3LSVA

Structure of the a237f mutant of the pentameric ligand gated ion channel from gloeobacter violaceus
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title One-microsecond molecular dynamics simulation of channel gating in a nicotinic receptor homologue.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Ligand-gated ion channel
total genus 99
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3lsvA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3lsvA01
5TVCA 2XQAA 2M6BA 2XQ9A 2BG9B 2YMDA 4DBMA 5KE4A 2C9TA 5CO5A 3TLWA 3PEOA 2Y56A 5L4HA 3UU3A 5HEOA 2BYNA 2WNLA 3WTIA 2XYTA 5J0ZA 4F8HA 3SQ6A 2W8FA 2BYQA 4ZR6A 5L47A 5SYOA 4AFTA 5AFMA 3LSVA 3UU6A 4UM3A 4ZJSA 3P4WA 1OEDB 4AFHA 3UU4A 5BW2A 4A97A 2XQ5A 4HFCA 3WIPA 4LMKA 3EI0A 2XQ3A 3RI5A 5CFBA 3U8KA 4NZBA 3WTOA 5BP0A 3RIAA 2Y57A 4ZK1A 5AINA 4ZZCA 2ZJVA 2LLYA 3TLTA 3U8LA 3C84A 3JAFA 4TNWA 5AFLA 2XQ4A 3TLVA 2PH9A 4HFDA 4TWDA 2XNVA 3U8MA 4ALXA 4ZRUA 5AFMB 2QC1B 2VL0A 3EHZA 4QH1A 4Z90A 3UU8A 1OEDC 2M6IA 2LM2A 5LG3A 2BYRA 2BG9A 3C79A 5JMEA 4ZJTA 4ILBA 5BRXA 2X00A 2X00D 2BG9E 4QH5A 5KZUA 3TLUA 2XNTA 4QAAA 2W8GA 4NPPA 2YMEA 2Y7YA 2PGZA 4HFEA 2YKSA 4PIRA 4BQTA 4LMLA 3WTMA 4AFGA 1OEDA 2BR8A 5J5HA 5HEJA 3WTNA 4D01A 3SH1A 4TWHA 4UM3S 3ZDHA 5AFNA 2XNUA 3T4MA 3WTKA 1I9BA 5J5FA 4XK9A 5L4EA 2YOEA 4TNVA 4IREA 5AFHA 5HCMA 3JAEA 5HEGA 3PMZA 3GUAA 3JADA 4TWFA 2Y54A 4HFIA 1UX2A 2WNCA 2UZ6A 4HFBA 4QH4A 2BR7A 4ZK4A 3WTLA 3SIOA 4UM1A 4ILAA 3WTHA 2XQ7A 2WN9A 2XZ6A 4Z91A 2WNJA 3RQWA 4XHEA 4QACA 2LKGA 3ZKRA 3RQUA 4HQPA 5AFKA 2ZJUA 4QABA 3TLSA 2BYSA 1OEDE 4IL9A 3UU5A 4UM3P 4UXUA 4EZ1A 3RHWA 4UY2A 3RIFA 5IUXA 2BYPA 3IGQA 3SQ9A 4COFA 3UQ7A 2Y58A 3WTJA 5J5IA 2MAWA 3ZDGA 4A98A 3EAMA 4BFQA 5HEHA 2XYSA 4FRRA 4IL4A 2LKHA 1UW6A 5AFJA 5LXBA 1UV6A 5J5GA 3U8JA 4B5DA 3P50A 2BJ0A 4WV9A 5FJVA 2BG9C 5HCJA 3UQ4A 4LMJA 2KSRA 2XQ6A 4ILCA 3UUBA 3U8NA 5HEUA 4HFHA 4ZZBA 2XQ8A 4X5TA 2XZ5A 2WZYA 2YN6A
chains in the Genus database with same CATH superfamily
3F31A 2W4XA 4X1KE 1T98A 3TLWA 3GN5A 3WTIA 3HA4A 3BK9A 1XNRT 2NTYA 5SYOA 4PJLA 3OJAA 4BA9A 1EZ3A 5BW2A 4OX9T 2FJEA 4GOUA 2V7LA 3C4ZA 2LLYA 3EDUA 5JR9A 2X67A 1HX8A 2IAKA 4JI4T 4DV0T 2V1DB 1E7PA 4QH5A 1UGOA 4O8SA 3J9X1 4K0KT 5JDHA 2HN1A 2EHOC 5JVDE 4DBRA 4D01A 4ADZA 3BQIA 3H37A 2K9AA 2QGSA 5LG4A 2BDEA 4UV8B 3P7IA 1BR4A 4YJ3E 1FEWA 1NEKA 3UUMA 2WNJA 4XHEA 2K5BB 4QACA 2CBIA 2XAFB 3OVUA 3T1HT 4OYKA 4MBQA 1XMQT 3QNUA 3AEGA 2EHOA 1SHZC 4DIDB 3V5UA 2HH7A 5IHYA 3EAMA 4L0RA 4YHHT 3HKEE 4F6RC 3I9YA 3GWHA 4GK0E 4EV6A 3BQKA 2WY2A 5J1GA 4U2ZA 3KBUA 2V6XA 1XMOT 4OYJA 5L4HA 4UVCB 3W15B 3HKCE 2W8FA 4EGWA 5L47A 2ZM6T 3UU6A 1YKHB 3N9PA 5JDQA 2XQ5A 4AKRB 3FBLA 3AE2A 3EI0A 1UK5A 3KV6A 3RIAA 2Y57A 4JLEA 3ZMVB 1MNEA 2PFVA 3TLTA 4DNDA 4TWDA 5FP3A 2XNVA 4BJMA 3AE9A 3CQXC 2VL0A 1IJ6A 2IC6A 4KHZF 2WM9A 2V6YA 4HWHA 3QK6A 2NOXA 3UULA 1D1BA 5L3DB 1CHUA 5LXTE 1B7TA 3KV4A 3HKDE 2MYSA 4WZXA 5DQWA 5LMUT 4L9IA 5CA1E 2C5KT 3Q9DA 3LK42 4EB6E 1I9BA 2D2SA 3CX8B 5AFHA 1FMVA 4KX6A 3Q5EA 4DUYT 2XUEA 2XJ7A 1G8XA 4QH4A 3PUWF 3ZT5A 1UX4A 2EHOB 4YXDA 2V6YB 5JH7E 4ZOLE 5AQKB 3FZLB 5AFKA 2XAJB 2XAGB 3N9QA 3ZN1B 3RIUC 2KXPB 1MIWA 4QXHB 2MAWA 5HYAA 4TV8E 4X1YE 5JTGA 1HTJF 4ZI2C 1YKEB 1NWMX 3NRXA 3KVBA 3F57A 5FKYA 5AQMB 4M1PA 2LT3A 3KFWX 2JIWA 3VR8A 2BYQA 3PUXF 1OEDB 3RRCA 4AFHA 4IIJE 5JDMA 2BKOA 3WIPA 2AXDS 4CQIA 5AQRB 1HG5A 4H9PC 3C4WA 5CFBA 2D9DA 2YU1A 5C2TA 5LOVE 3K3OA 4U31A 2QC1B 5JQGE 1T72A 2CHOA 4PNIA 4JI0T 1J1JA 2LSKA 2WP9A 3AE3A 5HXRA 2AE9A 4TUYE 1YQ4A 4HN9A 3ZDHA 2XNUA 3X1DA 4XK9A 5AQSB 2LE8A 5FXWA 2KINB 5AQOB 3WAKA 4JI6T 1ZP0A 3ZEFB 3HI2A 5FNVE 2ZM8A 3TKLB 3LK3B 3K1SA 3VU7H 3RQUA 4TX5A 2BZBA 4UXUA 5AQTB 4P0AA 3CIRA 3IEEA 5L3BB 4QWNB 2V7JA 1UW6A 3HKBE 4O4LE 4AQYT 4NXMT 1W0AA 3IF8B 2DHRA 2VKDA 3UUBA 3L8RA 2JRKA 4GKKT 3L3PA 3RPUA 1DU2A 3AVSA 4UR9A 2VB6A 2BYNA 5JRCA 1HFAA 2L9QA 2UUAT 3P4WA 3L09A 3PDYA 4LMKA 2BS3A 5ABEA 3RYCE 3WTOA 3IBPA 2IC9A 4P1NA 5LP6E 2PH9A 3FZHB 4UIGA 4AKGA 1OEDC 4LF7T 5JDLA 1S94A 5AQPB 2DI4A 5BRXA 2X00A 2BG9E 2X9WA 2W0GA 5HXEA 2X68A 2I59A 5FXXA 4NPPA 3VR9A 4LMLA 3WAJA 3U3IA 1KNPA 4YJ2E 4AFGA 5AQUB 4YTPA 4PFPA 4TWHA 5AQVB 3LG7A 4IHJE 2E9XB 4TV9E 5BR8T 1UCUA 1LVFA 1HS7A 2UUCT 1QUUA 1M62A 3JAEA 2VKOA 5FY7A 4YSYA 3EVYA 2W62A 3BQLA 3C64A 4ZK4A 5HXHA 4JI1T 2N2NA 4OHFA 2NW7A 4UF0B 3QB5K 4JI3T 2LRKA 3CKDA 3AEEA 3MXZA 3AVRA 4FJOA 3UQ7A 2Y58A 2JMKA 4QXCB 2NWBA 5BMVE 2WZIA 2BKPA 5AFJA 3U8JA 2LHNA 2VURA 4KHPT 1VCSA 1WYBA 2XQ6A 2XQ8A 3GMIA 1KEYA 4EZHA 2VL8A 2XQYA 2C9TA 4BAYB 2K24A 4I55E 3FZKB 5ABFB 1SA0E 3AA6B 5AFMA 2VVNA 1WCRA 1U5PA 4DV6T 5ETWA 4NZBA 3AXJB 4HE8A 3ANWA 2BS2A 4ZZCA 3AEAA 3Q5DA 4CXXA 4P0BA 3FZFB 1W0BA 2UXCT 2M67A 4O2BE 2D5UA 4E7ZA 4O2AE 5HAXA 3TLUA 4U33A 4EXTA 1E1HB 5H6RB 4PFOA 1BR0A 4BQTA 1VRBA 2J62A 3SRZA 2BR8A 1LRZA 1OXZA 4UELA 3AB3B 5FVLA 5L4EA 1XDOA 5LGUB 4HWDA 4TWFA 3ZN0B 3RYFE 5JDNA 4WBNE 2UZ6A 2WZHA 3NKZA 4HWFA 1W09A 1HG2A 4LF9T 5J2TE 2LKGA 2ACZA 4DR7T 2W61A 4AIUA 3L39A 1SE7A 3RHWA 2RPAA 2XSBA 5J5IA 4UF0A 4JV5T 4U3CA 1N36T 2LKHA 2CLYB 2BJ0A 4AKLA 2PG8A 2YINA 4YLHA 5FL0A 1X79A 4GKJT 1FMWA 2JJ9A 3LBXA 2Y56A 3PTRB 3K8PC 4HGAA 3ZJ1A 3R6NA 4A97A 4HFCA 5LMNT 2CEAA 5LJNA 1R8IA 5JDGA 5BP0A 4ZK1A 4QKNA 2OLTA 5ABFA 1I94T 4YY3T 4I0UA 2CM0A 4I4TE 2Q9QB 2JQ9A 2K3WA 3LDQB 2X9HA 3KDSE 4PJMA 3PUYF 2Y7YA 2PGZA 3LK2B 4J2CA 2E5VA 4ZI3D 4Z8XA 3WTNA 5J2UE 4AKIA 2CLYC 2J47A 4NUVA 2VWAA 3FXDB 2XZEA 2LRLA 1UX5A 3OPCA 4E7SA 1I6ZA 4JYAT 4LF8T 4AQFC 3C4XA 1FIOA 2XTLA 4DV3T 3N5LA 1MIVA 4IL9A 5JDFA 4EZ1A 3RIFA 4COFA 1N32T 3AAIA 3AA0B 3AA1B 4HWCA 4FRRA 4X65T 5DJQC 4ZXLA 4B5DA 3ZYMA 3ZT6A 5AQGB 3ZMTB 2WZYA 3JC6C 2XQAA 3VHLA 2DWKA 1YW0A 3NRYA 3AE7A 2NTXA 3SS1A 2WDVA 4F8HA 4DV2T 4ZR6A 2N9DA 2LOPA 3P4RA 2NW9A 3NVOA 4LFCT 4H9OC 2VQFT 4CXYA 3RC8A 2UUBT 3AEBA 2LSJA 5AINA 2ZJVA 3SFDA 3I0QA 2ES0A 3N2OA 4AI6A 2V7KA 2DNXA 4DV1T 1XZYA 4EEBA 4ZRUA 3UUNA 3UU8A 2MPKA 2J4GA 3K3NA 5JMEA 1E2AA 4G2AA 1T8BA 4ILBA 1JNRA 2CPTA 3P4SA 3VRAA 2X00D 3ZPOA 1H7CA 3V5SA 4JEHB 5AQHB 5AFUL 1QLBA 4UM3S 1VOMA 3N2GE 1NAFA 4H9RC 3I0OA 3CQCB 2V8SV 5HCMA 2Q9QA 3GUAA 3DJBA 4IE6A 3GA8A 1ZOYA 2X9XA 5EK2A 4LF4T 3I1AA 1HNXT 2QA7A 2L3LA 4CXWA 2RA1A 2FJDA 5CJ5A 5HEHA 4IL4A 2ODVA 4KI0F 5ABGA 5H6QB 4X66T 2I0MA 2YN6A 1WFDA 3HL6A 3FHNA 3AEDA 3UU3A 2FBWA 2EHOD 3NZQA 2A2FX 3O1HA 3K3QC 3OYXA 4ZHQE 4UM3A 2C5JA 5LHHB 4IDQA 5JR9C 4KP3C 3EUHA 4DVDA 5GONE 5LHIB 1J5ET 2Q9QD 4O4JE 2W63A 2X0LB 3OTOT 2CWOA 2D0UA 3VKGA 5AFLA 1N34T 2KWHA 3U8MA 2BVLA 3OBVE 3SWHA 2DCFA 5AFMB 1D1AA 4QH1A 3P8CD 2CRBA 2Y8DA 2V5CA 2XHEB 3ONXA 3PE0A 2XSAA 4QAAA 4Q25A 3AEFA 5E0OA 3PUGA 2CXLA 2IMLA 5TAOA 3P4PA 2QRXA 3N9OA 2H89A 5KMGP 4TNVA 4DMWA 3B5MA 4YFSA 3ZMZB 2JPFA 2Y54A 2PBIA 5L3CB 4CN1A 4BJNA 1XDPA 2E5LT 3Q5XA 1AJ3A 3HR0A 2HPJA 4QHOA 2UXXB 4JUYA 4N78D 2LJLA 3S4UA 1ZV4X 4UM3P 2BYPA 2C5IT 1ZKEA 2BS4A 4ZS3A 3T8OA 1HF8A 1KK7A 4CN4A 2D0TA 2B76A 3CPZA 2WNCA 3ZLIA 2YMDA 2WNLA 2CBJA 2CE7A 3AAAB 3PJAA 3R84B 4X1IE 5F5WA 1NENA 5FXVA 3RI5A 3U8KA 3E0ZA 2WMOA 2E9XD 4U7YA 3PUSA 2XAQB 3MJXA 5LCYA 2LM9A 4B3RT 2PJQA 4DV4T 3RH3A 4LF6T 2X0HA 2WAUA 5CGMA 3ONJA 2FUPA 2LSYA 4HFEA 3PV0F 4HEAA 1W9RA 4DR5T 4UEMA 3GN5B 2V7MA 4H9QC 3JADA 3LJCA 1IBMT 3I9WA 2BR7A 4CI2B 3SIOA 4C90A 3QOFA 2B1EA 1SUMB 4PJNA 1O3XA 3DTOA 1OEDE 4IDPA 5ABHA 2IIUA 2R6GF 2WSSV 4TN7B 1KNRA 1UV6A 1QSDA 3ZMUB 5FJVA 5HEUA 2H7VC 2IUBA 2BG9B 2V7IA 4GK5E 4DR6T 4GYRA 3B13A 5HEOA 2XYTA 5LBQB 4ANJA 3JCFA 4XBFB 4AQFA 2VQET 2JQKA 2XQ3A 2DWGA 5AQLB 2OA5A 4OFZA 5IWAT 4DR2T 2W00A 2XQ4A 2VVSA 1XWMA 4YSZA 4HFDA 4X62T 1N33T 4DR4T 5FY0A 3AXJA 5LGNB 2MBGA 2LM2A 2W8GA 4QXBB 3PUZF 4PIRA 2DL1A 1KFYA 4IDZA 2ZM2A 3QC9A 4U72A 3C98B 4H63V 2NW8A 2H7OA 2BKNA 3RKOA 4IREA 4UV9B 1KNZA 5HEGA 1BR2A 2KNDA 4HFBA 1T7SA 3MACA 3RYIE 2YDSA 4TZ4C 2VKHA 4QABA 2BYSA 2WDRA 2X0YA 3UU5A 5KX5E 2XPKA 3ZCIA 4KMCA 2WQYA 4ZI2D 3PU8A 3VRBA 3ETVA 4QX7B 3OYZA 1S35A 3RRWA 2FJBA 3UQ4A 3RC3A 3MK7C 3U8NA 4X5TA 4XAXB 5L3EB 3RKGA 2W2UA 3WI3A 5EK4A 5FVKA 2VASA 2XAHB 3N9NA 3U78A 2YDRA 4WYVA 5FMNA 4EOZB 2QVAA 2DLRA 1U4QA 5AQQB 4ERRA 3PUQA 2YK0A 1HNWT 3JAFA 3N9LA 4JI2T 3TLVA 2CXFA 1US7B 2KT9A 2YDQA 4ISTA 3RF1A 4ZJTA 2WU2A 3IHRA 3O9XA 4IGUA 4CI1B 1XNQT 2YMEA 2XM1A 3E22E 2UXBT 1HNZT 1YD8G 5LGTB 2WS3A 4EAHA 2JQQA 2YOEA 1UURA 1MMAA 2K48A 4DO0A 1JNZA 2IDOB 4B3MT 5FL1A 4ZS2A 2XYSA 1YXRA 2WBLA 5CA0E 2H88A 1MMDA 2A9UA 4WV9A 2KSRA 4AISA 2ZJUA 3UTKA 4WNKA 5F3JA 3N9MA 3A8YC 3UT5E 2CCQA 3ABVA 4AFTA 5LB7B 5LJMA 2E8IA 3UU4A 4IDOA 3MA9A 4ISSA 3SFEA 1IBLT 2E9XA 4H9SE 4TNWA 3QB5A 4C91A 3EABA 4KBMB 1V9DA 4I50E 3ZT7A 4CZZB 5KXJA 4Z90A 2Z6EA 5LG3A 3G06A 2BG9A 3FB2A 5HWYA 4X64T 3EDVA 5F8PA 3ZCJA 4YHJA 4DR3T 4PJJA 3LFMA 2XNTA 2G0UA 2V5DA 4A56A 1HX1B 2V26A 5LA6E 2IHR1 2CMRA 2CWYA 4U7IA 4B3TT 2HPLA 3FXEB 4L5GA 4XZCA 3O1IA 4HFIA 3ZSTA 5L3GB 4IE0A 4G63A 3WTLA 5KDMC 2MTQA 3PJAJ 2C0SA 2MOZA 3ZYLA 4AXPA 4JI8T 3RGLA 3TLSA 2WDQA 5FY1A 1WRDA 3WTJA 3ZYKA 4BFQA 4ZI3C 2WWUA 4LMJA 3Q2MA 5LYJE 4ZZBA 2VKJA 4LF5T 2ACXA 5TVCA 2QYWA 1D0ZA 4JI7T 3ZC0A 4O4IE 3LSVA 4ZJSA 3CVRA 3M3ZB 3E08A 3NWIA 2LSIA 1D1CA 2Q9QC 3ZC1A 3J7Yq 1HCIA 4MHCA 4DV5T 3LBXB 5FXZA 4AKHA 4U2YA 3EHZA 3AE4A 2HHHT 1MIYA 5AQFB 2XM2A 2ODUA 4UXNB 3JC6D 4UVAB 2X66A 5EK3A 5AQJB 5HXSA 1UUSA 5J5HA 2LOSA 1CUNA 5HXCA 3DP7A 5AFNA 3KBTA 2J1DG 4LFBT 4A5XA 4IE7A 4PW8A 5JR9B 2PTFA 5JRCB 1UX2A 3FBZA 1VCTA 3MZKB 3RYHE 4Z91A 3ANWB 3RQWA 3PUAA 4NIQA 4MALA 2LEHA 4UY2A 4WW0A 4PK6A 4IE4A 2W66A 3UFGA 5L3FB 3CX7B 4O4HE 3PURA 3KV9A 4EIWA 4QX8B 4PK5A 4JBWF 2XZ5A 3ZDGA 3RLFF 4OK0A 2KWIB 3CMLA 2M6BA 3NZPA 3QUJA 4LFAT 1WR0A 3RX6A 3NBXX 3A7MA 2WMNA 3ZSSA 5C8YE 1IAPA 2Y48B 4HTEA 3P4QA 3KVAA 2UU9T 2WU5A 2H3RA 4PK4A 5FYMA 4U74A 2KZ7B 2JMHA 3AE8A 3T1YT 3B57A 3PU3A 3C79A 3AAEB 4IE5A 3KINB 2N1GA 1G73A 2VK9A 4HWIB 4ZEYA 2YEVC 3O1JA 2YKSA 4EYYR 4DUZT 5AQNB 3T4MA 4DV7T 1Z0PA 1L0VA 3PMZA 3CK6A 3IA3A 2A3DA 4NXNT 4DR1T 3WTHA 4UM1A 5EZYE 2XZ6A 5M4YA 5ADXL 3H3MA 5IUXA 3IGQA 3ETUA 3SQ9A 1IZNB 1X9BA 3A5XA 2CA5A 3Q5WA 4A98A 2NP9A 3P50A 5HWXA 2BG9C 2YU2A 4KUMB 4HFHA 2XQ9A 5KE4A 3PEOA 1Y01A 2E2AA 1YQ3A 2LHRA 3SQ6A 2BVMA 4MFRA 3VKHA 2JQHA 1ZEEA 2BBJA 1MNDA 5A1LA 5DQVA 4V1Av 3CQGB 1BR1A 5LHGB 3UUXB 5L2LA 3C84A 3OKQA 1M7KA 1J5WA 4ALXA 4ILUA 3PUVF 2RP4A 3ONLC 2FJAA 3C50A 4B6XA 1MMGA 1WLXA 2Y6XA 3WTMA 5LBMA 1OEDA 3ESLA 2WWVA 2HN2A 3F2EA 1IJ5A 1OWAA 2XASB 2W67A 3WTKA 5IYZE 2E9XC 1LVKA 4YSXA 2A72A 4CN6A 3AE1A 3UFEA 5JREA 4K0UA 4ILAA 2XQ7A 2P9BA 5C3JA 2KLQA 4HKAA 3M65A 2ZM0A 3ZKRA 4HQPA 4B3ST 2UXNB 2CHNA 3CX6B 4JI5T 1KF6A 5CB4E 1ZHCA 2WCAA 3H3AA 4EZ4A 4NUUA 5LXBA 1WYCA 4ZI7E 4YT0A 5HCJA 2X9YA 4ILCA 4YTNA 5KZUA 2CXDA 4DBMA 5CO5A 4H9NC 5J0ZA 4P09A 4AQGA 4EEDA 4GYSA 2NR4A 3ZMSB 5AQIB 1IBKT 3ZJ2A 2KMFA 4IDNA 2L8KA 3U8LA 3AE5A 3CWZB 2WB5A 4WBOA 4DBQA 4GIWA 4FI5A 2XY8B 2I6HA 2M6IA 1FJGT 2BYRA 4H63H 1WR6A 4JEUB 2UXDT 4PAGA 3FZMB 1Z8UA 4EYUA 3RIUA 3N2KE 5HEJA 1D0YA 3SH1A 2LSGA 2ZLYA 4X20E 4DMVA 4HFVA 5J5FA 2BBHA 1D0XA 4MLKA 3AE6A 3AA7B 2SPCA 3D0TA 4ASKA 3SOLA 3C51A 3O4XE 2GK9A 2WN9A 1GQEA 4I43B 2IW5B 2ZMAA 4CI3B 4YTMA 1MMNA 3AECA 1HR0T 2X51A 1Y64B 3MKDA 4IT4A 1LKXA 2OV9A 4UVBB 5J5GA 2F4VT 5LNKA 3KV5A 5DABA
chains in the Genus database with same CATH topology
5TVCA 2XQAA 2M6BA 2XQ9A 2BG9B 2YMDA 4DBMA 5KE4A 2C9TA 5CO5A 3TLWA 3PEOA 2Y56A 5L4HA 3UU3A 5HEOA 2BYNA 2WNLA 3WTIA 2XYTA 5J0ZA 4F8HA 3SQ6A 2W8FA 2BYQA 4ZR6A 5L47A 5SYOA 4AFTA 5AFMA 3LSVA 3UU6A 4UM3A 4ZJSA 3P4WA 1OEDB 4AFHA 3UU4A 5BW2A 4A97A 2XQ5A 4HFCA 3WIPA 4LMKA 3EI0A 2XQ3A 3RI5A 5CFBA 3U8KA 4NZBA 3WTOA 5BP0A 3RIAA 2Y57A 4ZK1A 5AINA 4ZZCA 2ZJVA 2LLYA 3TLTA 3U8LA 3C84A 3JAFA 4TNWA 5AFLA 2XQ4A 3TLVA 2PH9A 4HFDA 4TWDA 2XNVA 3U8MA 4ALXA 4ZRUA 5AFMB 2QC1B 2VL0A 3EHZA 4QH1A 4Z90A 3UU8A 1OEDC 2M6IA 2LM2A 5LG3A 2BYRA 2BG9A 3C79A 5JMEA 4ZJTA 4ILBA 5BRXA 2X00A 2X00D 2BG9E 4QH5A 5KZUA 3TLUA 2XNTA 4QAAA 2W8GA 4NPPA 2YMEA 2Y7YA 2PGZA 4HFEA 2YKSA 4PIRA 4BQTA 4LMLA 3WTMA 4AFGA 1OEDA 2BR8A 5J5HA 5HEJA 3WTNA 4D01A 3SH1A 4TWHA 4UM3S 3ZDHA 5AFNA 2XNUA 3T4MA 3WTKA 1I9BA 5J5FA 4XK9A 5L4EA 2YOEA 4TNVA 4IREA 5AFHA 5HCMA 3JAEA 5HEGA 3PMZA 3GUAA 3JADA 4TWFA 2Y54A 4HFIA 1UX2A 2WNCA 2UZ6A 4HFBA 4QH4A 2BR7A 4ZK4A 3WTLA 3SIOA 4UM1A 4ILAA 3WTHA 2XQ7A 2WN9A 2XZ6A 4Z91A 2WNJA 3RQWA 4XHEA 4QACA 2LKGA 3ZKRA 3RQUA 4HQPA 5AFKA 2ZJUA 4QABA 3TLSA 2BYSA 1OEDE 4IL9A 3UU5A 4UM3P 4UXUA 4EZ1A 3RHWA 4UY2A 3RIFA 5IUXA 2BYPA 3IGQA 3SQ9A 4COFA 3UQ7A 2Y58A 3WTJA 5J5IA 2MAWA 3ZDGA 4A98A 3EAMA 4BFQA 5HEHA 2XYSA 4FRRA 4IL4A 2LKHA 1UW6A 5AFJA 5LXBA 1UV6A 5J5GA 3U8JA 4B5DA 3P50A 2BJ0A 4WV9A 5FJVA 2BG9C 5HCJA 3UQ4A 4LMJA 2KSRA 2XQ6A 4ILCA 3UUBA 3U8NA 5HEUA 4HFHA 4ZZBA 2XQ8A 4X5TA 2XZ5A 2WZYA 2YN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TVC A;  2XQA A;  2M6B A;  2XQ9 A;  2BG9 B;  2YMD A;  4DBM A;  5KE4 A;  2C9T A;  5CO5 A;  3TLW A;  3PEO A;  2Y56 A;  5L4H A;  3UU3 A;  5HEO A;  2BYN A;  2WNL A;  3WTI A;  2XYT A;  5J0Z A;  4F8H A;  3SQ6 A;  2W8F A;  2BYQ A;  4ZR6 A;  5L47 A;  5SYO A;  4AFT A;  5AFM A;  3LSV A;  3UU6 A;  4UM3 A;  4ZJS A;  3P4W A;  1OED B;  4AFH A;  3UU4 A;  5BW2 A;  4A97 A;  2XQ5 A;  4HFC A;  3WIP A;  4LMK A;  3EI0 A;  2XQ3 A;  3RI5 A;  5CFB A;  3U8K A;  4NZB A;  3WTO A;  5BP0 A;  3RIA A;  2Y57 A;  4ZK1 A;  5AIN A;  4ZZC A;  2ZJV A;  2LLY A;  3TLT A;  3U8L A;  3C84 A;  3JAF A;  4TNW A;  5AFL A;  2XQ4 A;  3TLV A;  2PH9 A;  4HFD A;  4TWD A;  2XNV A;  3U8M A;  4ALX A;  4ZRU A;  5AFM B;  2QC1 B;  2VL0 A;  3EHZ A;  4QH1 A;  4Z90 A;  3UU8 A;  1OED C;  2M6I A;  2LM2 A;  5LG3 A;  2BYR A;  2BG9 A;  3C79 A;  5JME A;  4ZJT A;  4ILB A;  5BRX A;  2X00 A;  2X00 D;  2BG9 E;  4QH5 A;  5KZU A;  3TLU A;  2XNT A;  4QAA A;  2W8G A;  4NPP A;  2YME A;  2Y7Y A;  2PGZ A;  4HFE A;  2YKS A;  4PIR A;  4BQT A;  4LML A;  3WTM A;  4AFG A;  1OED A;  2BR8 A;  5J5H A;  5HEJ A;  3WTN A;  4D01 A;  3SH1 A;  4TWH A;  4UM3 S;  3ZDH A;  5AFN A;  2XNU A;  3T4M A;  3WTK A;  1I9B A;  5J5F A;  4XK9 A;  5L4E A;  2YOE A;  4TNV A;  4IRE A;  5AFH A;  5HCM A;  3JAE A;  5HEG A;  3PMZ A;  3GUA A;  3JAD A;  4TWF A;  2Y54 A;  4HFI A;  1UX2 A;  2WNC A;  2UZ6 A;  4HFB A;  4QH4 A;  2BR7 A;  4ZK4 A;  3WTL A;  3SIO A;  4UM1 A;  4ILA A;  3WTH A;  2XQ7 A;  2WN9 A;  2XZ6 A;  4Z91 A;  2WNJ A;  3RQW A;  4XHE A;  4QAC A;  2LKG A;  3ZKR A;  3RQU A;  4HQP A;  5AFK A;  2ZJU A;  4QAB A;  3TLS A;  2BYS A;  1OED E;  4IL9 A;  3UU5 A;  4UM3 P;  4UXU A;  4EZ1 A;  3RHW A;  4UY2 A;  3RIF A;  5IUX A;  2BYP A;  3IGQ A;  3SQ9 A;  4COF A;  3UQ7 A;  2Y58 A;  3WTJ A;  5J5I A;  2MAW A;  3ZDG A;  4A98 A;  3EAM A;  4BFQ A;  5HEH A;  2XYS A;  4FRR A;  4IL4 A;  2LKH A;  1UW6 A;  5AFJ A;  5LXB A;  1UV6 A;  5J5G A;  3U8J A;  4B5D A;  3P50 A;  2BJ0 A;  4WV9 A;  5FJV A;  2BG9 C;  5HCJ A;  3UQ4 A;  4LMJ A;  2KSR A;  2XQ6 A;  4ILC A;  3UUB A;  3U8N A;  5HEU A;  4HFH A;  4ZZB A;  2XQ8 A;  4X5T A;  2XZ5 A;  2WZY A;  2YN6 A; 
#chains in the Genus database with same CATH topology
 3F31 A;  2W4X A;  4X1K E;  1T98 A;  3TLW A;  3GN5 A;  3WTI A;  3HA4 A;  3BK9 A;  1XNR T;  2NTY A;  5SYO A;  4PJL A;  3OJA A;  4BA9 A;  1EZ3 A;  5BW2 A;  4OX9 T;  2FJE A;  4GOU A;  2V7L A;  3C4Z A;  2LLY A;  3EDU A;  5JR9 A;  2X67 A;  1HX8 A;  2IAK A;  4JI4 T;  4DV0 T;  2V1D B;  1E7P A;  4QH5 A;  1UGO A;  4O8S A;  3J9X 1;  4K0K T;  5JDH A;  2HN1 A;  2EHO C;  5JVD E;  4DBR A;  4D01 A;  4ADZ A;  3BQI A;  3H37 A;  2K9A A;  2QGS A;  5LG4 A;  2BDE A;  4UV8 B;  3P7I A;  1BR4 A;  4YJ3 E;  1FEW A;  1NEK A;  3UUM A;  2WNJ A;  4XHE A;  2K5B B;  4QAC A;  2CBI A;  2XAF B;  3OVU A;  3T1H T;  4OYK A;  4MBQ A;  1XMQ T;  3QNU A;  3AEG A;  2EHO A;  1SHZ C;  4DID B;  3V5U A;  2HH7 A;  5IHY A;  3EAM A;  4L0R A;  4YHH T;  3HKE E;  4F6R C;  3I9Y A;  3GWH A;  4GK0 E;  4EV6 A;  3BQK A;  2WY2 A;  5J1G A;  4U2Z A;  3KBU A;  2V6X A;  1XMO T;  4OYJ A;  5L4H A;  4UVC B;  3W15 B;  3HKC E;  2W8F A;  4EGW A;  5L47 A;  2ZM6 T;  3UU6 A;  1YKH B;  3N9P A;  5JDQ A;  2XQ5 A;  4AKR B;  3FBL A;  3AE2 A;  3EI0 A;  1UK5 A;  3KV6 A;  3RIA A;  2Y57 A;  4JLE A;  3ZMV B;  1MNE A;  2PFV A;  3TLT A;  4DND A;  4TWD A;  5FP3 A;  2XNV A;  4BJM A;  3AE9 A;  3CQX C;  2VL0 A;  1IJ6 A;  2IC6 A;  4KHZ F;  2WM9 A;  2V6Y A;  4HWH A;  3QK6 A;  2NOX A;  3UUL A;  1D1B A;  5L3D B;  1CHU A;  5LXT E;  1B7T A;  3KV4 A;  3HKD E;  2MYS A;  4WZX A;  5DQW A;  5LMU T;  4L9I A;  5CA1 E;  2C5K T;  3Q9D A;  3LK4 2;  4EB6 E;  1I9B A;  2D2S A;  3CX8 B;  5AFH A;  1FMV A;  4KX6 A;  3Q5E A;  4DUY T;  2XUE A;  2XJ7 A;  1G8X A;  4QH4 A;  3PUW F;  3ZT5 A;  1UX4 A;  2EHO B;  4YXD A;  2V6Y B;  5JH7 E;  4ZOL E;  5AQK B;  3FZL B;  5AFK A;  2XAJ B;  2XAG B;  3N9Q A;  3ZN1 B;  3RIU C;  2KXP B;  1MIW A;  4QXH B;  2MAW A;  5HYA A;  4TV8 E;  4X1Y E;  5JTG A;  1HTJ F;  4ZI2 C;  1YKE B;  1NWM X;  3NRX A;  3KVB A;  3F57 A;  5FKY A;  5AQM B;  4M1P A;  2LT3 A;  3KFW X;  2JIW A;  3VR8 A;  2BYQ A;  3PUX F;  1OED B;  3RRC A;  4AFH A;  4IIJ E;  5JDM A;  2BKO A;  3WIP A;  2AXD S;  4CQI A;  5AQR B;  1HG5 A;  4H9P C;  3C4W A;  5CFB A;  2D9D A;  2YU1 A;  5C2T A;  5LOV E;  3K3O A;  4U31 A;  2QC1 B;  5JQG E;  1T72 A;  2CHO A;  4PNI A;  4JI0 T;  1J1J A;  2LSK A;  2WP9 A;  3AE3 A;  5HXR A;  2AE9 A;  4TUY E;  1YQ4 A;  4HN9 A;  3ZDH A;  2XNU A;  3X1D A;  4XK9 A;  5AQS B;  2LE8 A;  5FXW A;  2KIN B;  5AQO B;  3WAK A;  4JI6 T;  1ZP0 A;  3ZEF B;  3HI2 A;  5FNV E;  2ZM8 A;  3TKL B;  3LK3 B;  3K1S A;  3VU7 H;  3RQU A;  4TX5 A;  2BZB A;  4UXU A;  5AQT B;  4P0A A;  3CIR A;  3IEE A;  5L3B B;  4QWN B;  2V7J A;  1UW6 A;  3HKB E;  4O4L E;  4AQY T;  4NXM T;  1W0A A;  3IF8 B;  2DHR A;  2VKD A;  3UUB A;  3L8R A;  2JRK A;  4GKK T;  3L3P A;  3RPU A;  1DU2 A;  3AVS A;  4UR9 A;  2VB6 A;  2BYN A;  5JRC A;  1HFA A;  2L9Q A;  2UUA T;  3P4W A;  3L09 A;  3PDY A;  4LMK A;  2BS3 A;  5ABE A;  3RYC E;  3WTO A;  3IBP A;  2IC9 A;  4P1N A;  5LP6 E;  2PH9 A;  3FZH B;  4UIG A;  4AKG A;  1OED C;  4LF7 T;  5JDL A;  1S94 A;  5AQP B;  2DI4 A;  5BRX A;  2X00 A;  2BG9 E;  2X9W A;  2W0G A;  5HXE A;  2X68 A;  2I59 A;  5FXX A;  4NPP A;  3VR9 A;  4LML A;  3WAJ A;  3U3I A;  1KNP A;  4YJ2 E;  4AFG A;  5AQU B;  4YTP A;  4PFP A;  4TWH A;  5AQV B;  3LG7 A;  4IHJ E;  2E9X B;  4TV9 E;  5BR8 T;  1UCU A;  1LVF A;  1HS7 A;  2UUC T;  1QUU A;  1M62 A;  3JAE A;  2VKO A;  5FY7 A;  4YSY A;  3EVY A;  2W62 A;  3BQL A;  3C64 A;  4ZK4 A;  5HXH A;  4JI1 T;  2N2N A;  4OHF A;  2NW7 A;  4UF0 B;  3QB5 K;  4JI3 T;  2LRK A;  3CKD A;  3AEE A;  3MXZ A;  3AVR A;  4FJO A;  3UQ7 A;  2Y58 A;  2JMK A;  4QXC B;  2NWB A;  5BMV E;  2WZI A;  2BKP A;  5AFJ A;  3U8J A;  2LHN A;  2VUR A;  4KHP T;  1VCS A;  1WYB A;  2XQ6 A;  2XQ8 A;  3GMI A;  1KEY A;  4EZH A;  2VL8 A;  2XQY A;  2C9T A;  4BAY B;  2K24 A;  4I55 E;  3FZK B;  5ABF B;  1SA0 E;  3AA6 B;  5AFM A;  2VVN A;  1WCR A;  1U5P A;  4DV6 T;  5ETW A;  4NZB A;  3AXJ B;  4HE8 A;  3ANW A;  2BS2 A;  4ZZC A;  3AEA A;  3Q5D A;  4CXX A;  4P0B A;  3FZF B;  1W0B A;  2UXC T;  2M67 A;  4O2B E;  2D5U A;  4E7Z A;  4O2A E;  5HAX A;  3TLU A;  4U33 A;  4EXT A;  1E1H B;  5H6R B;  4PFO A;  1BR0 A;  4BQT A;  1VRB A;  2J62 A;  3SRZ A;  2BR8 A;  1LRZ A;  1OXZ A;  4UEL A;  3AB3 B;  5FVL A;  5L4E A;  1XDO A;  5LGU B;  4HWD A;  4TWF A;  3ZN0 B;  3RYF E;  5JDN A;  4WBN E;  2UZ6 A;  2WZH A;  3NKZ A;  4HWF A;  1W09 A;  1HG2 A;  4LF9 T;  5J2T E;  2LKG A;  2ACZ A;  4DR7 T;  2W61 A;  4AIU A;  3L39 A;  1SE7 A;  3RHW A;  2RPA A;  2XSB A;  5J5I A;  4UF0 A;  4JV5 T;  4U3C A;  1N36 T;  2LKH A;  2CLY B;  2BJ0 A;  4AKL A;  2PG8 A;  2YIN A;  4YLH A;  5FL0 A;  1X79 A;  4GKJ T;  1FMW A;  2JJ9 A;  3LBX A;  2Y56 A;  3PTR B;  3K8P C;  4HGA A;  3ZJ1 A;  3R6N A;  4A97 A;  4HFC A;  5LMN T;  2CEA A;  5LJN A;  1R8I A;  5JDG A;  5BP0 A;  4ZK1 A;  4QKN A;  2OLT A;  5ABF A;  1I94 T;  4YY3 T;  4I0U A;  2CM0 A;  4I4T E;  2Q9Q B;  2JQ9 A;  2K3W A;  3LDQ B;  2X9H A;  3KDS E;  4PJM A;  3PUY F;  2Y7Y A;  2PGZ A;  3LK2 B;  4J2C A;  2E5V A;  4ZI3 D;  4Z8X A;  3WTN A;  5J2U E;  4AKI A;  2CLY C;  2J47 A;  4NUV A;  2VWA A;  3FXD B;  2XZE A;  2LRL A;  1UX5 A;  3OPC A;  4E7S A;  1I6Z A;  4JYA T;  4LF8 T;  4AQF C;  3C4X A;  1FIO A;  2XTL A;  4DV3 T;  3N5L A;  1MIV A;  4IL9 A;  5JDF A;  4EZ1 A;  3RIF A;  4COF A;  1N32 T;  3AAI A;  3AA0 B;  3AA1 B;  4HWC A;  4FRR A;  4X65 T;  5DJQ C;  4ZXL A;  4B5D A;  3ZYM A;  3ZT6 A;  5AQG B;  3ZMT B;  2WZY A;  3JC6 C;  2XQA A;  3VHL A;  2DWK A;  1YW0 A;  3NRY A;  3AE7 A;  2NTX A;  3SS1 A;  2WDV A;  4F8H A;  4DV2 T;  4ZR6 A;  2N9D A;  2LOP A;  3P4R A;  2NW9 A;  3NVO A;  4LFC T;  4H9O C;  2VQF T;  4CXY A;  3RC8 A;  2UUB T;  3AEB A;  2LSJ A;  5AIN A;  2ZJV A;  3SFD A;  3I0Q A;  2ES0 A;  3N2O A;  4AI6 A;  2V7K A;  2DNX A;  4DV1 T;  1XZY A;  4EEB A;  4ZRU A;  3UUN A;  3UU8 A;  2MPK A;  2J4G A;  3K3N A;  5JME A;  1E2A A;  4G2A A;  1T8B A;  4ILB A;  1JNR A;  2CPT A;  3P4S A;  3VRA A;  2X00 D;  3ZPO A;  1H7C A;  3V5S A;  4JEH B;  5AQH B;  5AFU L;  1QLB A;  4UM3 S;  1VOM A;  3N2G E;  1NAF A;  4H9R C;  3I0O A;  3CQC B;  2V8S V;  5HCM A;  2Q9Q A;  3GUA A;  3DJB A;  4IE6 A;  3GA8 A;  1ZOY A;  2X9X A;  5EK2 A;  4LF4 T;  3I1A A;  1HNX T;  2QA7 A;  2L3L A;  4CXW A;  2RA1 A;  2FJD A;  5CJ5 A;  5HEH A;  4IL4 A;  2ODV A;  4KI0 F;  5ABG A;  5H6Q B;  4X66 T;  2I0M A;  2YN6 A;  1WFD A;  3HL6 A;  3FHN A;  3AED A;  3UU3 A;  2FBW A;  2EHO D;  3NZQ A;  2A2F X;  3O1H A;  3K3Q C;  3OYX A;  4ZHQ E;  4UM3 A;  2C5J A;  5LHH B;  4IDQ A;  5JR9 C;  4KP3 C;  3EUH A;  4DVD A;  5GON E;  5LHI B;  1J5E T;  2Q9Q D;  4O4J E;  2W63 A;  2X0L B;  3OTO T;  2CWO A;  2D0U A;  3VKG A;  5AFL A;  1N34 T;  2KWH A;  3U8M A;  2BVL A;  3OBV E;  3SWH A;  2DCF A;  5AFM B;  1D1A A;  4QH1 A;  3P8C D;  2CRB A;  2Y8D A;  2V5C A;  2XHE B;  3ONX A;  3PE0 A;  2XSA A;  4QAA A;  4Q25 A;  3AEF A;  5E0O A;  3PUG A;  2CXL A;  2IML A;  5TAO A;  3P4P A;  2QRX A;  3N9O A;  2H89 A;  5KMG P;  4TNV A;  4DMW A;  3B5M A;  4YFS A;  3ZMZ B;  2JPF A;  2Y54 A;  2PBI A;  5L3C B;  4CN1 A;  4BJN A;  1XDP A;  2E5L T;  3Q5X A;  1AJ3 A;  3HR0 A;  2HPJ A;  4QHO A;  2UXX B;  4JUY A;  4N78 D;  2LJL A;  3S4U A;  1ZV4 X;  4UM3 P;  2BYP A;  2C5I T;  1ZKE A;  2BS4 A;  4ZS3 A;  3T8O A;  1HF8 A;  1KK7 A;  4CN4 A;  2D0T A;  2B76 A;  3CPZ A;  2WNC A;  3ZLI A;  2YMD A;  2WNL A;  2CBJ A;  2CE7 A;  3AAA B;  3PJA A;  3R84 B;  4X1I E;  5F5W A;  1NEN A;  5FXV A;  3RI5 A;  3U8K A;  3E0Z A;  2WMO A;  2E9X D;  4U7Y A;  3PUS A;  2XAQ B;  3MJX A;  5LCY A;  2LM9 A;  4B3R T;  2PJQ A;  4DV4 T;  3RH3 A;  4LF6 T;  2X0H A;  2WAU A;  5CGM A;  3ONJ A;  2FUP A;  2LSY A;  4HFE A;  3PV0 F;  4HEA A;  1W9R A;  4DR5 T;  4UEM A;  3GN5 B;  2V7M A;  4H9Q C;  3JAD A;  3LJC A;  1IBM T;  3I9W A;  2BR7 A;  4CI2 B;  3SIO A;  4C90 A;  3QOF A;  2B1E A;  1SUM B;  4PJN A;  1O3X A;  3DTO A;  1OED E;  4IDP A;  5ABH A;  2IIU A;  2R6G F;  2WSS V;  4TN7 B;  1KNR A;  1UV6 A;  1QSD A;  3ZMU B;  5FJV A;  5HEU A;  2H7V C;  2IUB A;  2BG9 B;  2V7I A;  4GK5 E;  4DR6 T;  4GYR A;  3B13 A;  5HEO A;  2XYT A;  5LBQ B;  4ANJ A;  3JCF A;  4XBF B;  4AQF A;  2VQE T;  2JQK A;  2XQ3 A;  2DWG A;  5AQL B;  2OA5 A;  4OFZ A;  5IWA T;  4DR2 T;  2W00 A;  2XQ4 A;  2VVS A;  1XWM A;  4YSZ A;  4HFD A;  4X62 T;  1N33 T;  4DR4 T;  5FY0 A;  3AXJ A;  5LGN B;  2MBG A;  2LM2 A;  2W8G A;  4QXB B;  3PUZ F;  4PIR A;  2DL1 A;  1KFY A;  4IDZ A;  2ZM2 A;  3QC9 A;  4U72 A;  3C98 B;  4H63 V;  2NW8 A;  2H7O A;  2BKN A;  3RKO A;  4IRE A;  4UV9 B;  1KNZ A;  5HEG A;  1BR2 A;  2KND A;  4HFB A;  1T7S A;  3MAC A;  3RYI E;  2YDS A;  4TZ4 C;  2VKH A;  4QAB A;  2BYS A;  2WDR A;  2X0Y A;  3UU5 A;  5KX5 E;  2XPK A;  3ZCI A;  4KMC A;  2WQY A;  4ZI2 D;  3PU8 A;  3VRB A;  3ETV A;  4QX7 B;  3OYZ A;  1S35 A;  3RRW A;  2FJB A;  3UQ4 A;  3RC3 A;  3MK7 C;  3U8N A;  4X5T A;  4XAX B;  5L3E B;  3RKG A;  2W2U A;  3WI3 A;  5EK4 A;  5FVK A;  2VAS A;  2XAH B;  3N9N A;  3U78 A;  2YDR A;  4WYV A;  5FMN A;  4EOZ B;  2QVA A;  2DLR A;  1U4Q A;  5AQQ B;  4ERR A;  3PUQ A;  2YK0 A;  1HNW T;  3JAF A;  3N9L A;  4JI2 T;  3TLV A;  2CXF A;  1US7 B;  2KT9 A;  2YDQ A;  4IST A;  3RF1 A;  4ZJT A;  2WU2 A;  3IHR A;  3O9X A;  4IGU A;  4CI1 B;  1XNQ T;  2YME A;  2XM1 A;  3E22 E;  2UXB T;  1HNZ T;  1YD8 G;  5LGT B;  2WS3 A;  4EAH A;  2JQQ A;  2YOE A;  1UUR A;  1MMA A;  2K48 A;  4DO0 A;  1JNZ A;  2IDO B;  4B3M T;  5FL1 A;  4ZS2 A;  2XYS A;  1YXR A;  2WBL A;  5CA0 E;  2H88 A;  1MMD A;  2A9U A;  4WV9 A;  2KSR A;  4AIS A;  2ZJU A;  3UTK A;  4WNK A;  5F3J A;  3N9M A;  3A8Y C;  3UT5 E;  2CCQ A;  3ABV A;  4AFT A;  5LB7 B;  5LJM A;  2E8I A;  3UU4 A;  4IDO A;  3MA9 A;  4ISS A;  3SFE A;  1IBL T;  2E9X A;  4H9S E;  4TNW A;  3QB5 A;  4C91 A;  3EAB A;  4KBM B;  1V9D A;  4I50 E;  3ZT7 A;  4CZZ B;  5KXJ A;  4Z90 A;  2Z6E A;  5LG3 A;  3G06 A;  2BG9 A;  3FB2 A;  5HWY A;  4X64 T;  3EDV A;  5F8P A;  3ZCJ A;  4YHJ A;  4DR3 T;  4PJJ A;  3LFM A;  2XNT A;  2G0U A;  2V5D A;  4A56 A;  1HX1 B;  2V26 A;  5LA6 E;  2IHR 1;  2CMR A;  2CWY A;  4U7I A;  4B3T T;  2HPL A;  3FXE B;  4L5G A;  4XZC A;  3O1I A;  4HFI A;  3ZST A;  5L3G B;  4IE0 A;  4G63 A;  3WTL A;  5KDM C;  2MTQ A;  3PJA J;  2C0S A;  2MOZ A;  3ZYL A;  4AXP A;  4JI8 T;  3RGL A;  3TLS A;  2WDQ A;  5FY1 A;  1WRD A;  3WTJ A;  3ZYK A;  4BFQ A;  4ZI3 C;  2WWU A;  4LMJ A;  3Q2M A;  5LYJ E;  4ZZB A;  2VKJ A;  4LF5 T;  2ACX A;  5TVC A;  2QYW A;  1D0Z A;  4JI7 T;  3ZC0 A;  4O4I E;  3LSV A;  4ZJS A;  3CVR A;  3M3Z B;  3E08 A;  3NWI A;  2LSI A;  1D1C A;  2Q9Q C;  3ZC1 A;  3J7Y q;  1HCI A;  4MHC A;  4DV5 T;  3LBX B;  5FXZ A;  4AKH A;  4U2Y A;  3EHZ A;  3AE4 A;  2HHH T;  1MIY A;  5AQF B;  2XM2 A;  2ODU A;  4UXN B;  3JC6 D;  4UVA B;  2X66 A;  5EK3 A;  5AQJ B;  5HXS A;  1UUS A;  5J5H A;  2LOS A;  1CUN A;  5HXC A;  3DP7 A;  5AFN A;  3KBT A;  2J1D G;  4LFB T;  4A5X A;  4IE7 A;  4PW8 A;  5JR9 B;  2PTF A;  5JRC B;  1UX2 A;  3FBZ A;  1VCT A;  3MZK B;  3RYH E;  4Z91 A;  3ANW B;  3RQW A;  3PUA A;  4NIQ A;  4MAL A;  2LEH A;  4UY2 A;  4WW0 A;  4PK6 A;  4IE4 A;  2W66 A;  3UFG A;  5L3F B;  3CX7 B;  4O4H E;  3PUR A;  3KV9 A;  4EIW A;  4QX8 B;  4PK5 A;  4JBW F;  2XZ5 A;  3ZDG A;  3RLF F;  4OK0 A;  2KWI B;  3CML A;  2M6B A;  3NZP A;  3QUJ A;  4LFA T;  1WR0 A;  3RX6 A;  3NBX X;  3A7M A;  2WMN A;  3ZSS A;  5C8Y E;  1IAP A;  2Y48 B;  4HTE A;  3P4Q A;  3KVA A;  2UU9 T;  2WU5 A;  2H3R A;  4PK4 A;  5FYM A;  4U74 A;  2KZ7 B;  2JMH A;  3AE8 A;  3T1Y T;  3B57 A;  3PU3 A;  3C79 A;  3AAE B;  4IE5 A;  3KIN B;  2N1G A;  1G73 A;  2VK9 A;  4HWI B;  4ZEY A;  2YEV C;  3O1J A;  2YKS A;  4EYY R;  4DUZ T;  5AQN B;  3T4M A;  4DV7 T;  1Z0P A;  1L0V A;  3PMZ A;  3CK6 A;  3IA3 A;  2A3D A;  4NXN T;  4DR1 T;  3WTH A;  4UM1 A;  5EZY E;  2XZ6 A;  5M4Y A;  5ADX L;  3H3M A;  5IUX A;  3IGQ A;  3ETU A;  3SQ9 A;  1IZN B;  1X9B A;  3A5X A;  2CA5 A;  3Q5W A;  4A98 A;  2NP9 A;  3P50 A;  5HWX A;  2BG9 C;  2YU2 A;  4KUM B;  4HFH A;  2XQ9 A;  5KE4 A;  3PEO A;  1Y01 A;  2E2A A;  1YQ3 A;  2LHR A;  3SQ6 A;  2BVM A;  4MFR A;  3VKH A;  2JQH A;  1ZEE A;  2BBJ A;  1MND A;  5A1L A;  5DQV A;  4V1A v;  3CQG B;  1BR1 A;  5LHG B;  3UUX B;  5L2L A;  3C84 A;  3OKQ A;  1M7K A;  1J5W A;  4ALX A;  4ILU A;  3PUV F;  2RP4 A;  3ONL C;  2FJA A;  3C50 A;  4B6X A;  1MMG A;  1WLX A;  2Y6X A;  3WTM A;  5LBM A;  1OED A;  3ESL A;  2WWV A;  2HN2 A;  3F2E A;  1IJ5 A;  1OWA A;  2XAS B;  2W67 A;  3WTK A;  5IYZ E;  2E9X C;  1LVK A;  4YSX A;  2A72 A;  4CN6 A;  3AE1 A;  3UFE A;  5JRE A;  4K0U A;  4ILA A;  2XQ7 A;  2P9B A;  5C3J A;  2KLQ A;  4HKA A;  3M65 A;  2ZM0 A;  3ZKR A;  4HQP A;  4B3S T;  2UXN B;  2CHN A;  3CX6 B;  4JI5 T;  1KF6 A;  5CB4 E;  1ZHC A;  2WCA A;  3H3A A;  4EZ4 A;  4NUU A;  5LXB A;  1WYC A;  4ZI7 E;  4YT0 A;  5HCJ A;  2X9Y A;  4ILC A;  4YTN A;  5KZU A;  2CXD A;  4DBM A;  5CO5 A;  4H9N C;  5J0Z A;  4P09 A;  4AQG A;  4EED A;  4GYS A;  2NR4 A;  3ZMS B;  5AQI B;  1IBK T;  3ZJ2 A;  2KMF A;  4IDN A;  2L8K A;  3U8L A;  3AE5 A;  3CWZ B;  2WB5 A;  4WBO A;  4DBQ A;  4GIW A;  4FI5 A;  2XY8 B;  2I6H A;  2M6I A;  1FJG T;  2BYR A;  4H63 H;  1WR6 A;  4JEU B;  2UXD T;  4PAG A;  3FZM B;  1Z8U A;  4EYU A;  3RIU A;  3N2K E;  5HEJ A;  1D0Y A;  3SH1 A;  2LSG A;  2ZLY A;  4X20 E;  4DMV A;  4HFV A;  5J5F A;  2BBH A;  1D0X A;  4MLK A;  3AE6 A;  3AA7 B;  2SPC A;  3D0T A;  4ASK A;  3SOL A;  3C51 A;  3O4X E;  2GK9 A;  2WN9 A;  1GQE A;  4I43 B;  2IW5 B;  2ZMA A;  4CI3 B;  4YTM A;  1MMN A;  3AEC A;  1HR0 T;  2X51 A;  1Y64 B;  3MKD A;  4IT4 A;  1LKX A;  2OV9 A;  4UVB B;  5J5G A;  2F4V T;  5LNK A;  3KV5 A;  5DAB A; 
#chains in the Genus database with same CATH homology
 5TVC A;  2XQA A;  2M6B A;  2XQ9 A;  2BG9 B;  2YMD A;  4DBM A;  5KE4 A;  2C9T A;  5CO5 A;  3TLW A;  3PEO A;  2Y56 A;  5L4H A;  3UU3 A;  5HEO A;  2BYN A;  2WNL A;  3WTI A;  2XYT A;  5J0Z A;  4F8H A;  3SQ6 A;  2W8F A;  2BYQ A;  4ZR6 A;  5L47 A;  5SYO A;  4AFT A;  5AFM A;  3LSV A;  3UU6 A;  4UM3 A;  4ZJS A;  3P4W A;  1OED B;  4AFH A;  3UU4 A;  5BW2 A;  4A97 A;  2XQ5 A;  4HFC A;  3WIP A;  4LMK A;  3EI0 A;  2XQ3 A;  3RI5 A;  5CFB A;  3U8K A;  4NZB A;  3WTO A;  5BP0 A;  3RIA A;  2Y57 A;  4ZK1 A;  5AIN A;  4ZZC A;  2ZJV A;  2LLY A;  3TLT A;  3U8L A;  3C84 A;  3JAF A;  4TNW A;  5AFL A;  2XQ4 A;  3TLV A;  2PH9 A;  4HFD A;  4TWD A;  2XNV A;  3U8M A;  4ALX A;  4ZRU A;  5AFM B;  2QC1 B;  2VL0 A;  3EHZ A;  4QH1 A;  4Z90 A;  3UU8 A;  1OED C;  2M6I A;  2LM2 A;  5LG3 A;  2BYR A;  2BG9 A;  3C79 A;  5JME A;  4ZJT A;  4ILB A;  5BRX A;  2X00 A;  2X00 D;  2BG9 E;  4QH5 A;  5KZU A;  3TLU A;  2XNT A;  4QAA A;  2W8G A;  4NPP A;  2YME A;  2Y7Y A;  2PGZ A;  4HFE A;  2YKS A;  4PIR A;  4BQT A;  4LML A;  3WTM A;  4AFG A;  1OED A;  2BR8 A;  5J5H A;  5HEJ A;  3WTN A;  4D01 A;  3SH1 A;  4TWH A;  4UM3 S;  3ZDH A;  5AFN A;  2XNU A;  3T4M A;  3WTK A;  1I9B A;  5J5F A;  4XK9 A;  5L4E A;  2YOE A;  4TNV A;  4IRE A;  5AFH A;  5HCM A;  3JAE A;  5HEG A;  3PMZ A;  3GUA A;  3JAD A;  4TWF A;  2Y54 A;  4HFI A;  1UX2 A;  2WNC A;  2UZ6 A;  4HFB A;  4QH4 A;  2BR7 A;  4ZK4 A;  3WTL A;  3SIO A;  4UM1 A;  4ILA A;  3WTH A;  2XQ7 A;  2WN9 A;  2XZ6 A;  4Z91 A;  2WNJ A;  3RQW A;  4XHE A;  4QAC A;  2LKG A;  3ZKR A;  3RQU A;  4HQP A;  5AFK A;  2ZJU A;  4QAB A;  3TLS A;  2BYS A;  1OED E;  4IL9 A;  3UU5 A;  4UM3 P;  4UXU A;  4EZ1 A;  3RHW A;  4UY2 A;  3RIF A;  5IUX A;  2BYP A;  3IGQ A;  3SQ9 A;  4COF A;  3UQ7 A;  2Y58 A;  3WTJ A;  5J5I A;  2MAW A;  3ZDG A;  4A98 A;  3EAM A;  4BFQ A;  5HEH A;  2XYS A;  4FRR A;  4IL4 A;  2LKH A;  1UW6 A;  5AFJ A;  5LXB A;  1UV6 A;  5J5G A;  3U8J A;  4B5D A;  3P50 A;  2BJ0 A;  4WV9 A;  5FJV A;  2BG9 C;  5HCJ A;  3UQ4 A;  4LMJ A;  2KSR A;  2XQ6 A;  4ILC A;  3UUB A;  3U8N A;  5HEU A;  4HFH A;  4ZZB A;  2XQ8 A;  4X5T A;  2XZ5 A;  2WZY A;  2YN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...