3LSVA

Structure of the a237f mutant of the pentameric ligand gated ion channel from gloeobacter violaceus
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ligand-gated ion channel
publication title One-microsecond molecular dynamics simulation of channel gating in a nicotinic receptor homologue.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 99
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3lsvA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3lsvA01
2XNTA 2XQ5A 4PIRA 5SYOA 2XQ7A 5J0ZA 3WTKA 5BRXA 3U8NA 3UU4A 4XK9A 4WV9A 3WTNA 2M6BA 5CFBA 3SQ9A 2LLYA 2XYSA 2Y57A 4AFTA 3RI5A 2Y58A 5CO5A 4QH1A 3WTIA 4IL9A 3SIOA 3TLVA 3P50A 5J5GA 4XHEA 4HFHA 4ILAA 4ZZCA 2YOEA 4FRRA 3SQ6A 3WTOA 5L47A 3TLWA 4ZZBA 5L4EA 4ZK4A 3EHZA 2BR7A 3UU8A 4QH4A 3UUBA 4LMJA 4ZK1A 5J5HA 2BG9A 4IREA 5HCMA 3U8LA 3U8KA 2XQ3A 2W8GA 3ZDHA 2YMDA 4ZR6A 5AFLA 4NZBA 5BP0A 4X5TA 2C9TA 5AFMA 4ZJSA 5KE4A 3WIPA 4UY2A 1OEDE 5AFJA 2LKHA 5HEGA 3JADA 4TWHA 2BYPA 2PH9A 2LM2A 3C79A 4AFGA 1UX2A 4TNVA 3EI0A 3SH1A 4HFDA 2BYQA 4UXUA 2BG9E 2BYNA 2M6IA 5AINA 3JAEA 4QAAA 3RIFA 3U8MA 3UU6A 4LMKA 2WNJA 4HQPA 4UM3P 4Z91A 5HEUA 2XZ5A 2XYTA 4ZRUA 2XNUA 5HCJA 2UZ6A 2ZJVA 4LMLA 4HFEA 4ALXA 5J5FA 4HFIA 4UM3A 5KZUA 3PMZA 4TWDA 3WTHA 5JMEA 1OEDB 4UM3S 3UU5A 4DBMA 4HFBA 1I9BA 1UW6A 2Y54A 5FJVA 4IL4A 3T4MA 4BQTA 5AFHA 5AFNA 3C84A 4HFCA 3LSVA 2WN9A 3ZDGA 3TLSA 4QH5A 2VL0A 3UQ7A 3TLTA 2BYRA 4AFHA 3WTJA 2XQ8A 2BJ0A 2BG9B 5HEHA 4A97A 3RHWA 3GUAA 4ILBA 2Y7YA 2BYSA 3WTMA 4ZJTA 5AFMB 4B5DA 3IGQA 2WZYA 4QABA 3P4WA 5L4HA 4TWFA 4BFQA 3JAFA 1OEDC 2KSRA 2XQAA 2MAWA 2YMEA 3UQ4A 1UV6A 3PEOA 3EAMA 3TLUA 4UM1A 2ZJUA 2YKSA 2XNVA 5HEJA 5TVCA 4D01A 3WTLA 5AFKA 4F8HA 2W8FA 2XQ4A 2BG9C 2XQ6A 1OEDA 2X00D 5J5IA 4A98A 5BW2A 5LG3A 2XQ9A 3RQWA 4Z90A 4NPPA 3RQUA 2XZ6A 4TNWA 2YN6A 3U8JA 2LKGA 3UU3A 5LXBA 3ZKRA 4QACA 2QC1B 2Y56A 4ILCA 3RIAA 2BR8A 2PGZA 5HEOA 4COFA 2WNCA 2X00A 4EZ1A 2WNLA 5IUXA
chains in the Genus database with same CATH superfamily
1N33T 2IUBA 2XTLA 4QXBB 3EVYA 1KFYA 2LT3A 3C4WA 4YHHT 3MXZA 3TLWA 4IDPA 1YKHB 3QNUA 4B3RT 4X65T 1LVKA 4DR5T 4PAGA 5IWAT 3WIPA 2L9QA 3OTOT 2XAQB 2CHOA 5ABEA 1W0BA 2LOPA 4IDOA 3WI3A 3C64A 3RC3A 4YT0A 4LF5T 3SS1A 2WNJA 1MIYA 2XAGB 4YY3T 4KBMB 4HGAA 2CWYA 3CIRA 3O1IA 2N1GA 5DQVA 2J4GA 4DV2T 1UK5A 4NXNT 2KZ7B 2W00A 4MFRA 3GUAA 3B5MA 4JUYA 5ABFA 2RA1A 3ETUA 4DV5T 4UV8B 2XUEA 4ISSA 4UM1A 2YKSA 2BKOA 3N5LA 4F8HA 3AB3B 2XQ4A 4KHPT 5BMVE 4JEHB 2WMNA 3Q9DA 5FY1A 2V26A 5LXBA 1SHZC 2DL1A 1QLBA 3LBXB 5M4YA 4HEAA 2CHNA 2WNLA 4JI7T 1LRZA 5BRXA 3ZMTB 2Y48B 3UFEA 5CFBA 2WQYA 4B3ST 2HH7A 2A2FX 4ADZA 5KXJA 4HE8A 4XHEA 4PJNA 3PUZF 3IHRA 4LMJA 1U5PA 2I6HA 5LHIB 5HCMA 3UFGA 3U8KA 2QVAA 3KV5A 1SE7A 1IZNB 2CRBA 4H9RC 3HKDE 2X9XA 5AQMB 5KE4A 3U78A 3C4XA 5FL1A 2K3WA 1UX2A 2KLQA 3ZCIA 2CXLA 2XAHB 3RPUA 5JDMA 2QYWA 4Z91A 2BBHA 2XAFB 5LMUT 2FBWA 5JQGE 4DBMA 2MYSA 4IL4A 4HWCA 2V7KA 3GN5B 4O4HE 5L3FB 2LSJA 4NUVA 2J47A 2BVLA 5FY7A 1FJGT 3KFWX 2L8KA 2KSRA 2IW5B 2EHOB 3BQIA 1KNZA 4D01A 3PTRB 4EYYR 3CKDA 2VQET 1J1JA 3HKBE 4HTEA 4BA9A 3N2KE 2Q9QD 1E2AA 1KF6A 5LGTB 2BS2A 3RKOA 4JLEA 4EEDA 5KX5E 2CWOA 4EZ1A 4OHFA 4PIRA 1X9BA 4H9PC 2L3LA 3HR0A 4H9QC 4AI6A 3E0ZA 3ONJA 4ZZCA 3FBZA 2DCFA 3CVRA 3R6NA 4ZK1A 4HN9A 2BG9A 4GIWA 2XQ3A 4F6RC 3ZDHA 3NRYA 5AFLA 5AFMA 1OEDE 2YDSA 5BR8T 4Z8XA 5AQRB 2D2SA 3RF1A 4DR1T 2WDRA 5J2UE 4DV7T 3U8MA 2OV9A 2NWBA 3AE7A 5CA0E 5AQTB 2XNUA 5JR9A 3AVSA 4YJ2E 4CI3B 2E2AA 1HG5A 3AA0B 1S94A 2CCQA 5AQUB 3B13A 3K3NA 1OWAA 2CLYC 3OYXA 2X0LB 3GMIA 5HXRA 2CLYB 3WTMA 4ZJTA 4YSXA 3ZYMA 3Q5WA 4G2AA 4UF0A 2YMEA 3UQ4A 3S4UA 1CUNA 2V6YA 3PURA 3VHLA 2N9DA 2KWHA 5L3CB 4ZI2D 4KUMB 3ZT7A 5AQOB 5ETWA 2YU1A 3EUHA 1US7B 4I55E 2W63A 5BW2A 2XQ9A 2NTYA 5EK4A 4BJMA 3AAAB 4OYJA 2AXDS 3PUAA 4UEMA 4COFA 1B7TA 3OPCA 3UT5E 4PJLA 4P0BA 2XQ7A 5IHYA 4ILUA 1FEWA 3QB5K 2M6BA 2LLYA 2K9AA 5CO5A 3ZSTA 2VWAA 3RYCE 5LNKA 1J5WA 1MMAA 4OK0A 4GK0E 3U8LA 4EZHA 3K3OA 2FJAA 3IEEA 3LFMA 1FMVA 2B1EA 4ZJSA 4JI4T 2X0HA 4PJJA 2PH9A 1J5ET 1D1BA 4JI5T 2A72A 3UU6A 5JREA 4YFSA 2XYTA 3DJBA 3FXDB 3P4SA 2Y6XA 4X66T 5DJQC 5A1LA 3L39A 1IJ5A 1HS7A 3O1HA 2R6GF 3WTJA 5LHGB 4A97A 2Q9QC 3O9XA 4CN1A 3PU8A 2Q9QB 3DP7A 4UXNB 2V7LA 1HX1B 4EAHA 1IBKT 1D0YA 4B3MT 3ZLIA 2JMKA 2WZIA 3D0TA 1HNXT 2CXFA 2XQ6A 3IBPA 4U33A 3FZFB 2UXCT 5J2TE 4WNKA 2WP9A 1XMOT 3HKCE 3H37A 3MZKB 4Z90A 2WS3A 2Y56A 2BR8A 3RRCA 2PGZA 1M7KA 3AXJB 2UUBT 2WNCA 3HL6A 2X9WA 3P8CD 4IDNA 3MKDA 3AEFA 3UU4A 2WM9A 3ZMVB 5FYMA 2BKPA 1NWMX 3RI5A 2LRLA 4P0AA 4TN7B 4C91A 1L0VA 4FRRA 1LVFA 3EHZA 4QH4A 2JQHA 3F57A 3I9WA 2ZLYA 2YMDA 1ZP0A 3I0QA 5JVDE 3AE4A 2K24A 5HEGA 3SH1A 4UXUA 4HWFA 3JCFA 4LMKA 2MTQA 2X51A 2WB5A 1YKEB 2V5CA 1Y01A 5LXTE 1I6ZA 3VRAA 4B6XA 3SRZA 4YLHA 3LG7A 4ZI2C 2ODUA 2FUPA 3UQ7A 2BG9B 2W61A 1NEKA 3RHWA 2PBIA 3ZC1A 3IA3A 5AFMB 2DWGA 2UUAT 1E1HB 3PDYA 2W2UA 5TVCA 5HXSA 3KINB 2OA5A 5J5IA 2CPTA 2V7IA 2CXDA 3NWIA 5JR9B 4ZEYA 3RH3A 1ZHCA 1ZKEA 4AQFA 5FMNA 4M1PA 4PNIA 2I0MA 2IC6A 1BR1A 1XNRT 2C5JA 4KP3C 3ZEFB 3AE9A 4AISA 1V9DA 2WCAA 3AE8A 3UUXB 1G73A 4GYSA 2Y58A 4IL9A 4UF0B 5LB7B 2E9XC 4ZK4A 1VRBA 1IBMT 2V6YB 1M62A 4U7IA 4CI1B 5F3JA 2EHOD 4NIQA 3PUWF 2X9YA 4ZR6A 2NR4A 3RYFE 4YSZA 4TV9E 2P9BA 1BR0A 3AEEA 2LM2A 2MPKA 3FBLA 4AKIA 2NW7A 3AA6B 4AKRB 4IE6A 1UX4A 2VVSA 3KV9A 3C50A 5J5FA 1WYCA 5LP6E 1T98A 1I9BA 3AA1B 3PUXF 3C84A 4HFCA 2C5IT 4H9OC 1O3XA 5IYZE 4QXCB 3ZN1B 5EK3A 4EZ4A 2E5LT 5FY0A 5L2LA 4YJ3E 4AKLA 3EAMA 2UXDT 1BR4A 3WTLA 2I59A 3ZJ2A 4ZS3A 3VKHA 3GWHA 1KNRA 3CK6A 2WBLA 5LA6E 2H3RA 2FJEA 2RP4A 2V1DB 3PV0F 5HEOA 1WCRA 3RRWA 2MOZA 4ASKA 5SYOA 1ZEEA 4QWNB 3AE3A 4XK9A 3NZQA 1HR0T 3SIOA 3ANWB 4EOZB 3WTOA 2JJ9A 5L4EA 3ZMUB 4EV6A 3OVUA 4QHOA 3PUYF 4KX6A 3PUGA 4TNVA 3JAEA 4KHZF 4CQIA 5AQKB 2BS4A 5AQLB 4ZRUA 4GKKT 3WTHA 5EZYE 2BVMA 1IJ6A 3FZKB 5LYJE 2YINA 3L09A 3TLSA 4A5XA 4X1YE 4PFPA 3AE5A 2XQ8A 3CQXC 3ZN0B 5HEHA 3FXEB 3MACA 4QABA 4TWFA 3N2GE 5F5WA 5JTGA 4HWHA 4EXTA 1S35A 2XNVA 2VURA 5JDNA 4ZXLA 1MIVA 3ZMZB 3OKQA 3PUVF 4K0UA 3U8JA 3ZT5A 3DTOA 3AE2A 4YHJA 4GYRA 2EHOC 3HKEE 5JRCA 2X66A 3QC9A 2XASB 4JYAT 4ZI3D 3WTKA 3QUJA 2XSAA 3N9OA 3UUMA 4YTPA 2Y57A 4CN4A 3AVRA 3P50A 5FP3A 1MMNA 4AQGA 5L47A 5FNVE 5DQWA 2BR7A 3Q5EA 4X62T 3AEDA 1QSDA 2VL8A 4JV5T 4TX5A 3LK3B 4GKJT 2WDVA 4NXMT 4L5GA 4TWHA 2LM9A 4IE0A 4DR3T 4MHCA 2BYQA 5DABA 3LJCA 3ZYKA 2B76A 3SWHA 2IAKA 2VASA 1N36T 2LRKA 4JI1T 3LDQB 2W66A 4PW8A 2IDOB 4DIDB 2WSSV 1OEDB 3UU5A 3ZYLA 5F8PA 4PK6A 1H7CA 3N9MA 2FJDA 1G8XA 3N9NA 2Y7YA 1I94T 3CPZA 4UVAB 1KNPA 1R8IA 3AECA 1FMWA 3LK42 4A98A 3OYZA 2IC9A 2BS3A 2WU5A 4JI8T 4OFZA 4QX8B 3KDSE 4N78D 1WR0A 4H63H 2X00A 4JI2T 3PU3A 3RYHE 3M65A 2WDQA 3H3AA 5AQJB 4H63V 5J5GA 5ABGA 2PJQA 1HX8A 3PUSA 5BP0A 4LFCT 2E9XA 4DR7T 3B57A 3FHNA 2CBIA 1D1AA 4IGUA 3JADA 1Z8UA 2JQ9A 5KMGP 4CXYA 4HFDA 1VOMA 5ABFB 2VKJA 5AQGB 5LGUB 4X1IE 3VR9A 3AEBA 3SOLA 1GQEA 5AQPB 2KMFA 4AKHA 3G06A 1D0XA 2C0SA 3LSVA 4IE5A 1UUSA 2DNXA 2K5BB 3SFEA 1WLXA 2UXXB 4K0KT 4LF7T 3VKGA 2D9DA 2NP9A 3VU7H 2DWKA 4MALA 3P4WA 2UU9T 4NUUA 4JBWF 5HWYA 3PEOA 2KINB 2ZJUA 3PUQA 2XY8B 2LJLA 3RYIE 4KMCA 3C4ZA 4AIUA 4O2AE 3NRXA 3I9YA 3UU3A 2V5DA 2J62A 4U72A 3SFDA 3X1DA 3P4RA 4I43B 4XZCA 3K3QC 2XQ5A 1HFAA 1OXZA 5JDLA 4MLKA 2XAJB 1QUUA 5LJMA 2CE7A 4YTNA 2FJBA 3MA9A 3UU8A 4QKNA 4JI0T 2W67A 2CM0A 3E22E 1WRDA 1N32T 2ZM8A 2VB6A 5CGMA 3AAIA 5AQNB 3E08A 2ZM2A 2C5KT 4UY2A 1XMQT 5HAXA 3RX6A 2VKDA 2BYPA 4AFGA 2J1DG 1JNZA 2UXBT 5HXCA 2M6IA 4DV1T 3N9PA 4CZZB 1UX5A 2WY2A 2ZM0A 4LF4T 3NKZA 4LMLA 4WW0A 1MMGA 1SUMB 2A3DA 1UCUA 2SPCA 1W9RA 2NW9A 5AFUL 4YTMA 1WYBA 2LSGA 3ZSSA 3CQGB 4KI0F 4ISTA 4XBFB 2BYSA 5FXXA 4EGWA 4H9NC 1WFDA 4HWIB 4CI2B 4H9SE 5EK2A 3J7Yq 2BG9C 1NAFA 5J1GA 2HN2A 3EABA 4TUYE 3WAJA 1IAPA 4JI6T 5FVKA 2JQKA 3P4QA 3P7IA 2XPKA 3PJAA 3ZKRA 4QACA 4CXWA 3RIAA 2BDEA 4FI5A 3LK2B 1WR6A 2F4VT 2VK9A 2XNTA 5J0ZA 3ONXA 5JR9C 4B3TT 4ZS2A 2X67A 3TLVA 3A5XA 2HPLA 3UUBA 1KK7A 4E7SA 1D0ZA 3Q2MA 3T1HT 2LKHA 4U7YA 2PG8A 3C79A 5JDHA 5HXHA 3C51A 2V7JA 4AXPA 2LHNA 4HKAA 2CEAA 2H7OA 5H6RB 2UZ6A 3UTKA 2ODVA 4HFIA 4DMVA 4YXDA 3PMZA 2X0YA 5JMEA 3NBXX 3QOFA 4IE7A 5LJNA 2Y54A 5FJVA 4BQTA 5H6QB 4QH5A 2VL0A 3TLTA 2HPJA 2BJ0A 3VR8A 3IGQA 5LG4A 5L4HA 3JAFA 5ADXL 1YXRA 2JMHA 1Y64B 2YEVC 4CN6A 2N2NA 2UUCT 3TLUA 5JDGA 4PK5A 1N34T 1HNZT 3KV6A 4EIWA 4DV4T 5JH7E 3UUNA 4WBNE 5FL0A 3MJXA 4X20E 2NOXA 3U8NA 1X79A 5KDMC 3T8OA 3WTNA 2W0GA 3RIUC 3L3PA 3NVOA 2WU2A 3GA8A 4DBRA 3N9LA 4OYKA 3W15B 3N2OA 4X5TA 3QB5A 5C2TA 5L3BB 1XDOA 2IMLA 3WAKA 3IF8B 2BYNA 5AINA 2LEHA 4O4LE 2A9UA 5CB4E 3CX8B 3CMLA 2HN1A 4A56A 2X68A 4UM3S 3VRBA 5AFNA 3T4MA 4OX9T 3ZDGA 4DNDA 4ILBA 5FKYA 3EDUA 2E5VA 2ZMAA 2WZYA 3U3IA 3R84B 4BFQA 1YQ4A 4DBQA 5LBMA 3KBUA 1HF8A 1ZOYA 4I0UA 5JDFA 4WBOA 2NW8A 5LG3A 4DV6T 2XZ6A 3AEAA 3AA7B 1Z0PA 3OJAA 2XHEB 1MMDA 4LFAT 2V7MA 4CXXA 2Q9QA 4WV9A 3PJAJ 4QX7B 2W4XA 3C98B 4QH1A 2D0UA 2W62A 4UIGA 4O4JE 5LCYA 2YOEA 2V6XA 4ZZBA 1HTJF 3F2EA 5J5HA 2VKHA 4IREA 5E0OA 1XWMA 4DUYT 4NZBA 2M67A 2WAUA 2K48A 3AXJA 1YW0A 2LSKA 4ERRA 1MNEA 4LF6T 4LF8T 2LE8A 3KVAA 4HQPA 4I4TE 5HEUA 3P4PA 3I0OA 2UXNB 5LHHB 1AJ3A 5KZUA 4I50E 4AQFC 2CBJA 3O4XE 2IHR1 2BYRA 4AFHA 2V8SV 2AE9A 5AQFB 3BK9A 2ACZA 4PJMA 4U2YA 2YDRA 3ONLC 2BKNA 5FXVA 1OEDC 2MAWA 1XDPA 2JQQA 5HEJA 1SA0E 2VKOA 3BQKA 4O8SA 3RKGA 4DO0A 5C8YE 4YSYA 4NPPA 3RQUA 1MIWA 2Y8DA 3I1AA 2QC1B 4ILCA 2QRXA 3KVBA 4IHJE 4IDQA 5LGNB 3AE6A 2D0TA 3AE1A 5HXEA 4Q25A 2H89A 3ZC0A 5LBQB 2YU2A 5L3DB 4ZHQE 3F31A 1LKXA 3O1JA 2ZM6T 4HFHA 5AQHB 4DMWA 5FXWA 3A7MA 3Q5XA 5CA1E 2W8GA 1YQ3A 5AQVB 2ACXA 4DUZT 4V1Av 2JPFA 2BBJA 1YD8G 4UVBB 4C90A 5TAOA 2WWVA 2XM2A 5JDQA 3RIFA 2GK9A 4EB6E 3RC8A 1HCIA 4JI3T 2D5UA 4DR4T 5HCJA 1T7SA 2KXPB 4FJOA 3HI2A 4DR6T 4TWDA 3ZT6A 4GK5E 4HFBA 4G63A 2YK0A 3KBTA 5AQSB 5LMNT 5ABHA 2OLTA 2XQYA 4TV8E 2DI4A 4L9IA 4XAXB 3ETVA 4DR2T 1E7PA 5AFKA 2W8FA 2HHHT 1JNRA 2X00D 5CJ5A 2X9HA 5L3GB 3JC6D 3EDVA 3AAEB 3A8YC 2JIWA 3PE0A 2MBGA 4HWDA 4IT4A 3AEGA 4ZI3C 3SQ9A 1W09A 3NZPA 2E9XD 1CHUA 3J9X1 4ILAA 3RIUA 2IIUA 1FIOA 2BZBA 4MBQA 3FZLB 4ZOLE 2C9TA 5C3JA 4O4IE 2XM1A 2QGSA 4J2CA 2JRKA 3ZJ1A 3EI0A 1HG2A 3FZHB 4U74A 1T8BA 3CX7B 4DVDA 1ZV4X 4UV9B 3OBVE 4UM3P 3ANWA 4U31A 4P1NA 4LFBT 2XZ5A 2ZJVA 1HNWT 4ALXA 4UM3A 4IE4A 2XJ7A 3M3ZB 1VCSA 1BR2A 3V5UA 2H88A 3N9QA 2DHRA 3LBXA 1UW6A 3FB2A 2NTXA 2ES0A 5FVLA 2WN9A 2QA7A 1UURA 3CX6B 5JRCB 4BJNA 4B5DA 4IDZA 2WWUA 2XQAA 2XZEA 2KT9A 2YDQA 3FZMB 1D1CA 5AQQB 1W0AA 3L8RA 4HFVA 3RGLA 3ESLA 2CA5A 1XNQT 2LHRA 4U2ZA 4DV3T 4ZI7E 1VCTA 2Z6EA 1U4QA 4L0RA 3CQCB 4IIJE 4EEBA 4WZXA 2XYSA 4AFTA 4ANJA 4TZ4C 3WTIA 4X64T 3TKLB 2KWIB 3SQ6A 1DU2A 1EZ3A 4U3CA 5GONE 3GN5A 4DV0T 2DLRA 4UELA 1T72A 3ABVA 1IBLT 2PTFA 3UULA 5AFJA 2H7VC 3KV4A 4EYUA 4BAYB 2EHOA 2E8IA 4PK4A 4WYVA 2CMRA 2BG9E 2RPAA 4QAAA 5HWXA 1MNDA 5L3EB 2PFVA 3K1SA 3T1YT 3ZCJA 4LF9T 5HYAA 5FXZA 3HA4A 1XZYA 4HFEA 5LOVE 5AQIB 4GOUA 3CWZB 4O2BE 1KEYA 3Q5DA 2VQFT 5AFHA 1NENA 2WMOA 2KNDA 3QK6A 2XSBA 4UVCB 3JC6C 3ZPOA 2G0UA 4E7ZA 3ZMSB 3H3MA 4AKGA 3K8PC 2LSIA 3V5SA 1UGOA 4PFOA 4X1KE 1UV6A 3RLFF 3MK7C 4UR9A 1OEDA 2LSYA 4QXHB 3RQWA 4P09A 4TNWA 2YN6A 3BQLA 2LKGA 2VVNA 4JEUB 2WZHA 2E9XB 2LOSA 4AQYT 5IUXA
chains in the Genus database with same CATH topology
2XNTA 2XQ5A 4PIRA 5SYOA 2XQ7A 5J0ZA 3WTKA 5BRXA 3U8NA 3UU4A 4XK9A 4WV9A 3WTNA 2M6BA 5CFBA 3SQ9A 2LLYA 2XYSA 2Y57A 4AFTA 3RI5A 2Y58A 5CO5A 4QH1A 3WTIA 4IL9A 3SIOA 3TLVA 3P50A 5J5GA 4XHEA 4HFHA 4ILAA 4ZZCA 2YOEA 4FRRA 3SQ6A 3WTOA 5L47A 3TLWA 4ZZBA 5L4EA 4ZK4A 3EHZA 2BR7A 3UU8A 4QH4A 3UUBA 4LMJA 4ZK1A 5J5HA 2BG9A 4IREA 5HCMA 3U8LA 3U8KA 2XQ3A 2W8GA 3ZDHA 2YMDA 4ZR6A 5AFLA 4NZBA 5BP0A 4X5TA 2C9TA 5AFMA 4ZJSA 5KE4A 3WIPA 4UY2A 1OEDE 5AFJA 2LKHA 5HEGA 3JADA 4TWHA 2BYPA 2PH9A 2LM2A 3C79A 4AFGA 1UX2A 4TNVA 3EI0A 3SH1A 4HFDA 2BYQA 4UXUA 2BG9E 2BYNA 2M6IA 5AINA 3JAEA 4QAAA 3RIFA 3U8MA 3UU6A 4LMKA 2WNJA 4HQPA 4UM3P 4Z91A 5HEUA 2XZ5A 2XYTA 4ZRUA 2XNUA 5HCJA 2UZ6A 2ZJVA 4LMLA 4HFEA 4ALXA 5J5FA 4HFIA 4UM3A 5KZUA 3PMZA 4TWDA 3WTHA 5JMEA 1OEDB 4UM3S 3UU5A 4DBMA 4HFBA 1I9BA 1UW6A 2Y54A 5FJVA 4IL4A 3T4MA 4BQTA 5AFHA 5AFNA 3C84A 4HFCA 3LSVA 2WN9A 3ZDGA 3TLSA 4QH5A 2VL0A 3UQ7A 3TLTA 2BYRA 4AFHA 3WTJA 2XQ8A 2BJ0A 2BG9B 5HEHA 4A97A 3RHWA 3GUAA 4ILBA 2Y7YA 2BYSA 3WTMA 4ZJTA 5AFMB 4B5DA 3IGQA 2WZYA 4QABA 3P4WA 5L4HA 4TWFA 4BFQA 3JAFA 1OEDC 2KSRA 2XQAA 2MAWA 2YMEA 3UQ4A 1UV6A 3PEOA 3EAMA 3TLUA 4UM1A 2ZJUA 2YKSA 2XNVA 5HEJA 5TVCA 4D01A 3WTLA 5AFKA 4F8HA 2W8FA 2XQ4A 2BG9C 2XQ6A 1OEDA 2X00D 5J5IA 4A98A 5BW2A 5LG3A 2XQ9A 3RQWA 4Z90A 4NPPA 3RQUA 2XZ6A 4TNWA 2YN6A 3U8JA 2LKGA 3UU3A 5LXBA 3ZKRA 4QACA 2QC1B 2Y56A 4ILCA 3RIAA 2BR8A 2PGZA 5HEOA 4COFA 2WNCA 2X00A 4EZ1A 2WNLA 5IUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XNT A;  2XQ5 A;  4PIR A;  5SYO A;  2XQ7 A;  5J0Z A;  3WTK A;  5BRX A;  3U8N A;  3UU4 A;  4XK9 A;  4WV9 A;  3WTN A;  2M6B A;  5CFB A;  3SQ9 A;  2LLY A;  2XYS A;  2Y57 A;  4AFT A;  3RI5 A;  2Y58 A;  5CO5 A;  4QH1 A;  3WTI A;  4IL9 A;  3SIO A;  3TLV A;  3P50 A;  5J5G A;  4XHE A;  4HFH A;  4ILA A;  4ZZC A;  2YOE A;  4FRR A;  3SQ6 A;  3WTO A;  5L47 A;  3TLW A;  4ZZB A;  5L4E A;  4ZK4 A;  3EHZ A;  2BR7 A;  3UU8 A;  4QH4 A;  3UUB A;  4LMJ A;  4ZK1 A;  5J5H A;  2BG9 A;  4IRE A;  5HCM A;  3U8L A;  3U8K A;  2XQ3 A;  2W8G A;  3ZDH A;  2YMD A;  4ZR6 A;  5AFL A;  4NZB A;  5BP0 A;  4X5T A;  2C9T A;  5AFM A;  4ZJS A;  5KE4 A;  3WIP A;  4UY2 A;  1OED E;  5AFJ A;  2LKH A;  5HEG A;  3JAD A;  4TWH A;  2BYP A;  2PH9 A;  2LM2 A;  3C79 A;  4AFG A;  1UX2 A;  4TNV A;  3EI0 A;  3SH1 A;  4HFD A;  2BYQ A;  4UXU A;  2BG9 E;  2BYN A;  2M6I A;  5AIN A;  3JAE A;  4QAA A;  3RIF A;  3U8M A;  3UU6 A;  4LMK A;  2WNJ A;  4HQP A;  4UM3 P;  4Z91 A;  5HEU A;  2XZ5 A;  2XYT A;  4ZRU A;  2XNU A;  5HCJ A;  2UZ6 A;  2ZJV A;  4LML A;  4HFE A;  4ALX A;  5J5F A;  4HFI A;  4UM3 A;  5KZU A;  3PMZ A;  4TWD A;  3WTH A;  5JME A;  1OED B;  4UM3 S;  3UU5 A;  4DBM A;  4HFB A;  1I9B A;  1UW6 A;  2Y54 A;  5FJV A;  4IL4 A;  3T4M A;  4BQT A;  5AFH A;  5AFN A;  3C84 A;  4HFC A;  3LSV A;  2WN9 A;  3ZDG A;  3TLS A;  4QH5 A;  2VL0 A;  3UQ7 A;  3TLT A;  2BYR A;  4AFH A;  3WTJ A;  2XQ8 A;  2BJ0 A;  2BG9 B;  5HEH A;  4A97 A;  3RHW A;  3GUA A;  4ILB A;  2Y7Y A;  2BYS A;  3WTM A;  4ZJT A;  5AFM B;  4B5D A;  3IGQ A;  2WZY A;  4QAB A;  3P4W A;  5L4H A;  4TWF A;  4BFQ A;  3JAF A;  1OED C;  2KSR A;  2XQA A;  2MAW A;  2YME A;  3UQ4 A;  1UV6 A;  3PEO A;  3EAM A;  3TLU A;  4UM1 A;  2ZJU A;  2YKS A;  2XNV A;  5HEJ A;  5TVC A;  4D01 A;  3WTL A;  5AFK A;  4F8H A;  2W8F A;  2XQ4 A;  2BG9 C;  2XQ6 A;  1OED A;  2X00 D;  5J5I A;  4A98 A;  5BW2 A;  5LG3 A;  2XQ9 A;  3RQW A;  4Z90 A;  4NPP A;  3RQU A;  2XZ6 A;  4TNW A;  2YN6 A;  3U8J A;  2LKG A;  3UU3 A;  5LXB A;  3ZKR A;  4QAC A;  2QC1 B;  2Y56 A;  4ILC A;  3RIA A;  2BR8 A;  2PGZ A;  5HEO A;  4COF A;  2WNC A;  2X00 A;  4EZ1 A;  2WNL A;  5IUX A; 
#chains in the Genus database with same CATH topology
 1N33 T;  2IUB A;  2XTL A;  4QXB B;  3EVY A;  1KFY A;  2LT3 A;  3C4W A;  4YHH T;  3MXZ A;  3TLW A;  4IDP A;  1YKH B;  3QNU A;  4B3R T;  4X65 T;  1LVK A;  4DR5 T;  4PAG A;  5IWA T;  3WIP A;  2L9Q A;  3OTO T;  2XAQ B;  2CHO A;  5ABE A;  1W0B A;  2LOP A;  4IDO A;  3WI3 A;  3C64 A;  3RC3 A;  4YT0 A;  4LF5 T;  3SS1 A;  2WNJ A;  1MIY A;  2XAG B;  4YY3 T;  4KBM B;  4HGA A;  2CWY A;  3CIR A;  3O1I A;  2N1G A;  5DQV A;  2J4G A;  4DV2 T;  1UK5 A;  4NXN T;  2KZ7 B;  2W00 A;  4MFR A;  3GUA A;  3B5M A;  4JUY A;  5ABF A;  2RA1 A;  3ETU A;  4DV5 T;  4UV8 B;  2XUE A;  4ISS A;  4UM1 A;  2YKS A;  2BKO A;  3N5L A;  4F8H A;  3AB3 B;  2XQ4 A;  4KHP T;  5BMV E;  4JEH B;  2WMN A;  3Q9D A;  5FY1 A;  2V26 A;  5LXB A;  1SHZ C;  2DL1 A;  1QLB A;  3LBX B;  5M4Y A;  4HEA A;  2CHN A;  2WNL A;  4JI7 T;  1LRZ A;  5BRX A;  3ZMT B;  2Y48 B;  3UFE A;  5CFB A;  2WQY A;  4B3S T;  2HH7 A;  2A2F X;  4ADZ A;  5KXJ A;  4HE8 A;  4XHE A;  4PJN A;  3PUZ F;  3IHR A;  4LMJ A;  1U5P A;  2I6H A;  5LHI B;  5HCM A;  3UFG A;  3U8K A;  2QVA A;  3KV5 A;  1SE7 A;  1IZN B;  2CRB A;  4H9R C;  3HKD E;  2X9X A;  5AQM B;  5KE4 A;  3U78 A;  3C4X A;  5FL1 A;  2K3W A;  1UX2 A;  2KLQ A;  3ZCI A;  2CXL A;  2XAH B;  3RPU A;  5JDM A;  2QYW A;  4Z91 A;  2BBH A;  2XAF B;  5LMU T;  2FBW A;  5JQG E;  4DBM A;  2MYS A;  4IL4 A;  4HWC A;  2V7K A;  3GN5 B;  4O4H E;  5L3F B;  2LSJ A;  4NUV A;  2J47 A;  2BVL A;  5FY7 A;  1FJG T;  3KFW X;  2L8K A;  2KSR A;  2IW5 B;  2EHO B;  3BQI A;  1KNZ A;  4D01 A;  3PTR B;  4EYY R;  3CKD A;  2VQE T;  1J1J A;  3HKB E;  4HTE A;  4BA9 A;  3N2K E;  2Q9Q D;  1E2A A;  1KF6 A;  5LGT B;  2BS2 A;  3RKO A;  4JLE A;  4EED A;  5KX5 E;  2CWO A;  4EZ1 A;  4OHF A;  4PIR A;  1X9B A;  4H9P C;  2L3L A;  3HR0 A;  4H9Q C;  4AI6 A;  3E0Z A;  3ONJ A;  4ZZC A;  3FBZ A;  2DCF A;  3CVR A;  3R6N A;  4ZK1 A;  4HN9 A;  2BG9 A;  4GIW A;  2XQ3 A;  4F6R C;  3ZDH A;  3NRY A;  5AFL A;  5AFM A;  1OED E;  2YDS A;  5BR8 T;  4Z8X A;  5AQR B;  2D2S A;  3RF1 A;  4DR1 T;  2WDR A;  5J2U E;  4DV7 T;  3U8M A;  2OV9 A;  2NWB A;  3AE7 A;  5CA0 E;  5AQT B;  2XNU A;  5JR9 A;  3AVS A;  4YJ2 E;  4CI3 B;  2E2A A;  1HG5 A;  3AA0 B;  1S94 A;  2CCQ A;  5AQU B;  3B13 A;  3K3N A;  1OWA A;  2CLY C;  3OYX A;  2X0L B;  3GMI A;  5HXR A;  2CLY B;  3WTM A;  4ZJT A;  4YSX A;  3ZYM A;  3Q5W A;  4G2A A;  4UF0 A;  2YME A;  3UQ4 A;  3S4U A;  1CUN A;  2V6Y A;  3PUR A;  3VHL A;  2N9D A;  2KWH A;  5L3C B;  4ZI2 D;  4KUM B;  3ZT7 A;  5AQO B;  5ETW A;  2YU1 A;  3EUH A;  1US7 B;  4I55 E;  2W63 A;  5BW2 A;  2XQ9 A;  2NTY A;  5EK4 A;  4BJM A;  3AAA B;  4OYJ A;  2AXD S;  3PUA A;  4UEM A;  4COF A;  1B7T A;  3OPC A;  3UT5 E;  4PJL A;  4P0B A;  2XQ7 A;  5IHY A;  4ILU A;  1FEW A;  3QB5 K;  2M6B A;  2LLY A;  2K9A A;  5CO5 A;  3ZST A;  2VWA A;  3RYC E;  5LNK A;  1J5W A;  1MMA A;  4OK0 A;  4GK0 E;  3U8L A;  4EZH A;  3K3O A;  2FJA A;  3IEE A;  3LFM A;  1FMV A;  2B1E A;  4ZJS A;  4JI4 T;  2X0H A;  4PJJ A;  2PH9 A;  1J5E T;  1D1B A;  4JI5 T;  2A72 A;  3UU6 A;  5JRE A;  4YFS A;  2XYT A;  3DJB A;  3FXD B;  3P4S A;  2Y6X A;  4X66 T;  5DJQ C;  5A1L A;  3L39 A;  1IJ5 A;  1HS7 A;  3O1H A;  2R6G F;  3WTJ A;  5LHG B;  4A97 A;  2Q9Q C;  3O9X A;  4CN1 A;  3PU8 A;  2Q9Q B;  3DP7 A;  4UXN B;  2V7L A;  1HX1 B;  4EAH A;  1IBK T;  1D0Y A;  4B3M T;  3ZLI A;  2JMK A;  2WZI A;  3D0T A;  1HNX T;  2CXF A;  2XQ6 A;  3IBP A;  4U33 A;  3FZF B;  2UXC T;  5J2T E;  4WNK A;  2WP9 A;  1XMO T;  3HKC E;  3H37 A;  3MZK B;  4Z90 A;  2WS3 A;  2Y56 A;  2BR8 A;  3RRC A;  2PGZ A;  1M7K A;  3AXJ B;  2UUB T;  2WNC A;  3HL6 A;  2X9W A;  3P8C D;  4IDN A;  3MKD A;  3AEF A;  3UU4 A;  2WM9 A;  3ZMV B;  5FYM A;  2BKP A;  1NWM X;  3RI5 A;  2LRL A;  4P0A A;  4TN7 B;  4C91 A;  1L0V A;  4FRR A;  1LVF A;  3EHZ A;  4QH4 A;  2JQH A;  3F57 A;  3I9W A;  2ZLY A;  2YMD A;  1ZP0 A;  3I0Q A;  5JVD E;  3AE4 A;  2K24 A;  5HEG A;  3SH1 A;  4UXU A;  4HWF A;  3JCF A;  4LMK A;  2MTQ A;  2X51 A;  2WB5 A;  1YKE B;  2V5C A;  1Y01 A;  5LXT E;  1I6Z A;  3VRA A;  4B6X A;  3SRZ A;  4YLH A;  3LG7 A;  4ZI2 C;  2ODU A;  2FUP A;  3UQ7 A;  2BG9 B;  2W61 A;  1NEK A;  3RHW A;  2PBI A;  3ZC1 A;  3IA3 A;  5AFM B;  2DWG A;  2UUA T;  1E1H B;  3PDY A;  2W2U A;  5TVC A;  5HXS A;  3KIN B;  2OA5 A;  5J5I A;  2CPT A;  2V7I A;  2CXD A;  3NWI A;  5JR9 B;  4ZEY A;  3RH3 A;  1ZHC A;  1ZKE A;  4AQF A;  5FMN A;  4M1P A;  4PNI A;  2I0M A;  2IC6 A;  1BR1 A;  1XNR T;  2C5J A;  4KP3 C;  3ZEF B;  3AE9 A;  4AIS A;  1V9D A;  2WCA A;  3AE8 A;  3UUX B;  1G73 A;  4GYS A;  2Y58 A;  4IL9 A;  4UF0 B;  5LB7 B;  2E9X C;  4ZK4 A;  1VRB A;  1IBM T;  2V6Y B;  1M62 A;  4U7I A;  4CI1 B;  5F3J A;  2EHO D;  4NIQ A;  3PUW F;  2X9Y A;  4ZR6 A;  2NR4 A;  3RYF E;  4YSZ A;  4TV9 E;  2P9B A;  1BR0 A;  3AEE A;  2LM2 A;  2MPK A;  3FBL A;  4AKI A;  2NW7 A;  3AA6 B;  4AKR B;  4IE6 A;  1UX4 A;  2VVS A;  3KV9 A;  3C50 A;  5J5F A;  1WYC A;  5LP6 E;  1T98 A;  1I9B A;  3AA1 B;  3PUX F;  3C84 A;  4HFC A;  2C5I T;  4H9O C;  1O3X A;  5IYZ E;  4QXC B;  3ZN1 B;  5EK3 A;  4EZ4 A;  2E5L T;  5FY0 A;  5L2L A;  4YJ3 E;  4AKL A;  3EAM A;  2UXD T;  1BR4 A;  3WTL A;  2I59 A;  3ZJ2 A;  4ZS3 A;  3VKH A;  3GWH A;  1KNR A;  3CK6 A;  2WBL A;  5LA6 E;  2H3R A;  2FJE A;  2RP4 A;  2V1D B;  3PV0 F;  5HEO A;  1WCR A;  3RRW A;  2MOZ A;  4ASK A;  5SYO A;  1ZEE A;  4QWN B;  3AE3 A;  4XK9 A;  3NZQ A;  1HR0 T;  3SIO A;  3ANW B;  4EOZ B;  3WTO A;  2JJ9 A;  5L4E A;  3ZMU B;  4EV6 A;  3OVU A;  4QHO A;  3PUY F;  4KX6 A;  3PUG A;  4TNV A;  3JAE A;  4KHZ F;  4CQI A;  5AQK B;  2BS4 A;  5AQL B;  4ZRU A;  4GKK T;  3WTH A;  5EZY E;  2BVM A;  1IJ6 A;  3FZK B;  5LYJ E;  2YIN A;  3L09 A;  3TLS A;  4A5X A;  4X1Y E;  4PFP A;  3AE5 A;  2XQ8 A;  3CQX C;  3ZN0 B;  5HEH A;  3FXE B;  3MAC A;  4QAB A;  4TWF A;  3N2G E;  5F5W A;  5JTG A;  4HWH A;  4EXT A;  1S35 A;  2XNV A;  2VUR A;  5JDN A;  4ZXL A;  1MIV A;  3ZMZ B;  3OKQ A;  3PUV F;  4K0U A;  3U8J A;  3ZT5 A;  3DTO A;  3AE2 A;  4YHJ A;  4GYR A;  2EHO C;  3HKE E;  5JRC A;  2X66 A;  3QC9 A;  2XAS B;  4JYA T;  4ZI3 D;  3WTK A;  3QUJ A;  2XSA A;  3N9O A;  3UUM A;  4YTP A;  2Y57 A;  4CN4 A;  3AVR A;  3P50 A;  5FP3 A;  1MMN A;  4AQG A;  5L47 A;  5FNV E;  5DQW A;  2BR7 A;  3Q5E A;  4X62 T;  3AED A;  1QSD A;  2VL8 A;  4JV5 T;  4TX5 A;  3LK3 B;  4GKJ T;  2WDV A;  4NXM T;  4L5G A;  4TWH A;  2LM9 A;  4IE0 A;  4DR3 T;  4MHC A;  2BYQ A;  5DAB A;  3LJC A;  3ZYK A;  2B76 A;  3SWH A;  2IAK A;  2VAS A;  1N36 T;  2LRK A;  4JI1 T;  3LDQ B;  2W66 A;  4PW8 A;  2IDO B;  4DID B;  2WSS V;  1OED B;  3UU5 A;  3ZYL A;  5F8P A;  4PK6 A;  1H7C A;  3N9M A;  2FJD A;  1G8X A;  3N9N A;  2Y7Y A;  1I94 T;  3CPZ A;  4UVA B;  1KNP A;  1R8I A;  3AEC A;  1FMW A;  3LK4 2;  4A98 A;  3OYZ A;  2IC9 A;  2BS3 A;  2WU5 A;  4JI8 T;  4OFZ A;  4QX8 B;  3KDS E;  4N78 D;  1WR0 A;  4H63 H;  2X00 A;  4JI2 T;  3PU3 A;  3RYH E;  3M65 A;  2WDQ A;  3H3A A;  5AQJ B;  4H63 V;  5J5G A;  5ABG A;  2PJQ A;  1HX8 A;  3PUS A;  5BP0 A;  4LFC T;  2E9X A;  4DR7 T;  3B57 A;  3FHN A;  2CBI A;  1D1A A;  4IGU A;  3JAD A;  1Z8U A;  2JQ9 A;  5KMG P;  4CXY A;  4HFD A;  1VOM A;  5ABF B;  2VKJ A;  5AQG B;  5LGU B;  4X1I E;  3VR9 A;  3AEB A;  3SOL A;  1GQE A;  5AQP B;  2KMF A;  4AKH A;  3G06 A;  1D0X A;  2C0S A;  3LSV A;  4IE5 A;  1UUS A;  2DNX A;  2K5B B;  3SFE A;  1WLX A;  2UXX B;  4K0K T;  4LF7 T;  3VKG A;  2D9D A;  2NP9 A;  3VU7 H;  2DWK A;  4MAL A;  3P4W A;  2UU9 T;  4NUU A;  4JBW F;  5HWY A;  3PEO A;  2KIN B;  2ZJU A;  3PUQ A;  2XY8 B;  2LJL A;  3RYI E;  4KMC A;  3C4Z A;  4AIU A;  4O2A E;  3NRX A;  3I9Y A;  3UU3 A;  2V5D A;  2J62 A;  4U72 A;  3SFD A;  3X1D A;  3P4R A;  4I43 B;  4XZC A;  3K3Q C;  2XQ5 A;  1HFA A;  1OXZ A;  5JDL A;  4MLK A;  2XAJ B;  1QUU A;  5LJM A;  2CE7 A;  4YTN A;  2FJB A;  3MA9 A;  3UU8 A;  4QKN A;  4JI0 T;  2W67 A;  2CM0 A;  3E22 E;  1WRD A;  1N32 T;  2ZM8 A;  2VB6 A;  5CGM A;  3AAI A;  5AQN B;  3E08 A;  2ZM2 A;  2C5K T;  4UY2 A;  1XMQ T;  5HAX A;  3RX6 A;  2VKD A;  2BYP A;  4AFG A;  2J1D G;  1JNZ A;  2UXB T;  5HXC A;  2M6I A;  4DV1 T;  3N9P A;  4CZZ B;  1UX5 A;  2WY2 A;  2ZM0 A;  4LF4 T;  3NKZ A;  4LML A;  4WW0 A;  1MMG A;  1SUM B;  2A3D A;  1UCU A;  2SPC A;  1W9R A;  2NW9 A;  5AFU L;  4YTM A;  1WYB A;  2LSG A;  3ZSS A;  3CQG B;  4KI0 F;  4IST A;  4XBF B;  2BYS A;  5FXX A;  4EGW A;  4H9N C;  1WFD A;  4HWI B;  4CI2 B;  4H9S E;  5EK2 A;  3J7Y q;  2BG9 C;  1NAF A;  5J1G A;  2HN2 A;  3EAB A;  4TUY E;  3WAJ A;  1IAP A;  4JI6 T;  5FVK A;  2JQK A;  3P4Q A;  3P7I A;  2XPK A;  3PJA A;  3ZKR A;  4QAC A;  4CXW A;  3RIA A;  2BDE A;  4FI5 A;  3LK2 B;  1WR6 A;  2F4V T;  2VK9 A;  2XNT A;  5J0Z A;  3ONX A;  5JR9 C;  4B3T T;  4ZS2 A;  2X67 A;  3TLV A;  3A5X A;  2HPL A;  3UUB A;  1KK7 A;  4E7S A;  1D0Z A;  3Q2M A;  3T1H T;  2LKH A;  4U7Y A;  2PG8 A;  3C79 A;  5JDH A;  5HXH A;  3C51 A;  2V7J A;  4AXP A;  2LHN A;  4HKA A;  2CEA A;  2H7O A;  5H6R B;  2UZ6 A;  3UTK A;  2ODV A;  4HFI A;  4DMV A;  4YXD A;  3PMZ A;  2X0Y A;  5JME A;  3NBX X;  3QOF A;  4IE7 A;  5LJN A;  2Y54 A;  5FJV A;  4BQT A;  5H6Q B;  4QH5 A;  2VL0 A;  3TLT A;  2HPJ A;  2BJ0 A;  3VR8 A;  3IGQ A;  5LG4 A;  5L4H A;  3JAF A;  5ADX L;  1YXR A;  2JMH A;  1Y64 B;  2YEV C;  4CN6 A;  2N2N A;  2UUC T;  3TLU A;  5JDG A;  4PK5 A;  1N34 T;  1HNZ T;  3KV6 A;  4EIW A;  4DV4 T;  5JH7 E;  3UUN A;  4WBN E;  5FL0 A;  3MJX A;  4X20 E;  2NOX A;  3U8N A;  1X79 A;  5KDM C;  3T8O A;  3WTN A;  2W0G A;  3RIU C;  3L3P A;  3NVO A;  2WU2 A;  3GA8 A;  4DBR A;  3N9L A;  4OYK A;  3W15 B;  3N2O A;  4X5T A;  3QB5 A;  5C2T A;  5L3B B;  1XDO A;  2IML A;  3WAK A;  3IF8 B;  2BYN A;  5AIN A;  2LEH A;  4O4L E;  2A9U A;  5CB4 E;  3CX8 B;  3CML A;  2HN1 A;  4A56 A;  2X68 A;  4UM3 S;  3VRB A;  5AFN A;  3T4M A;  4OX9 T;  3ZDG A;  4DND A;  4ILB A;  5FKY A;  3EDU A;  2E5V A;  2ZMA A;  2WZY A;  3U3I A;  3R84 B;  4BFQ A;  1YQ4 A;  4DBQ A;  5LBM A;  3KBU A;  1HF8 A;  1ZOY A;  4I0U A;  5JDF A;  4WBO A;  2NW8 A;  5LG3 A;  4DV6 T;  2XZ6 A;  3AEA A;  3AA7 B;  1Z0P A;  3OJA A;  2XHE B;  1MMD A;  4LFA T;  2V7M A;  4CXX A;  2Q9Q A;  4WV9 A;  3PJA J;  4QX7 B;  2W4X A;  3C98 B;  4QH1 A;  2D0U A;  2W62 A;  4UIG A;  4O4J E;  5LCY A;  2YOE A;  2V6X A;  4ZZB A;  1HTJ F;  3F2E A;  5J5H A;  2VKH A;  4IRE A;  5E0O A;  1XWM A;  4DUY T;  4NZB A;  2M67 A;  2WAU A;  2K48 A;  3AXJ A;  1YW0 A;  2LSK A;  4ERR A;  1MNE A;  4LF6 T;  4LF8 T;  2LE8 A;  3KVA A;  4HQP A;  4I4T E;  5HEU A;  3P4P A;  3I0O A;  2UXN B;  5LHH B;  1AJ3 A;  5KZU A;  4I50 E;  4AQF C;  2CBJ A;  3O4X E;  2IHR 1;  2BYR A;  4AFH A;  2V8S V;  2AE9 A;  5AQF B;  3BK9 A;  2ACZ A;  4PJM A;  4U2Y A;  2YDR A;  3ONL C;  2BKN A;  5FXV A;  1OED C;  2MAW A;  1XDP A;  2JQQ A;  5HEJ A;  1SA0 E;  2VKO A;  3BQK A;  4O8S A;  3RKG A;  4DO0 A;  5C8Y E;  4YSY A;  4NPP A;  3RQU A;  1MIW A;  2Y8D A;  3I1A A;  2QC1 B;  4ILC A;  2QRX A;  3KVB A;  4IHJ E;  4IDQ A;  5LGN B;  3AE6 A;  2D0T A;  3AE1 A;  5HXE A;  4Q25 A;  2H89 A;  3ZC0 A;  5LBQ B;  2YU2 A;  5L3D B;  4ZHQ E;  3F31 A;  1LKX A;  3O1J A;  2ZM6 T;  4HFH A;  5AQH B;  4DMW A;  5FXW A;  3A7M A;  3Q5X A;  5CA1 E;  2W8G A;  1YQ3 A;  5AQV B;  2ACX A;  4DUZ T;  4V1A v;  2JPF A;  2BBJ A;  1YD8 G;  4UVB B;  4C90 A;  5TAO A;  2WWV A;  2XM2 A;  5JDQ A;  3RIF A;  2GK9 A;  4EB6 E;  3RC8 A;  1HCI A;  4JI3 T;  2D5U A;  4DR4 T;  5HCJ A;  1T7S A;  2KXP B;  4FJO A;  3HI2 A;  4DR6 T;  4TWD A;  3ZT6 A;  4GK5 E;  4HFB A;  4G63 A;  2YK0 A;  3KBT A;  5AQS B;  5LMN T;  5ABH A;  2OLT A;  2XQY A;  4TV8 E;  2DI4 A;  4L9I A;  4XAX B;  3ETV A;  4DR2 T;  1E7P A;  5AFK A;  2W8F A;  2HHH T;  1JNR A;  2X00 D;  5CJ5 A;  2X9H A;  5L3G B;  3JC6 D;  3EDV A;  3AAE B;  3A8Y C;  2JIW A;  3PE0 A;  2MBG A;  4HWD A;  4IT4 A;  3AEG A;  4ZI3 C;  3SQ9 A;  1W09 A;  3NZP A;  2E9X D;  1CHU A;  3J9X 1;  4ILA A;  3RIU A;  2IIU A;  1FIO A;  2BZB A;  4MBQ A;  3FZL B;  4ZOL E;  2C9T A;  5C3J A;  4O4I E;  2XM1 A;  2QGS A;  4J2C A;  2JRK A;  3ZJ1 A;  3EI0 A;  1HG2 A;  3FZH B;  4U74 A;  1T8B A;  3CX7 B;  4DVD A;  1ZV4 X;  4UV9 B;  3OBV E;  4UM3 P;  3ANW A;  4U31 A;  4P1N A;  4LFB T;  2XZ5 A;  2ZJV A;  1HNW T;  4ALX A;  4UM3 A;  4IE4 A;  2XJ7 A;  3M3Z B;  1VCS A;  1BR2 A;  3V5U A;  2H88 A;  3N9Q A;  2DHR A;  3LBX A;  1UW6 A;  3FB2 A;  2NTX A;  2ES0 A;  5FVL A;  2WN9 A;  2QA7 A;  1UUR A;  3CX6 B;  5JRC B;  4BJN A;  4B5D A;  4IDZ A;  2WWU A;  2XQA A;  2XZE A;  2KT9 A;  2YDQ A;  3FZM B;  1D1C A;  5AQQ B;  1W0A A;  3L8R A;  4HFV A;  3RGL A;  3ESL A;  2CA5 A;  1XNQ T;  2LHR A;  4U2Z A;  4DV3 T;  4ZI7 E;  1VCT A;  2Z6E A;  1U4Q A;  4L0R A;  3CQC B;  4IIJ E;  4EEB A;  4WZX A;  2XYS A;  4AFT A;  4ANJ A;  4TZ4 C;  3WTI A;  4X64 T;  3TKL B;  2KWI B;  3SQ6 A;  1DU2 A;  1EZ3 A;  4U3C A;  5GON E;  3GN5 A;  4DV0 T;  2DLR A;  4UEL A;  1T72 A;  3ABV A;  1IBL T;  2PTF A;  3UUL A;  5AFJ A;  2H7V C;  3KV4 A;  4EYU A;  4BAY B;  2EHO A;  2E8I A;  4PK4 A;  4WYV A;  2CMR A;  2BG9 E;  2RPA A;  4QAA A;  5HWX A;  1MND A;  5L3E B;  2PFV A;  3K1S A;  3T1Y T;  3ZCJ A;  4LF9 T;  5HYA A;  5FXZ A;  3HA4 A;  1XZY A;  4HFE A;  5LOV E;  5AQI B;  4GOU A;  3CWZ B;  4O2B E;  1KEY A;  3Q5D A;  2VQF T;  5AFH A;  1NEN A;  2WMO A;  2KND A;  3QK6 A;  2XSB A;  4UVC B;  3JC6 C;  3ZPO A;  2G0U A;  4E7Z A;  3ZMS B;  3H3M A;  4AKG A;  3K8P C;  2LSI A;  3V5S A;  1UGO A;  4PFO A;  4X1K E;  1UV6 A;  3RLF F;  3MK7 C;  4UR9 A;  1OED A;  2LSY A;  4QXH B;  3RQW A;  4P09 A;  4TNW A;  2YN6 A;  3BQL A;  2LKG A;  2VVN A;  4JEU B;  2WZH A;  2E9X B;  2LOS A;  4AQY T;  5IUX A; 
#chains in the Genus database with same CATH homology
 2XNT A;  2XQ5 A;  4PIR A;  5SYO A;  2XQ7 A;  5J0Z A;  3WTK A;  5BRX A;  3U8N A;  3UU4 A;  4XK9 A;  4WV9 A;  3WTN A;  2M6B A;  5CFB A;  3SQ9 A;  2LLY A;  2XYS A;  2Y57 A;  4AFT A;  3RI5 A;  2Y58 A;  5CO5 A;  4QH1 A;  3WTI A;  4IL9 A;  3SIO A;  3TLV A;  3P50 A;  5J5G A;  4XHE A;  4HFH A;  4ILA A;  4ZZC A;  2YOE A;  4FRR A;  3SQ6 A;  3WTO A;  5L47 A;  3TLW A;  4ZZB A;  5L4E A;  4ZK4 A;  3EHZ A;  2BR7 A;  3UU8 A;  4QH4 A;  3UUB A;  4LMJ A;  4ZK1 A;  5J5H A;  2BG9 A;  4IRE A;  5HCM A;  3U8L A;  3U8K A;  2XQ3 A;  2W8G A;  3ZDH A;  2YMD A;  4ZR6 A;  5AFL A;  4NZB A;  5BP0 A;  4X5T A;  2C9T A;  5AFM A;  4ZJS A;  5KE4 A;  3WIP A;  4UY2 A;  1OED E;  5AFJ A;  2LKH A;  5HEG A;  3JAD A;  4TWH A;  2BYP A;  2PH9 A;  2LM2 A;  3C79 A;  4AFG A;  1UX2 A;  4TNV A;  3EI0 A;  3SH1 A;  4HFD A;  2BYQ A;  4UXU A;  2BG9 E;  2BYN A;  2M6I A;  5AIN A;  3JAE A;  4QAA A;  3RIF A;  3U8M A;  3UU6 A;  4LMK A;  2WNJ A;  4HQP A;  4UM3 P;  4Z91 A;  5HEU A;  2XZ5 A;  2XYT A;  4ZRU A;  2XNU A;  5HCJ A;  2UZ6 A;  2ZJV A;  4LML A;  4HFE A;  4ALX A;  5J5F A;  4HFI A;  4UM3 A;  5KZU A;  3PMZ A;  4TWD A;  3WTH A;  5JME A;  1OED B;  4UM3 S;  3UU5 A;  4DBM A;  4HFB A;  1I9B A;  1UW6 A;  2Y54 A;  5FJV A;  4IL4 A;  3T4M A;  4BQT A;  5AFH A;  5AFN A;  3C84 A;  4HFC A;  3LSV A;  2WN9 A;  3ZDG A;  3TLS A;  4QH5 A;  2VL0 A;  3UQ7 A;  3TLT A;  2BYR A;  4AFH A;  3WTJ A;  2XQ8 A;  2BJ0 A;  2BG9 B;  5HEH A;  4A97 A;  3RHW A;  3GUA A;  4ILB A;  2Y7Y A;  2BYS A;  3WTM A;  4ZJT A;  5AFM B;  4B5D A;  3IGQ A;  2WZY A;  4QAB A;  3P4W A;  5L4H A;  4TWF A;  4BFQ A;  3JAF A;  1OED C;  2KSR A;  2XQA A;  2MAW A;  2YME A;  3UQ4 A;  1UV6 A;  3PEO A;  3EAM A;  3TLU A;  4UM1 A;  2ZJU A;  2YKS A;  2XNV A;  5HEJ A;  5TVC A;  4D01 A;  3WTL A;  5AFK A;  4F8H A;  2W8F A;  2XQ4 A;  2BG9 C;  2XQ6 A;  1OED A;  2X00 D;  5J5I A;  4A98 A;  5BW2 A;  5LG3 A;  2XQ9 A;  3RQW A;  4Z90 A;  4NPP A;  3RQU A;  2XZ6 A;  4TNW A;  2YN6 A;  3U8J A;  2LKG A;  3UU3 A;  5LXB A;  3ZKR A;  4QAC A;  2QC1 B;  2Y56 A;  4ILC A;  3RIA A;  2BR8 A;  2PGZ A;  5HEO A;  4COF A;  2WNC A;  2X00 A;  4EZ1 A;  2WNL A;  5IUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...