA 5CA0E 2KT9A 1MIWA 3WAJA 5LB7B 2E8IA 5F5WA 2BBHA 4DV5T 2YU2A 4PJLA 4NPPA 4KHPT 4QAAA 2HHHT 4KBMB 2X9YA 3CX7B 1T72A 2W62A 3ZLIA 2VKHA 3RRCA 4LFAT 1M62A 2YDQA 3QC9A 3F31A 5CA1E 5BW2A 3BQIA 2AXDS 4P0AA 4U2YA 3ZEFB 3ZMTB 2A3DA 5IYZE 2FBWA 1X9BA 3P7IA 4LFBT 5J2UE 2JQKA 3CX6B 4QH1A 2X9HA 5L3EB 3CKDA 4I50E 3NBXX 3AVRA 3HKBE 5JDQA 4IDOA 3LK3B 3RPUA 3UU6A 3C79A 3SFEA 3ZMZB 2NTYA 4AXPA 3PUQA 2D5UA 1SE7A 3V5SA 5FXWA 5FL1A 2WSSV 2XNVA 2XZ6A 3HKCE 3RC3A 3UU5A 2FJDA 4DR2T 3Q5EA 5FKYA 2QA7A 1IBKT 3OPCA 2AE9A 3N9NA 4CI2B 5ABHA 1ZKEA 2YMEA 4UVBB 4DR3T 3HA4A 2XQ8A 4DV1T 2HN1A 2CBIA 2N2NA 4HWDA 2CHOA 3RQUA 2LRLA 2NOXA 4UM3P 3MACA 3WTMA 3UU3A 5HXEA 2NW9A 4C90A 3CQCB 3GWHA 3RF1A 4BJMA 5J0ZA 3PUVF 3CVRA 1IZNB 2XNUA 4QX8B 3AE5A 1HX8A 1BR1A 4L0RA 4H63V 3WTNA 1FMWA 3EVYA 1CUNA 5AFLA 2BVLA 5L3BB 3WAKA 5JDGA 2W2UA 5L3CB 1T7SA 2UXCT 3RIAA 4CXXA 3LJCA 3AA1B 1HFAA 3LBXA 4A98A 4HFHA 4HWFA 4HFIA 3T1YT 3U78A 1YW0A 2X51A 5AQLB 4DBRA 1XMOT 4IL4A 3L39A 1WFDA 2WBLA 2XYTA 4ZS2A 2VWAA 2CLYB 5LMUT 2SPCA 2PG8A 5ETWA 3ANWA 2YINA 2XPKA 4KX6A 1LVKA 5IWAT 2UUAT 3LBXB 3O1IA 3I9WA 4IDPA 4PK4A 2I6HA 1X79A 2BKNA 5SYOA 1OEDA 2NWBA 2Y7YA 1KK7A 4DMVA 3ANWB 2JJ9A 3RGLA 2A72A 3RHWA 4UXUA 3TLWA 2A2FX 4AKGA 1OEDB 2QVAA 3AB3B 3WTIA 2XJ7A 2R6GF 3RC8A 3MZKB 2VL0A 4UXNB 4CI3B 2B76A 4YXDA 3P8CD 2W4XA 3IF8B 4ZEYA 1XZYA 4IE0A 1LVFA 4CZZB 4O4IE 4U7IA 2JQQA 5AQMB 4HEAA 3R84B 5HXHA 2WP9A 4YSZA 4C91A 4EEBA 2VB6A 5HAXA 2OV9A 3C84A 2YDRA 5LHIB 2J62A 5AQPB 2MAWA 5KZUA 4YSYA 2UXNB 2X68A 4ERRA 4OHFA 3GA8A 5HWYA 5FY0A 2ZM6T 5L3DB 2KXPB 2RP4A 4FRRA 3PUXF 4LF4T 3ONXA 3ZT5A 2JQ9A 3RQWA 2KNDA 2V7IA 2N1GA 1JNRA 4LMKA 3KV9A 3RYHE 4NZBA 5CFBA 2LOPA 2A9UA 3ZKRA 2EHOD 3AVSA 3CWZB 5FJVA 4B6XA 3FBZA 2H7OA 2X9WA 2V6YA 3C64A 5KDMC 1BR2A 3A7MA 5LNKA 5JQGE 1VCTA 1XMQT 3PUYF 2VVNA 1I9BA 4ALXA 4DV2T 2JPFA 2EHOC 3AEFA 2V6YB 3PJAA 3NRYA 4DR7T 2JIWA 3U8MA 3ZN1B 2F4VT 4YFSA 1H7CA 3IA3A 3O1JA 1QUUA 2ZM8A 4UVAB 2XZEA 3OTOT 5ADXL 2Q9QA 1UK5A 2LSIA 3E22E 5AQFB 5JR9B 3T8OA 5BMVE 5JDHA 2UUBT 2ZJUA 2CMRA 2DCFA 5KXJA 3NWIA 4JEUB 2XHEB 5LHHB 2FUPA 3M3ZB 4TNVA 3KFWX 2CHNA 4E7ZA 3N9LA 4LF6T 2Q9QB 2WDQA 2MBGA 4QH5A 1Y01A 4CXWA 4U3CA 4EB6E 3F57A 4TV8E 3F2EA 3MK7C 2V5CA 2MYSA 5HEUA 2LSJA 2DL1A 1V9DA 2YEVC 2LT3A 4AI6A 1W0AA 2VL8A 1MMAA 3AA0B 1KFYA 5J5HA 3PJAJ 4QABA 2XQYA 4O4JE 2ACZA 3U8JA 3RI5A 3Q5WA 4IE4A 3WTOA 2IAKA 4YHHT 1NWMX 5AQUB 2WWUA 3BQLA 4QWNB 4EV6A 2DWGA 5CJ5A 3ZDHA 2I0MA 3LDQB 1U5PA 4TWDA 3NZQA 3AEDA 3VRAA 2B1EA 3ZT6A 4ILBA 5LXTE 1T98A 5JMEA 4JI2T 4JI5T 2XSBA 4PJMA 3VR9A 3CK6A 5AQIB 1NEKA 4UM3A 4JV5T 2BYSA 4IIJE 4K0UA 3P50A 1I6ZA 4AQFA 4UEMA 2RPAA 3RYCE 2EHOA 3KDSE 2BYPA 4DO0A 2XQ9A 2LKHA 1KF6A 2BS3A 3CQXC 1QLBA 1D0YA 4WYVA 1OXZA 4AKLA 4EGWA 1QSDA 4KUMB 3P4RA 1O3XA 2M6IA 1W09A 2MPKA 4AFHA 2BYRA 1BR0A 2LM2A 1JNZA 2C5KT 3PE0A 2H89A 1L0VA 2XAFB 1MIVA 4U74A 4MBQA 2XQAA 3AE3A 4TV9E 2ODUA 4U72A 3AE7A 2Y48B 2BS2A 1D1CA 2FJBA 2VQFT 2ODVA 4NUUA 3SIOA 3A8YC 5JDLA 5AQSB 3UQ4A 4HFCA 2BR8A 5JDFA 4DUYT 3VR8A 3SFDA 5FXVA 3AECA 4O8SA 2V7LA 2XYSA 3RIFA 2DNXA 1WYBA 1U4QA 3WTJA 4QX7B 3RX6A 2I59A 2LSYA 2LHRA 2CEAA 2BG9B 3SQ9A 2LKGA 4O4LE 3LG7A 4IE6A 5LG4A 2ZM0A 3FZHB 4FI5A 4HE8A 3N2KE 5LHGB 3SWHA 4EZHA 1WYCA 4OX9T 2N9DA 2C5IT 5FY1A 4B3RT 3B5MA 1N33T 2CLYC 5AQTB 3I0OA 4L9IA 5CB4E 1D0ZA 1HG5A 4PNIA 2WDVA 1KNZA 5JRCA 3P4SA 3KINB 3IHRA 4ZRUA 3K3OA 3V5UA 2K9AA 3MA9A 4LF8T 2L3LA 5HYAA 3TLSA 1HCIA 5LA6E 4JI8T 4KP3C 4ZR6A 2L9QA 4G2AA 5J1GA 4P09A 1YQ3A 4BFQA 1UCUA 2WU2A 5JRCB 1OEDC 4AKRB 4F6RC 5LGNB 2XQ5A 4ZS3A 2HN2A 3AAAB 4A56A 3VKHA 5C8YE 3ONLC 5H6RB 2CXFA 3QK6A 4LMJA 2YKSA 1HX1B 4DIDB 5H6QB 3ZJ1A 3VHLA 5A1LA 1OEDE 2IW5B 5HEHA 3T4MA 2BVMA 4PFPA 5LOVE 4XK9A 1MMDA 1YD8G 3AEGA 5ABFB 2V7JA 2Y8DA 2UUCT 4X62T 4ILAA 2XNTA 3H37A 2V1DB 2BYNA 3U8KA 2XZ5A 4I0UA 4PK6A 3UU8A 3N5LA 5AQQB 3C4WA 5L2LA 4IDNA 2D0TA 4QACA 2MOZA 4EEDA 4GYRA 1UGOA 1IJ5A 2H88A 4ZI7E 3TLTA 5AQGB 2PBIA 3FZFB 4DBMA 4JI3T 5BR8T 4XBFB 3GMIA 3N9OA 4JLEA 2QYWA 5J5FA 3NZPA 3PUAA 5TAOA 5KE4A 3FXEB 3QOFA 2WNLA 1MMNA 2XM1A 4GOUA 4ISSA 4DV7T 4WW0A 3S4UA 3UFGA 2WB5A 4A5XA 4KHZF 4ZJSA 2L8KA 3BK9A 4TWFA 2K48A 2OA5A 2IMLA 3E0ZA 2XQ6A 2Q9QD 3ZT7A 4DR1T 4X5TA 3OYZA 2VQET 4BAYB 1Y64B 1ZV4X 3U8NA 4CN4A 3ZCIA 3E08A 5JVDE 3ZMUB 5JR9C 2V6XA 2XAQB 5HXSA 5AQVB 5LCYA 4DMWA 4QHOA 5LBQB 3K3QC 4WV9A 3MJXA 1XNQT 4EYYR 5E0OA 4H9PC 1ZP0A 5ABEA 2Q9QC 4M1PA 2X0LB 3PTRB 5HEOA 4MHCA 2XAGB 2Y56A 2DWKA 3ESLA 3RRWA 2RA1A 1UX4A 3ZCJA 5F8PA 4UV9B 4XAXB 2WY2A 3UTKA 1WRDA 4QXBB 4FJOA 5F3JA 5LGTB 2NTXA 4WBNE 1S35A 2JMKA 4MLKA 3AEEA 2YN6A 5L47A 4GYSA 3PV0F 3DJBA 2DI4A 3UUNA 5FYMA 5JREA 5FXXA 1OWAA 3PURA 2J47A 3Q2MA 5LYJE 4UELA 3H3AA 3HKDE 2CXLA 2UXBT 1Z8UA 3CIRA 4JUYA 4AIUA 1VOMA 4ZZBA 3B13A 4HGAA 2NW7A 3A5XA 5LBMA 4P1NA 2X0YA 1UUSA 4HFBA 2IC9A 2OLTA 2E2AA 4QXHB 5AQKB 2IC6A 2KMFA 3EUHA 3P4WA 2VKJA 3Q5DA 3AE9A 3ETUA 2CA5A 3PMZA 5HEGA 3ZYKA 5JR9A 3ZMSB 5FL0A 2M67A 4AQFC 3PUWF 2C5JA 5DJQC 4ANJA 2WU5A 3ZN0B 2K3WA 3W15B 3ZC0A 3AAEB 4ILUA 3UT5E 4LMLA 2ACXA 2W61A 2DHRA 4H9OC 4UIGA 2NP9A 4TNWA 4ASKA 4EXTA 2Y58A 3U8LA 2WAUA 5AQJB 4PW8A 4CN1A 3VU7H 4DV4T 4NXMT 2BG9C 3JC6D 4JI1T 4MALA 1M7KA 4E7SA 2W8GA 3T1HT 4B5DA 3GUAA 4H63H 3EHZA 2BG9E 3IBPA 3MKDA 4JI4T 4YY3T 1VCSA 2E9XA 4ZXLA 3Q9DA 5CGMA 2V8SV 4EIWA 3OYXA 1VRBA 2CM0A 2LSGA 4GKJT 5GONE 2JQHA 3AE2A 3P4QA 3B57A 1ZHCA 3KBTA 2IUBA 1N36T 2D9DA 3ZSTA 3N2OA 4XHEA 1UW6A 2NR4A 2MTQA 2E9XB 4IDZA 3K3NA 2KWIB 1YQ4A 4J2CA 3QUJA 4HWIB 2BKOA 4BQTA 4YJ2E 2UXDT 3KV6A 2BDEA 4PIRA 2LRKA 5LJNA 2JMHA 4Z91A 4XZCA 3DTOA 2CXDA 2ZM2A 2CWOA 5TVCA 4G63A 3SS1A 2KSRA 2XM2A 3AE6A 1E7PA 1W9RA 3AA7B 1MNEA 4PFOA 4DR6T 3G06A 1HNZT 2WNCA 3PUSA 5BRXA 2XQ3A 4DR4T 2W8FA 3FZLB 3TKLB 1HNXT 3N9QA 3RYFE 2DLRA 2LM9A 4HFEA 4U7YA 1S94A 5AFNA 4TWHA 5C3JA 2J1DG 3CX8B 5EK4A 2BG9A 2PTFA 2BKPA 3AE8A 2WZYA 3ZDGA 2PJQA 5JTGA 3SRZA 2XQ7A 4QKNA 3ZJ2A 1MNDA 3X1DA 4EZ4A 3PU8A 5AFJA 1MIYA 4YSXA 5LGUB 4GIWA 4JEHB 4JBWF 3K1SA 4NIQA 5FMNA 4Q25A 1IBMT 1IJ6A 5IHYA 4NUVA 5ABGA 4AQYT 2CWYA 5LG3A 2M6BA 4IREA 1NENA 3ZPOA 3SH1A 5AFKA 3VKGA 3L8RA 1UV6A 3O1HA 1WR6A 2NW8A 4MFRA 3CQGB 3KVBA 1YKEB 1LKXA 3PDYA 2HPJA 2BR7A 4ZI2D 4I4TE 4YHJA 3QB5K 4WBOA 5AFMA 3IEEA 1BR4A 2XY8B 1US7B 4JYAT 3WI3A 3TLVA 2VVSA 4DR5T 3ETVA 4TUYE 4UM3S 2ZJVA 2KINB 1E1HB 3KBUA 3UFEA 2BYQA 4CI1B 4B3MT 3KVAA 2K5BB 5M4YA 5LP6E 2PGZA 2KWHA 1I94T 2CBJA 4Z90A 1D0XA 5AFMB 4AISA 5FVLA 4ZI2C 2V5DA 3OJAA 1N32T 2J4GA 5FNVE 4A97A 4CXYA 4CQIA 4DBQA 5AQHB 4H9NC 5ABFA 5HEJA 3Q5XA 4IDQA 2PH9A 4YTNA 5L3GB 3ZYLA 3WTLA 4ZI3D 1W0BA 4N78D 2BJ0A 4ZZCA 4X64T 4ILCA 2LEHA 4KI0F 2BS4A 3NVOA 4YLHA 3RKOA 2YU1A 2D2SA 3LK42 3M65A 2V7MA 4WNKA 3BQKA 1IAPA 2KLQA 1R8IA 4UM1A 1UX5A 2VURA 5JDNA 5DQWA 2VK9A 4HWCA 3EDVA 2FJAA 3WTHA 4O2AE 4ZI3C 2BZBA 1XDPA 2X0HA 2IHR1 1SHZC 3PEOA 2W00A 3GN5A 3O9XA 3UU4A 3FHNA 2E5LT 2WS3A 2X9XA 3HR0A 2WM9A 5LMNT 3QB5A 4EAHA 5HXRA 3LK2B 3PUGA 4GKKT 4X65T 4ZK4A 2W67A 1J1JA 4DV6T 3GN5B 4TZ4C 5J5GA 4AKHA 3I9YA 2WMOA 3AE1A 2UXXB 3I0QA 3UUMA 1UURA 1XDOA 3AE4A 5J2TE 1EZ3A 4UR9A 4JI6T 4Z8XA 3UULA 3AEBA 3RIUC 3C51A 1D1AA 3SQ6A 2Y54A
chains in the Genus database with same CATH topology
4ILCA 3WTKA 3RIAA 3UU8A 2C9TA 4UM3A 2BYSA 3P50A 4XHEA 5CO5A 1UW6A 4A98A 4HFHA 3UU6A 3PMZA 4HFIA 2QC1B 5HEGA 4QH4A 3C79A 3C84A 2MAWA 2BYPA 4D01A 5LG3A 4QACA 5HCMA 5HEOA 2M6BA 4IREA 2ZJUA 4UM1A 2XQ9A 4COFA 2LKHA 5BP0A 5KZUA 2Y56A 3SH1A 3UUBA 5AFKA 1UV6A 4BQTA 3TLTA 4IL4A 3EAMA 4DBMA 4ZRUA 2XYTA 2YMDA 2XNVA 2XZ6A 4F8HA 4TNVA 4PIRA 4LMLA 5L4HA 3UU5A 4FRRA 2XQ4A 3TLSA 5L4EA 4Z91A 2WNJA 3WTHA 5J5FA 4ZR6A 2YOEA 3LSVA 3JAEA 2M6IA 2BR7A 4QH5A 3RQWA 2X00A 2BYRA 3WIPA 5TVCA 4AFHA 5AFMA 5KE4A 3IGQA 2LM2A 5J5IA 4TNWA 2KSRA 4LMKA 2Y58A 2WNLA 3U8LA 3TLVA 5SYOA 3PEOA 4BFQA 1OEDA 2XQAA 2Y57A 3UU4A 5HEUA 1OEDC 2WNCA 4NZBA 2YMEA 2XQ5A 4UM3S 2Y7YA 2ZJVA 5CFBA 5BRXA 2YN6A 5AFHA 5L47A 2XQ3A 3ZKRA 2BG9C 3SIOA 2XQ8A 1UX2A 2W8FA 3UQ4A 3JAFA 4HFCA 4NPPA 5HCJA 2BR8A 2BYQA 4QABA 5J5HA 4ZJSA 3TLUA 2WN9A 4IL9A 2PGZA 4QAAA 4LMJA 4Z90A 4UY2A 5FJVA 2YKSA 4HFEA 4TWFA 2W8GA 5AFMB 3RQUA 2XYSA 4AFTA 3RIFA 3U8JA 3RHWA 3RI5A 4ZK4A 4UXUA 4ZK1A 5AFNA 4TWHA 3WTOA 4B5DA 4UM3P 3TLWA 3WTMA 3WTJA 3UU3A 1OEDB 1OEDE 3WTIA 5BW2A 3GUAA 2LLYA 5J5GA 2XQ6A 5HEHA 3T4MA 5IUXA 4EZ1A 2BG9B 2BG9E 2BG9A 2LKGA 3EHZA 4A97A 4WV9A 5J0ZA 1I9BA 4XK9A 3SQ9A 3ZDHA 2X00D 2XNUA 4ZZBA 2VL0A 4X5TA 2WZYA 3ZDGA 4AFGA 4ALXA 4ZJTA 4HQPA 5HEJA 3U8NA 3UQ7A 2XQ7A 3WTNA 4TWDA 2PH9A 5LXBA 5AFJA 5AINA 5AFLA 4HFBA 4HFDA 4ILBA 4ILAA 3JADA 2XNTA 5JMEA 3SQ6A 2BYNA 3WTLA 4QH1A 3EI0A 3U8MA 3P4WA 2BJ0A 2Y54A 3U8KA 2UZ6A 2XZ5A 4ZZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILC A;  3WTK A;  3RIA A;  3UU8 A;  2C9T A;  4UM3 A;  2BYS A;  3P50 A;  4XHE A;  5CO5 A;  1UW6 A;  4A98 A;  4HFH A;  3UU6 A;  3PMZ A;  4HFI A;  2QC1 B;  5HEG A;  4QH4 A;  3C79 A;  3C84 A;  2MAW A;  2BYP A;  4D01 A;  5LG3 A;  4QAC A;  5HCM A;  5HEO A;  2M6B A;  4IRE A;  2ZJU A;  4UM1 A;  2XQ9 A;  4COF A;  2LKH A;  5BP0 A;  5KZU A;  2Y56 A;  3SH1 A;  3UUB A;  5AFK A;  1UV6 A;  4BQT A;  3TLT A;  4IL4 A;  3EAM A;  4DBM A;  4ZRU A;  2XYT A;  2YMD A;  2XNV A;  2XZ6 A;  4F8H A;  4TNV A;  4PIR A;  4LML A;  5L4H A;  3UU5 A;  4FRR A;  2XQ4 A;  3TLS A;  5L4E A;  4Z91 A;  2WNJ A;  3WTH A;  5J5F A;  4ZR6 A;  2YOE A;  3LSV A;  3JAE A;  2M6I A;  2BR7 A;  4QH5 A;  3RQW A;  2X00 A;  2BYR A;  3WIP A;  5TVC A;  4AFH A;  5AFM A;  5KE4 A;  3IGQ A;  2LM2 A;  5J5I A;  4TNW A;  2KSR A;  4LMK A;  2Y58 A;  2WNL A;  3U8L A;  3TLV A;  5SYO A;  3PEO A;  4BFQ A;  1OED A;  2XQA A;  2Y57 A;  3UU4 A;  5HEU A;  1OED C;  2WNC A;  4NZB A;  2YME A;  2XQ5 A;  4UM3 S;  2Y7Y A;  2ZJV A;  5CFB A;  5BRX A;  2YN6 A;  5AFH A;  5L47 A;  2XQ3 A;  3ZKR A;  2BG9 C;  3SIO A;  2XQ8 A;  1UX2 A;  2W8F A;  3UQ4 A;  3JAF A;  4HFC A;  4NPP A;  5HCJ A;  2BR8 A;  2BYQ A;  4QAB A;  5J5H A;  4ZJS A;  3TLU A;  2WN9 A;  4IL9 A;  2PGZ A;  4QAA A;  4LMJ A;  4Z90 A;  4UY2 A;  5FJV A;  2YKS A;  4HFE A;  4TWF A;  2W8G A;  5AFM B;  3RQU A;  2XYS A;  4AFT A;  3RIF A;  3U8J A;  3RHW A;  3RI5 A;  4ZK4 A;  4UXU A;  4ZK1 A;  5AFN A;  4TWH A;  3WTO A;  4B5D A;  4UM3 P;  3TLW A;  3WTM A;  3WTJ A;  3UU3 A;  1OED B;  1OED E;  3WTI A;  5BW2 A;  3GUA A;  2LLY A;  5J5G A;  2XQ6 A;  5HEH A;  3T4M A;  5IUX A;  4EZ1 A;  2BG9 B;  2BG9 E;  2BG9 A;  2LKG A;  3EHZ A;  4A97 A;  4WV9 A;  5J0Z A;  1I9B A;  4XK9 A;  3SQ9 A;  3ZDH A;  2X00 D;  2XNU A;  4ZZB A;  2VL0 A;  4X5T A;  2WZY A;  3ZDG A;  4AFG A;  4ALX A;  4ZJT A;  4HQP A;  5HEJ A;  3U8N A;  3UQ7 A;  2XQ7 A;  3WTN A;  4TWD A;  2PH9 A;  5LXB A;  5AFJ A;  5AIN A;  5AFL A;  4HFB A;  4HFD A;  4ILB A;  4ILA A;  3JAD A;  2XNT A;  5JME A;  3SQ6 A;  2BYN A;  3WTL A;  4QH1 A;  3EI0 A;  3U8M A;  3P4W A;  2BJ0 A;  2Y54 A;  3U8K A;  2UZ6 A;  2XZ5 A;  4ZZC A; 
#chains in the Genus database with same CATH topology
 2ES0 A;  2VAS A;  3FXD B;  1YKH B;  2QGS A;  3HKE E;  5JDM A;  4U33 A;  3N9P A;  5DQV A;  3CML A;  1XWM A;  4BJN A;  3AXJ A;  2H3R A;  4TX5 A;  3UUB A;  4UF0 A;  4DND A;  3C98 B;  1D1B A;  3EAM A;  2CPT A;  4HN9 A;  3ABV A;  2VKO A;  2XQ4 A;  5L4E A;  1KNR A;  3AEA A;  2WNJ A;  3L09 A;  3FBL A;  2YOE A;  3ZMV B;  3R6N A;  2KZ7 B;  4ZHQ E;  4L5G A;  3H3M A;  3AXJ B;  3MXZ A;  4DV0 T;  3FZM B;  4UF0 B;  4OYK A;  3VRB A;  2Y57 A;  4OK0 A;  4QXC B;  4HWH A;  3ZSS A;  2W0G A;  1ZOY A;  2E9X D;  2WZI A;  4UVC B;  1HTJ F;  3JAF A;  3RLF F;  3RKG A;  1MMG A;  4U31 A;  3TLU A;  2IIU A;  2UU9 T;  2LJL A;  4ZOL E;  2W63 A;  5JH7 E;  4AQG A;  4IE7 A;  3L3P A;  4TN7 B;  2WDR A;  5IUX A;  4EZ1 A;  4V1A v;  1G73 A;  3C50 A;  5L3F B;  1J5W A;  5DAB A;  1E2A A;  4PK5 A;  4LFC T;  4PJN A;  2E9X C;  2XAJ B;  4NXN T;  4H9R C;  2HPL A;  4LF9 T;  2FJE A;  2YDS A;  3AA6 B;  4KMC A;  3OVU A;  3AAI A;  1Z0P A;  2V7K A;  2WZH A;  3KV4 A;  2W66 A;  4DUZ T;  4X1Y E;  2QC1 B;  5BP0 A;  2HH7 A;  3RIU A;  4YTP A;  3K8P C;  2PFV A;  3N9M A;  3NRX A;  5EK3 A;  2Y6X A;  5AQN B;  4ADZ A;  3RH3 A;  4EYU A;  2LE8 A;  4BA9 A;  3PU3 A;  1FIO A;  3JAE A;  3HL6 A;  4YT0 A;  3WIP A;  2P9B A;  2X66 A;  3U3I A;  5J5I A;  2XUE A;  4I55 E;  1DU2 A;  3UUX B;  4CN6 A;  2GK9 A;  4O2B E;  5AFH A;  1FJG T;  1WLX A;  1WR0 A;  5HCJ A;  3HI2 A;  4UY2 A;  5FP3 A;  4X66 T;  4U2Z A;  4I43 B;  3FZK B;  4IE5 A;  4ZK1 A;  2YK0 A;  3NKZ A;  1IBL T;  4AKI A;  2C0S A;  2LLY A;  3FB2 A;  3EDU A;  2V26 A;  2XSA A;  2X00 D;  4YTM A;  4AFG A;  4OYJ A;  1XNR T;  4WZX A;  1FEW A;  2D0U A;  5LJM A;  2WWV A;  5LXB A;  4HFD A;  2ZLY A;  3JAD A;  5EZY E;  3EI0 A;  1LRZ A;  4O4H E;  3ZC1 A;  3I1A A;  5EK2 A;  1FMV A;  3WTK A;  1T8B A;  1NAF A;  3O4X E;  5CO5 A;  2XTL A;  1HR0 T;  4IHJ E;  4QH4 A;  1CHU A;  2LSK A;  4B3T T;  4UV8 B;  4COF A;  3JC6 C;  4JI0 T;  2E5V A;  4HKA A;  2LOS A;  4P0B A;  3EAB A;  2XAS B;  2YMD A;  2G0U A;  4F8H A;  1J5E T;  5L4H A;  5FY7 A;  1ZEE A;  1HS7 A;  4HTE A;  4EOZ B;  5KX5 E;  3LSV A;  1HF8 A;  1N34 T;  3JCF A;  4JI7 T;  4GK5 E;  2XAH B;  3LFM A;  4IT4 A;  5AQO B;  1KNP A;  2CRB A;  1UX2 A;  2Z6E A;  1GQE A;  4X1K E;  2ZMA A;  4H9Q C;  2WN9 A;  4IL9 A;  3KV5 A;  3ONJ A;  2JRK A;  4AFT A;  2QRX A;  2K24 A;  5AQR B;  3N2G E;  4HFV A;  2IDO B;  2CCQ A;  3P4P A;  1WCR A;  3OBV E;  5HXC A;  5KMG P;  4GK0 E;  1YXR A;  3DP7 A;  3OKQ A;  1KEY A;  4X1I E;  4ZJT A;  4HQP A;  3UQ7 A;  2CE7 A;  3J9X 1;  4PJJ A;  2BBJ A;  5AIN A;  2X67 A;  4YJ3 E;  4LF7 T;  4X20 E;  2VKD A;  3J7Y q;  2UZ6 A;  2H7V C;  5C2T A;  3QNU A;  4OFZ A;  2C9T A;  3D0T A;  1B7T A;  1HG2 A;  3C4Z A;  3PUZ F;  4H9S E;  4DVD A;  2WMN A;  2EHO B;  4D01 A;  5FXZ A;  5HCM A;  4B3S T;  1HNW T;  3ZYM A;  2WQY A;  4PAG A;  5FVK A;  2LHN A;  1SA0 E;  4K0K T;  1AJ3 A;  3RYI E;  4IGU A;  5HWX A;  4DV3 T;  3CPZ A;  3C4X A;  3SOL A;  4IST A;  4LF5 T;  2X00 A;  5AFU L;  2WCA A;  1SUM B;  1G8X A;  3IGQ A;  5CA0 E;  2KT9 A;  1MIW A;  3WAJ A;  5LB7 B;  2E8I A;  5F5W A;  2BBH A;  4DV5 T;  2YU2 A;  4PJL A;  4NPP A;  4KHP T;  4QAA A;  2HHH T;  4KBM B;  2X9Y A;  3CX7 B;  1T72 A;  2W62 A;  3ZLI A;  2VKH A;  3RRC A;  4LFA T;  1M62 A;  2YDQ A;  3QC9 A;  3F31 A;  5CA1 E;  5BW2 A;  3BQI A;  2AXD S;  4P0A A;  4U2Y A;  3ZEF B;  3ZMT B;  2A3D A;  5IYZ E;  2FBW A;  1X9B A;  3P7I A;  4LFB T;  5J2U E;  2JQK A;  3CX6 B;  4QH1 A;  2X9H A;  5L3E B;  3CKD A;  4I50 E;  3NBX X;  3AVR A;  3HKB E;  5JDQ A;  4IDO A;  3LK3 B;  3RPU A;  3UU6 A;  3C79 A;  3SFE A;  3ZMZ B;  2NTY A;  4AXP A;  3PUQ A;  2D5U A;  1SE7 A;  3V5S A;  5FXW A;  5FL1 A;  2WSS V;  2XNV A;  2XZ6 A;  3HKC E;  3RC3 A;  3UU5 A;  2FJD A;  4DR2 T;  3Q5E A;  5FKY A;  2QA7 A;  1IBK T;  3OPC A;  2AE9 A;  3N9N A;  4CI2 B;  5ABH A;  1ZKE A;  2YME A;  4UVB B;  4DR3 T;  3HA4 A;  2XQ8 A;  4DV1 T;  2HN1 A;  2CBI A;  2N2N A;  4HWD A;  2CHO A;  3RQU A;  2LRL A;  2NOX A;  4UM3 P;  3MAC A;  3WTM A;  3UU3 A;  5HXE A;  2NW9 A;  4C90 A;  3CQC B;  3GWH A;  3RF1 A;  4BJM A;  5J0Z A;  3PUV F;  3CVR A;  1IZN B;  2XNU A;  4QX8 B;  3AE5 A;  1HX8 A;  1BR1 A;  4L0R A;  4H63 V;  3WTN A;  1FMW A;  3EVY A;  1CUN A;  5AFL A;  2BVL A;  5L3B B;  3WAK A;  5JDG A;  2W2U A;  5L3C B;  1T7S A;  2UXC T;  3RIA A;  4CXX A;  3LJC A;  3AA1 B;  1HFA A;  3LBX A;  4A98 A;  4HFH A;  4HWF A;  4HFI A;  3T1Y T;  3U78 A;  1YW0 A;  2X51 A;  5AQL B;  4DBR A;  1XMO T;  4IL4 A;  3L39 A;  1WFD A;  2WBL A;  2XYT A;  4ZS2 A;  2VWA A;  2CLY B;  5LMU T;  2SPC A;  2PG8 A;  5ETW A;  3ANW A;  2YIN A;  2XPK A;  4KX6 A;  1LVK A;  5IWA T;  2UUA T;  3LBX B;  3O1I A;  3I9W A;  4IDP A;  4PK4 A;  2I6H A;  1X79 A;  2BKN A;  5SYO A;  1OED A;  2NWB A;  2Y7Y A;  1KK7 A;  4DMV A;  3ANW B;  2JJ9 A;  3RGL A;  2A72 A;  3RHW A;  4UXU A;  3TLW A;  2A2F X;  4AKG A;  1OED B;  2QVA A;  3AB3 B;  3WTI A;  2XJ7 A;  2R6G F;  3RC8 A;  3MZK B;  2VL0 A;  4UXN B;  4CI3 B;  2B76 A;  4YXD A;  3P8C D;  2W4X A;  3IF8 B;  4ZEY A;  1XZY A;  4IE0 A;  1LVF A;  4CZZ B;  4O4I E;  4U7I A;  2JQQ A;  5AQM B;  4HEA A;  3R84 B;  5HXH A;  2WP9 A;  4YSZ A;  4C91 A;  4EEB A;  2VB6 A;  5HAX A;  2OV9 A;  3C84 A;  2YDR A;  5LHI B;  2J62 A;  5AQP B;  2MAW A;  5KZU A;  4YSY A;  2UXN B;  2X68 A;  4ERR A;  4OHF A;  3GA8 A;  5HWY A;  5FY0 A;  2ZM6 T;  5L3D B;  2KXP B;  2RP4 A;  4FRR A;  3PUX F;  4LF4 T;  3ONX A;  3ZT5 A;  2JQ9 A;  3RQW A;  2KND A;  2V7I A;  2N1G A;  1JNR A;  4LMK A;  3KV9 A;  3RYH E;  4NZB A;  5CFB A;  2LOP A;  2A9U A;  3ZKR A;  2EHO D;  3AVS A;  3CWZ B;  5FJV A;  4B6X A;  3FBZ A;  2H7O A;  2X9W A;  2V6Y A;  3C64 A;  5KDM C;  1BR2 A;  3A7M A;  5LNK A;  5JQG E;  1VCT A;  1XMQ T;  3PUY F;  2VVN A;  1I9B A;  4ALX A;  4DV2 T;  2JPF A;  2EHO C;  3AEF A;  2V6Y B;  3PJA A;  3NRY A;  4DR7 T;  2JIW A;  3U8M A;  3ZN1 B;  2F4V T;  4YFS A;  1H7C A;  3IA3 A;  3O1J A;  1QUU A;  2ZM8 A;  4UVA B;  2XZE A;  3OTO T;  5ADX L;  2Q9Q A;  1UK5 A;  2LSI A;  3E22 E;  5AQF B;  5JR9 B;  3T8O A;  5BMV E;  5JDH A;  2UUB T;  2ZJU A;  2CMR A;  2DCF A;  5KXJ A;  3NWI A;  4JEU B;  2XHE B;  5LHH B;  2FUP A;  3M3Z B;  4TNV A;  3KFW X;  2CHN A;  4E7Z A;  3N9L A;  4LF6 T;  2Q9Q B;  2WDQ A;  2MBG A;  4QH5 A;  1Y01 A;  4CXW A;  4U3C A;  4EB6 E;  3F57 A;  4TV8 E;  3F2E A;  3MK7 C;  2V5C A;  2MYS A;  5HEU A;  2LSJ A;  2DL1 A;  1V9D A;  2YEV C;  2LT3 A;  4AI6 A;  1W0A A;  2VL8 A;  1MMA A;  3AA0 B;  1KFY A;  5J5H A;  3PJA J;  4QAB A;  2XQY A;  4O4J E;  2ACZ A;  3U8J A;  3RI5 A;  3Q5W A;  4IE4 A;  3WTO A;  2IAK A;  4YHH T;  1NWM X;  5AQU B;  2WWU A;  3BQL A;  4QWN B;  4EV6 A;  2DWG A;  5CJ5 A;  3ZDH A;  2I0M A;  3LDQ B;  1U5P A;  4TWD A;  3NZQ A;  3AED A;  3VRA A;  2B1E A;  3ZT6 A;  4ILB A;  5LXT E;  1T98 A;  5JME A;  4JI2 T;  4JI5 T;  2XSB A;  4PJM A;  3VR9 A;  3CK6 A;  5AQI B;  1NEK A;  4UM3 A;  4JV5 T;  2BYS A;  4IIJ E;  4K0U A;  3P50 A;  1I6Z A;  4AQF A;  4UEM A;  2RPA A;  3RYC E;  2EHO A;  3KDS E;  2BYP A;  4DO0 A;  2XQ9 A;  2LKH A;  1KF6 A;  2BS3 A;  3CQX C;  1QLB A;  1D0Y A;  4WYV A;  1OXZ A;  4AKL A;  4EGW A;  1QSD A;  4KUM B;  3P4R A;  1O3X A;  2M6I A;  1W09 A;  2MPK A;  4AFH A;  2BYR A;  1BR0 A;  2LM2 A;  1JNZ A;  2C5K T;  3PE0 A;  2H89 A;  1L0V A;  2XAF B;  1MIV A;  4U74 A;  4MBQ A;  2XQA A;  3AE3 A;  4TV9 E;  2ODU A;  4U72 A;  3AE7 A;  2Y48 B;  2BS2 A;  1D1C A;  2FJB A;  2VQF T;  2ODV A;  4NUU A;  3SIO A;  3A8Y C;  5JDL A;  5AQS B;  3UQ4 A;  4HFC A;  2BR8 A;  5JDF A;  4DUY T;  3VR8 A;  3SFD A;  5FXV A;  3AEC A;  4O8S A;  2V7L A;  2XYS A;  3RIF A;  2DNX A;  1WYB A;  1U4Q A;  3WTJ A;  4QX7 B;  3RX6 A;  2I59 A;  2LSY A;  2LHR A;  2CEA A;  2BG9 B;  3SQ9 A;  2LKG A;  4O4L E;  3LG7 A;  4IE6 A;  5LG4 A;  2ZM0 A;  3FZH B;  4FI5 A;  4HE8 A;  3N2K E;  5LHG B;  3SWH A;  4EZH A;  1WYC A;  4OX9 T;  2N9D A;  2C5I T;  5FY1 A;  4B3R T;  3B5M A;  1N33 T;  2CLY C;  5AQT B;  3I0O A;  4L9I A;  5CB4 E;  1D0Z A;  1HG5 A;  4PNI A;  2WDV A;  1KNZ A;  5JRC A;  3P4S A;  3KIN B;  3IHR A;  4ZRU A;  3K3O A;  3V5U A;  2K9A A;  3MA9 A;  4LF8 T;  2L3L A;  5HYA A;  3TLS A;  1HCI A;  5LA6 E;  4JI8 T;  4KP3 C;  4ZR6 A;  2L9Q A;  4G2A A;  5J1G A;  4P09 A;  1YQ3 A;  4BFQ A;  1UCU A;  2WU2 A;  5JRC B;  1OED C;  4AKR B;  4F6R C;  5LGN B;  2XQ5 A;  4ZS3 A;  2HN2 A;  3AAA B;  4A56 A;  3VKH A;  5C8Y E;  3ONL C;  5H6R B;  2CXF A;  3QK6 A;  4LMJ A;  2YKS A;  1HX1 B;  4DID B;  5H6Q B;  3ZJ1 A;  3VHL A;  5A1L A;  1OED E;  2IW5 B;  5HEH A;  3T4M A;  2BVM A;  4PFP A;  5LOV E;  4XK9 A;  1MMD A;  1YD8 G;  3AEG A;  5ABF B;  2V7J A;  2Y8D A;  2UUC T;  4X62 T;  4ILA A;  2XNT A;  3H37 A;  2V1D B;  2BYN A;  3U8K A;  2XZ5 A;  4I0U A;  4PK6 A;  3UU8 A;  3N5L A;  5AQQ B;  3C4W A;  5L2L A;  4IDN A;  2D0T A;  4QAC A;  2MOZ A;  4EED A;  4GYR A;  1UGO A;  1IJ5 A;  2H88 A;  4ZI7 E;  3TLT A;  5AQG B;  2PBI A;  3FZF B;  4DBM A;  4JI3 T;  5BR8 T;  4XBF B;  3GMI A;  3N9O A;  4JLE A;  2QYW A;  5J5F A;  3NZP A;  3PUA A;  5TAO A;  5KE4 A;  3FXE B;  3QOF A;  2WNL A;  1MMN A;  2XM1 A;  4GOU A;  4ISS A;  4DV7 T;  4WW0 A;  3S4U A;  3UFG A;  2WB5 A;  4A5X A;  4KHZ F;  4ZJS A;  2L8K A;  3BK9 A;  4TWF A;  2K48 A;  2OA5 A;  2IML A;  3E0Z A;  2XQ6 A;  2Q9Q D;  3ZT7 A;  4DR1 T;  4X5T A;  3OYZ A;  2VQE T;  4BAY B;  1Y64 B;  1ZV4 X;  3U8N A;  4CN4 A;  3ZCI A;  3E08 A;  5JVD E;  3ZMU B;  5JR9 C;  2V6X A;  2XAQ B;  5HXS A;  5AQV B;  5LCY A;  4DMW A;  4QHO A;  5LBQ B;  3K3Q C;  4WV9 A;  3MJX A;  1XNQ T;  4EYY R;  5E0O A;  4H9P C;  1ZP0 A;  5ABE A;  2Q9Q C;  4M1P A;  2X0L B;  3PTR B;  5HEO A;  4MHC A;  2XAG B;  2Y56 A;  2DWK A;  3ESL A;  3RRW A;  2RA1 A;  1UX4 A;  3ZCJ A;  5F8P A;  4UV9 B;  4XAX B;  2WY2 A;  3UTK A;  1WRD A;  4QXB B;  4FJO A;  5F3J A;  5LGT B;  2NTX A;  4WBN E;  1S35 A;  2JMK A;  4MLK A;  3AEE A;  2YN6 A;  5L47 A;  4GYS A;  3PV0 F;  3DJB A;  2DI4 A;  3UUN A;  5FYM A;  5JRE A;  5FXX A;  1OWA A;  3PUR A;  2J47 A;  3Q2M A;  5LYJ E;  4UEL A;  3H3A A;  3HKD E;  2CXL A;  2UXB T;  1Z8U A;  3CIR A;  4JUY A;  4AIU A;  1VOM A;  4ZZB A;  3B13 A;  4HGA A;  2NW7 A;  3A5X A;  5LBM A;  4P1N A;  2X0Y A;  1UUS A;  4HFB A;  2IC9 A;  2OLT A;  2E2A A;  4QXH B;  5AQK B;  2IC6 A;  2KMF A;  3EUH A;  3P4W A;  2VKJ A;  3Q5D A;  3AE9 A;  3ETU A;  2CA5 A;  3PMZ A;  5HEG A;  3ZYK A;  5JR9 A;  3ZMS B;  5FL0 A;  2M67 A;  4AQF C;  3PUW F;  2C5J A;  5DJQ C;  4ANJ A;  2WU5 A;  3ZN0 B;  2K3W A;  3W15 B;  3ZC0 A;  3AAE B;  4ILU A;  3UT5 E;  4LML A;  2ACX A;  2W61 A;  2DHR A;  4H9O C;  4UIG A;  2NP9 A;  4TNW A;  4ASK A;  4EXT A;  2Y58 A;  3U8L A;  2WAU A;  5AQJ B;  4PW8 A;  4CN1 A;  3VU7 H;  4DV4 T;  4NXM T;  2BG9 C;  3JC6 D;  4JI1 T;  4MAL A;  1M7K A;  4E7S A;  2W8G A;  3T1H T;  4B5D A;  3GUA A;  4H63 H;  3EHZ A;  2BG9 E;  3IBP A;  3MKD A;  4JI4 T;  4YY3 T;  1VCS A;  2E9X A;  4ZXL A;  3Q9D A;  5CGM A;  2V8S V;  4EIW A;  3OYX A;  1VRB A;  2CM0 A;  2LSG A;  4GKJ T;  5GON E;  2JQH A;  3AE2 A;  3P4Q A;  3B57 A;  1ZHC A;  3KBT A;  2IUB A;  1N36 T;  2D9D A;  3ZST A;  3N2O A;  4XHE A;  1UW6 A;  2NR4 A;  2MTQ A;  2E9X B;  4IDZ A;  3K3N A;  2KWI B;  1YQ4 A;  4J2C A;  3QUJ A;  4HWI B;  2BKO A;  4BQT A;  4YJ2 E;  2UXD T;  3KV6 A;  2BDE A;  4PIR A;  2LRK A;  5LJN A;  2JMH A;  4Z91 A;  4XZC A;  3DTO A;  2CXD A;  2ZM2 A;  2CWO A;  5TVC A;  4G63 A;  3SS1 A;  2KSR A;  2XM2 A;  3AE6 A;  1E7P A;  1W9R A;  3AA7 B;  1MNE A;  4PFO A;  4DR6 T;  3G06 A;  1HNZ T;  2WNC A;  3PUS A;  5BRX A;  2XQ3 A;  4DR4 T;  2W8F A;  3FZL B;  3TKL B;  1HNX T;  3N9Q A;  3RYF E;  2DLR A;  2LM9 A;  4HFE A;  4U7Y A;  1S94 A;  5AFN A;  4TWH A;  5C3J A;  2J1D G;  3CX8 B;  5EK4 A;  2BG9 A;  2PTF A;  2BKP A;  3AE8 A;  2WZY A;  3ZDG A;  2PJQ A;  5JTG A;  3SRZ A;  2XQ7 A;  4QKN A;  3ZJ2 A;  1MND A;  3X1D A;  4EZ4 A;  3PU8 A;  5AFJ A;  1MIY A;  4YSX A;  5LGU B;  4GIW A;  4JEH B;  4JBW F;  3K1S A;  4NIQ A;  5FMN A;  4Q25 A;  1IBM T;  1IJ6 A;  5IHY A;  4NUV A;  5ABG A;  4AQY T;  2CWY A;  5LG3 A;  2M6B A;  4IRE A;  1NEN A;  3ZPO A;  3SH1 A;  5AFK A;  3VKG A;  3L8R A;  1UV6 A;  3O1H A;  1WR6 A;  2NW8 A;  4MFR A;  3CQG B;  3KVB A;  1YKE B;  1LKX A;  3PDY A;  2HPJ A;  2BR7 A;  4ZI2 D;  4I4T E;  4YHJ A;  3QB5 K;  4WBO A;  5AFM A;  3IEE A;  1BR4 A;  2XY8 B;  1US7 B;  4JYA T;  3WI3 A;  3TLV A;  2VVS A;  4DR5 T;  3ETV A;  4TUY E;  4UM3 S;  2ZJV A;  2KIN B;  1E1H B;  3KBU A;  3UFE A;  2BYQ A;  4CI1 B;  4B3M T;  3KVA A;  2K5B B;  5M4Y A;  5LP6 E;  2PGZ A;  2KWH A;  1I94 T;  2CBJ A;  4Z90 A;  1D0X A;  5AFM B;  4AIS A;  5FVL A;  4ZI2 C;  2V5D A;  3OJA A;  1N32 T;  2J4G A;  5FNV E;  4A97 A;  4CXY A;  4CQI A;  4DBQ A;  5AQH B;  4H9N C;  5ABF A;  5HEJ A;  3Q5X A;  4IDQ A;  2PH9 A;  4YTN A;  5L3G B;  3ZYL A;  3WTL A;  4ZI3 D;  1W0B A;  4N78 D;  2BJ0 A;  4ZZC A;  4X64 T;  4ILC A;  2LEH A;  4KI0 F;  2BS4 A;  3NVO A;  4YLH A;  3RKO A;  2YU1 A;  2D2S A;  3LK4 2;  3M65 A;  2V7M A;  4WNK A;  3BQK A;  1IAP A;  2KLQ A;  1R8I A;  4UM1 A;  1UX5 A;  2VUR A;  5JDN A;  5DQW A;  2VK9 A;  4HWC A;  3EDV A;  2FJA A;  3WTH A;  4O2A E;  4ZI3 C;  2BZB A;  1XDP A;  2X0H A;  2IHR 1;  1SHZ C;  3PEO A;  2W00 A;  3GN5 A;  3O9X A;  3UU4 A;  3FHN A;  2E5L T;  2WS3 A;  2X9X A;  3HR0 A;  2WM9 A;  5LMN T;  3QB5 A;  4EAH A;  5HXR A;  3LK2 B;  3PUG A;  4GKK T;  4X65 T;  4ZK4 A;  2W67 A;  1J1J A;  4DV6 T;  3GN5 B;  4TZ4 C;  5J5G A;  4AKH A;  3I9Y A;  2WMO A;  3AE1 A;  2UXX B;  3I0Q A;  3UUM A;  1UUR A;  1XDO A;  3AE4 A;  5J2T E;  1EZ3 A;  4UR9 A;  4JI6 T;  4Z8X A;  3UUL A;  3AEB A;  3RIU C;  3C51 A;  1D1A A;  3SQ6 A;  2Y54 A; 
#chains in the Genus database with same CATH homology
 4ILC A;  3WTK A;  3RIA A;  3UU8 A;  2C9T A;  4UM3 A;  2BYS A;  3P50 A;  4XHE A;  5CO5 A;  1UW6 A;  4A98 A;  4HFH A;  3UU6 A;  3PMZ A;  4HFI A;  2QC1 B;  5HEG A;  4QH4 A;  3C79 A;  3C84 A;  2MAW A;  2BYP A;  4D01 A;  5LG3 A;  4QAC A;  5HCM A;  5HEO A;  2M6B A;  4IRE A;  2ZJU A;  4UM1 A;  2XQ9 A;  4COF A;  2LKH A;  5BP0 A;  5KZU A;  2Y56 A;  3SH1 A;  3UUB A;  5AFK A;  1UV6 A;  4BQT A;  3TLT A;  4IL4 A;  3EAM A;  4DBM A;  4ZRU A;  2XYT A;  2YMD A;  2XNV A;  2XZ6 A;  4F8H A;  4TNV A;  4PIR A;  4LML A;  5L4H A;  3UU5 A;  4FRR A;  2XQ4 A;  3TLS A;  5L4E A;  4Z91 A;  2WNJ A;  3WTH A;  5J5F A;  4ZR6 A;  2YOE A;  3LSV A;  3JAE A;  2M6I A;  2BR7 A;  4QH5 A;  3RQW A;  2X00 A;  2BYR A;  3WIP A;  5TVC A;  4AFH A;  5AFM A;  5KE4 A;  3IGQ A;  2LM2 A;  5J5I A;  4TNW A;  2KSR A;  4LMK A;  2Y58 A;  2WNL A;  3U8L A;  3TLV A;  5SYO A;  3PEO A;  4BFQ A;  1OED A;  2XQA A;  2Y57 A;  3UU4 A;  5HEU A;  1OED C;  2WNC A;  4NZB A;  2YME A;  2XQ5 A;  4UM3 S;  2Y7Y A;  2ZJV A;  5CFB A;  5BRX A;  2YN6 A;  5AFH A;  5L47 A;  2XQ3 A;  3ZKR A;  2BG9 C;  3SIO A;  2XQ8 A;  1UX2 A;  2W8F A;  3UQ4 A;  3JAF A;  4HFC A;  4NPP A;  5HCJ A;  2BR8 A;  2BYQ A;  4QAB A;  5J5H A;  4ZJS A;  3TLU A;  2WN9 A;  4IL9 A;  2PGZ A;  4QAA A;  4LMJ A;  4Z90 A;  4UY2 A;  5FJV A;  2YKS A;  4HFE A;  4TWF A;  2W8G A;  5AFM B;  3RQU A;  2XYS A;  4AFT A;  3RIF A;  3U8J A;  3RHW A;  3RI5 A;  4ZK4 A;  4UXU A;  4ZK1 A;  5AFN A;  4TWH A;  3WTO A;  4B5D A;  4UM3 P;  3TLW A;  3WTM A;  3WTJ A;  3UU3 A;  1OED B;  1OED E;  3WTI A;  5BW2 A;  3GUA A;  2LLY A;  5J5G A;  2XQ6 A;  5HEH A;  3T4M A;  5IUX A;  4EZ1 A;  2BG9 B;  2BG9 E;  2BG9 A;  2LKG A;  3EHZ A;  4A97 A;  4WV9 A;  5J0Z A;  1I9B A;  4XK9 A;  3SQ9 A;  3ZDH A;  2X00 D;  2XNU A;  4ZZB A;  2VL0 A;  4X5T A;  2WZY A;  3ZDG A;  4AFG A;  4ALX A;  4ZJT A;  4HQP A;  5HEJ A;  3U8N A;  3UQ7 A;  2XQ7 A;  3WTN A;  4TWD A;  2PH9 A;  5LXB A;  5AFJ A;  5AIN A;  5AFL A;  4HFB A;  4HFD A;  4ILB A;  4ILA A;  3JAD A;  2XNT A;  5JME A;  3SQ6 A;  2BYN A;  3WTL A;  4QH1 A;  3EI0 A;  3U8M A;  3P4W A;  2BJ0 A;  2Y54 A;  3U8K A;  2UZ6 A;  2XZ5 A;  4ZZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...