3LSVA

Structure of the a237f mutant of the pentameric ligand gated ion channel from gloeobacter violaceus
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title One-microsecond molecular dynamics simulation of channel gating in a nicotinic receptor homologue.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Ligand-gated ion channel
total genus 99
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3lsvA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3lsvA01
1OEDE 4PIRA 2ZJVA 5J5FA 4HFDA 2LKHA 4ILBA 5J0ZA 3WTNA 2YMEA 3P50A 3JAFA 2VL0A 5FJVA 5HEJA 2XNVA 4X5TA 5AFHA 3UU8A 4BFQA 4HFHA 4ZZBA 5BRXA 5KZUA 5LG3A 3TLVA 2BG9A 2XNUA 2XQ9A 4FRRA 4A97A 4UM3P 1I9BA 5SYOA 4DBMA 2XQ3A 4TNVA 3RIFA 2X00A 4QACA 3U8NA 2X00D 2XQ7A 2BYSA 2Y58A 4Z90A 5HCJA 1UV6A 4UY2A 3RI5A 4TWFA 4ZJSA 3SQ6A 4A98A 4TNWA 4QH4A 3JADA 3LSVA 4NZBA 1OEDA 4ZR6A 3WTOA 5AFLA 3RIAA 3RQUA 2BG9E 2YMDA 2XNTA 5AFMA 5LXBA 2XQ4A 3EI0A 5HEOA 4ZJTA 2XQ5A 2M6IA 3UUBA 2WNLA 3T4MA 4ZK4A 3WTJA 2BR7A 4AFGA 2BYRA 4ALXA 4TWHA 3UU5A 4HQPA 4QH5A 5J5IA 5L47A 2BYNA 1OEDC 3ZKRA 4HFEA 2YKSA 2PH9A 5BP0A 3TLUA 4ZZCA 3IGQA 3SH1A 2XQ8A 5KE4A 4XK9A 2LM2A 3WTLA 4ZK1A 3PEOA 2XZ5A 2XZ6A 5TVCA 5AFKA 5JMEA 5IUXA 2BG9B 4IL9A 2UZ6A 2W8GA 2LLYA 2XYTA 5CFBA 4QABA 3PMZA 2YN6A 4XHEA 4AFTA 4ILAA 4TWDA 4IL4A 1UX2A 2WNCA 3C79A 3C84A 3TLWA 4UM3A 4UXUA 4HFIA 3EAMA 4WV9A 3WTHA 2M6BA 3U8MA 2BR8A 2WNJA 5BW2A 4UM1A 2WZYA 5HEGA 3WTMA 2XQAA 3UU4A 2Y56A 5HCMA 3RHWA 5J5HA 2Y7YA 2PGZA 5AINA 5L4HA 4QH1A 2BG9C 3WIPA 2XQ6A 3U8LA 2LKGA 2BYQA 5AFJA 3P4WA 3UQ7A 4F8HA 2QC1B 3ZDGA 3UU3A 5AFMB 4HFCA 2KSRA 5CO5A 3ZDHA 5AFNA 3UQ4A 2BJ0A 4Z91A 2Y57A 4D01A 3RQWA 4LMLA 2WN9A 2XYSA 5HEHA 4ZRUA 2YOEA 1OEDB 4IREA 3JAEA 4LMJA 3SQ9A 4AFHA 3U8KA 3TLSA 2BYPA 5J5GA 3UU6A 4NPPA 4B5DA 3U8JA 2C9TA 5L4EA 3WTKA 2MAWA 3TLTA 2W8FA 2ZJUA 3EHZA 3GUAA 4COFA 3WTIA 4LMKA 4ILCA 4HFBA 4QAAA 1UW6A 4BQTA 4EZ1A 2Y54A 3SIOA 5HEUA 4UM3S
chains in the Genus database with same CATH superfamily
2G0UA 3OKQA 3AE7A 4YSZA 1XZYA 5KZUA 5FY0A 2A9UA 4YFSA 4UVBB 4TNVA 4EB6E 3AE2A 2X9YA 2WAUA 2CHOA 5LMUT 5JR9A 3KDSE 4TX5A 4ZJSA 4TNWA 4ZR6A 2B1EA 5FNVE 3KINB 2BDEA 5LP6E 3WTJA 1J5WA 3PUAA 1X9BA 3AA7B 2QGSA 3DP7A 1VRBA 2FUPA 4JEHB 3RIUC 2BG9B 1S94A 3ZN0B 4G63A 5IWAT 2VQFT 4DUZT 2GK9A 3EAMA 5FXWA 1XNQT 3Q5DA 2BVLA 4LF9T 2CPTA 5JDQA 2CCQA 1UGOA 3RHWA 3MJXA 3PUSA 2V7MA 3C50A 2YEVC 2LKGA 3L3PA 4P09A 2BYQA 3S4UA 2WB5A 3CQXC 1MMDA 3PU8A 3N2GE 4ZEYA 4AFHA 1CUNA 5ETWA 3UUXB 3HKDE 4X65T 3TLTA 3VHLA 4YTMA 5JDFA 4ILUA 4P0BA 4ZXLA 1YD8G 3IF8B 2J4GA 5LMNT 3E0ZA 4LF4T 3ZYKA 3RRCA 4ISSA 3NZQA 2OV9A 1BR2A 3AEFA 4UM3P 5FXZA 2LHNA 5JDMA 3ANWB 3U8NA 2X00D 4JI8T 1B7TA 4MLKA 2LSJA 1T8BA 2ODVA 4CI1B 2W2UA 1SHZC 1XNRT 3T4MA 3UUNA 5EK3A 4YXDA 2HH7A 2DCFA 5FL0A 3R84B 3F57A 2BKNA 1FJGT 2E8IA 4OFZA 2FJEA 2VKOA 4DBQA 5L2LA 4EEDA 1D0ZA 1WYCA 2V7IA 1D1CA 2WNCA 4I4TE 4PK5A 4UM1A 5KMGP 2M67A 4KBMB 5AQSB 4ERRA 2E9XB 2Y7YA 1IJ6A 5AINA 1U5PA 1SE7A 1XDPA 5DQWA 4JV5T 3SOLA 5LNKA 2LSYA 2LSIA 1WRDA 2XJ7A 2QYWA 3F2EA 3AAAB 2BS3A 4JEUB 4YY3T 3RF1A 4DMVA 4QXCB 4UF0B 3CVRA 5CB4E 4BQTA 2JQQA 3I9WA 1T72A 5LYJE 3JCFA 2UUBT 3VKHA 4H9PC 4PIRA 4IDOA 3UULA 5AFHA 5J2TE 2CXLA 3QC9A 1HX1B 5JRCA 5EK4A 2XQ7A 4Z90A 3B5MA 4C90A 2VKDA 5KDMC 4X1KE 1WR0A 2X9WA 3OYZA 4FI5A 4ZI3C 5FVKA 3C51A 5ABFB 2KLQA 4LF6T 3I1AA 5EZYE 3PJAJ 5FYMA 2LJLA 2QA7A 4IT4A 5FXXA 5L47A 3PE0A 4DV4T 3CIRA 4NXMT 4CXYA 1FIOA 5KE4A 3PEOA 1W09A 2NR4A 4UR9A 2A72A 4GYRA 3QOFA 3EABA 1HNZT 1EZ3A 3UT5E 3C79A 3TKLB 2BR8A 3CX6B 2XQAA 5BMVE 4IIJE 2WWUA 1YXRA 4LFCT 3UQ7A 2QC1B 3ZC0A 1IJ5A 5C8YE 2W61A 3SS1A 2V26A 5J5GA 4PAGA 2I59A 1H7CA 4HWHA 4GK0E 4K0UA 5ABFA 3U8JA 3L39A 3ZT5A 4QAAA 3AAEB 2D0UA 3NKZA 3A8YC 3M3ZB 4P1NA 3IBPA 5KXJA 5HWXA 1OWAA 4CZZB 2L8KA 2XQ9A 4DR1T 4U33A 1D1AA 2Y58A 2H7VC 3ZCJA 4TWFA 5F5WA 4ZI2D 3RLFF 4CN1A 5HXSA 5HWYA 2UUCT 3EVYA 3RIAA 1YW0A 5AQVB 5LJNA 5AQUB 1MIYA 2RP4A 4AFGA 4UEMA 4K0KT 4X1YE 2FBWA 2NW7A 3P4QA 3P4RA 2XQ8A 2X67A 3AE1A 3RH3A 5LHIB 1KNRA 3R6NA 4CI3B 1NWMX 2P9BA 4I0UA 2XAHB 2XQYA 4WV9A 3PU3A 5J1GA 2WBLA 5H6RB 1VCSA 2EHOB 2NW8A 3FZHB 2V1DB 2IC9A 3SQ9A 5AQPB 2ZM0A 4DR2T 2C9TA 2WDRA 1OEDE 2QVAA 3ESLA 4E7SA 3WTNA 2V7JA 2VL0A 2CBJA 4DV5T 3DTOA 3OPCA 3PUXF 2Q9QD 3ZSSA 2XQ3A 3OTOT 1HCIA 3DJBA 4YJ3E 2YDQA 1MMAA 3J7Yq 3N9NA 3ONXA 4QH4A 5M4YA 2F4VT 2XQ4A 4YJ2E 2EHOA 4UVCB 5BR8T 2WM9A 2X51A 2BYNA 4U3CA 4JI5T 3CX8B 3VRAA 4ASKA 2K3WA 4ZZCA 4XK9A 4PJLA 3ZMSB 3AE4A 4QXBB 5JMEA 4A56A 1FEWA 4H9QC 2JQHA 5LBQB 2L9QA 4IL4A 2XAGB 2VKHA 5AQKB 1HFAA 1ZP0A 3RYIE 4DV0T 2CM0A 5JDNA 2PGZA 3RYHE 2D9DA 2LRLA 4HFCA 4DUYT 3UFGA 2DWGA 2XSAA 1L0VA 4Z91A 1KNZA 5KX5E 1HNWT 3ZT7A 3AEGA 4DV1T 2BYPA 4HGAA 4U74A 4JI2T 4ISTA 4NPPA 4X62T 4JI0T 2W8FA 2ZJUA 4JI1T 3HR0A 4NUUA 4EXTA 3WTIA 3QB5K 2WZIA 5AFUL 5CA0E 5LBMA 1N36T 2Q9QA 5HXHA 5AQFB 3SWHA 4ZI7E 4AKRB 2JQ9A 2DL1A 2JMKA 2BG9A 2XNUA 5JTGA 4A97A 4CN4A 1I9BA 1BR4A 1UUSA 3RKGA 4O2AE 2FJAA 4A5XA 3SRZA 2V5DA 3U3IA 4V1Av 4WBOA 1YQ3A 3MXZA 3VR9A 1W0AA 3Q2MA 2IDOB 4NIQA 3RKOA 2NOXA 2RA1A 3PUQA 2BR7A 3ZLIA 3HKEE 4JUYA 3ZMVB 5L3DB 4CXXA 3IA3A 4ZK1A 4DV6T 2XZEA 3ZN1B 2LE8A 3ZJ2A 1HX8A 5FY7A 2K24A 3G06A 2D5UA 2WMOA 2IMLA 1HG2A 4UM3A 4UXUA 2UXNB 2PFVA 2D0TA 3K1SA 5J5HA 3OVUA 2KMFA 1W0BA 1QSDA 3KV6A 3O1JA 4D01A 2LHRA 2XYSA 4ZOLE 4DO0A 4AKHA 4ZS3A 2ZMAA 4HKAA 3IEEA 5AQTB 1WLXA 4CXWA 4IE4A 3GUAA 4GIWA 5L3FB 1MIVA 2ZJVA 3VKGA 1LVKA 5DQVA 4O4JE 2YMEA 3JAFA 2K9AA 4JI3T 1JNZA 3VRBA 4FRRA 2XHEB 2W62A 4DBMA 4ZI3D 4JI4T 1HTJF 2DLRA 1MNDA 3NZPA 2LOPA 5FP3A 5JR9C 1BR0A 5C2TA 3AVRA 1AJ3A 4E7ZA 2I6HA 2RPAA 4Z8XA 2CEAA 3ZKRA 2WDVA 3HKCE 2IUBA 2VVSA 3WTLA 5TVCA 2CA5A 1MNEA 5LA6E 4XHEA 5JRCB 4EYUA 2N2NA 2M6BA 5ABHA 2WZYA 5CGMA 2V6YA 3T8OA 3PTRB 2X9HA 2ZM2A 3ZMZB 2CHNA 3UU3A 2WN9A 2YOEA 1OEDB 4YLHA 3OYXA 5JDGA 3JC6D 2PTFA 4LMKA 3SIOA 2KWHA 5HEUA 4QX7B 3I0OA 3OBVE 3RYFE 4MBQA 3ZPOA 1T7SA 1US7B 4HWCA 5L3CB 3FHNA 2JMHA 3N9LA 4DMWA 3X1DA 4IE7A 4YSYA 4DNDA 2IW5B 2UXBT 3GN5A 3LG7A 4DR3T 3V5SA 3N9MA 1X79A 5LHGB 4Q25A 5AFMA 3ETVA 3IHRA 3EI0A 4TZ4C 2XQ5A 2YDSA 2B76A 3HI2A 3UU5A 1KNPA 2WCAA 4DIDB 2PH9A 4C91A 4DV7T 5HXEA 4H63V 4GOUA 2VURA 2K48A 4AQYT 5EK2A 4QHOA 4HFIA 3E22E 5JDHA 5AQMB 2LEHA 4U31A 1G8XA 3N9OA 2DWKA 5HCMA 3CPZA 4GKJT 3Q5EA 3ONJA 2ZLYA 3HA4A 4KUMB 4KX6A 4UIGA 2NW9A 1Y01A 1CHUA 1KEYA 5HEHA 5AQNB 1LVFA 3BQIA 4B5DA 3KV4A 2JPFA 4UVAB 3EHZA 3RRWA 1UX4A 4I55E 3N9PA 3H3MA 4B6XA 2VB6A 5AQQB 2V7KA 2V5CA 5J5FA 4DV3T 4L0RA 3AEAA 5ABGA 4EAHA 4U7IA 2A2FX 2XNVA 3AA0B 3UU8A 4NXNT 2X0LB 5LG3A 2X0YA 2KINB 2WZHA 3FXDB 2BS2A 2Y48B 5CA1E 3LSVA 4UV8B 2ODUA 2I0MA 4EZ4A 2W63A 3D0TA 4ALXA 4TWHA 2UXXB 4PK6A 3NBXX 4QH5A 2QRXA 3ETUA 3AA1B 3QUJA 4G2AA 3GA8A 2UZ6A 3LJCA 4BJMA 1YKHB 4YTPA 4UV9B 1R8IA 4ILAA 1V9DA 3AAIA 1UX2A 2PG8A 5JREA 1D0XA 3CMLA 3ZMUB 4IDNA 2Q9QC 2W4XA 5JDLA 2XY8B 3AB3B 5L4HA 1ZKEA 2BG9C 3P4WA 5CO5A 1IBMT 3UTKA 1Z8UA 3MKDA 3FBZA 3FBLA 3AE3A 2KWIB 3GN5B 4GKKT 5LGTB 4WNKA 2FJBA 4GYSA 2VVNA 4P0AA 3UU6A 4DR4T 5LHHB 2MAWA 2WY2A 4EZHA 1UW6A 2LSKA 3O1IA 2A3DA 4AKIA 4UM3S 1D1BA 4QX8B 2KT9A 4HFDA 2CLYB 5IHYA 5LB7B 3EDVA 2XSBA 5BRXA 2VWAA 4MALA 2WSSV 4HE8A 4X20E 2MYSA 4OK0A 3FZFB 2JQKA 4PJNA 1D0YA 3PUGA 3JADA 1HF8A 2JJ9A 2XUEA 4BAYB 2IAKA 2M6IA 4TV9E 2WNLA 4J2CA 3ZYLA 2CRBA 3QK6A 2CWYA 4HFEA 2YKSA 3FZMB 2BBJA 4NUVA 3TLUA 4IDZA 2MOZA 2E9XA 3AEBA 4TV8E 1ZOYA 3K3QC 3RPUA 4U72A 2XYTA 2LLYA 2ES0A 5CFBA 4CI2B 1FMVA 1YQ4A 1SA0E 1XMOT 4ANJA 2WNJA 5DJQC 3C4WA 4BJNA 3I9YA 4DV2T 4UELA 4IDQA 4HWIB 1VCTA 1J1JA 2HN2A 2XQ6A 2BZBA 3AA6B 5AFNA 3ONLC 2BJ0A 3L8RA 5LGNB 3AEEA 2IC6A 3AE5A 4ZI2C 1U4QA 3LK2B 2K5BB 4AQGA 2NTXA 4EGWA 4ILCA 1XDOA 5JR9B 2LKHA 5J0ZA 1YKEB 3PUZF 5AQJB 3RC3A 4AISA 5LCYA 4H63H 1NENA 2E2AA 3JC6C 2J47A 3P4SA 4HN9A 2CXDA 4PW8A 1VOMA 2H7OA 5LXBA 1WFDA 2E9XC 4ZK4A 3B57A 5LOVE 4HQPA 1N33T 4EV6A 3PUYF 2HN1A 3LDQB 3SH1A 2LRKA 1KFYA 3K8PC 3AE8A 2Y8DA 3CX7B 3AXJB 2KXPB 4O2BE 1UK5A 2HHHT 4X64T 3KVBA 1T98A 3T1YT 5C3JA 5BW2A 3AVSA 3UU4A 5LG4A 4O8SA 4OYKA 3N2OA 1N32T 1HR0T 3I0QA 5FXVA 2XAQB 2SPCA 2KNDA 3RX6A 3ZDGA 5AFJA 2XTLA 4XZCA 1Y64B 4ZS2A 2D2SA 3RQWA 1QLBA 4PNIA 3FB2A 4HWDA 3PUVF 3VR8A 3BK9A 2YU2A 3CWZB 3CQCB 4COFA 3NVOA 4X66T 5FY1A 5L3EB 2MBGA 3KFWX 1IAPA 2LOSA 5HEJA 5L3GB 2LM9A 3NRYA 2BKOA 3TLVA 4U2ZA 2V6XA 4PJJA 4QACA 1W9RA 2VKJA 4KP3C 5HCJA 1UV6A 1I94T 4B3TT 4A98A 1MMGA 1OEDA 3WTOA 5AFLA 4LF7T 3RQUA 2BG9E 2XNTA 2CLYC 4AQFC 1ZV4X 4OYJA 2AXDS 4EEBA 4JLEA 1HG5A 4FJOA 5J2UE 3FXEB 1IZNB 3ZEFB 2WP9A 5BP0A 2C5KT 1N34T 1IBLT 2YINA 4HFVA 2WMNA 3ANWA 5JH7E 4YHJA 2X66A 3WTHA 2UXDT 3RYCE 3N9QA 2Q9QB 1NAFA 4YTNA 4LF8T 2CMRA 5AFMB 2KSRA 5TAOA 1SUMB 3MZKB 3ZJ1A 3O4XE 2CE7A 1UCUA 3O1HA 2XM1A 2ACZA 2IHR1 4ILBA 2UXCT 5A1LA 3P50A 1LRZA 5AQRB 1M62A 2XASB 4ZHQE 5SYOA 2C0SA 2X0HA 2X00A 2BVMA 2BYSA 3RI5A 3OJAA 3KV5A 3SFDA 3KVAA 3SQ6A 3W15B 5LGUB 3AE9A 4ZJTA 5JVDE 3AE6A 2V7LA 2VL8A 3CQGB 2R6GF 4JBWF 2N9DA 2ZM8A 1KF6A 3IGQA 1M7KA 2VK9A 1WCRA 2WU2A 4I43B 1G73A 4CN6A 4IL9A 4WBNE 5F3JA 2H89A 4IE0A 4DBRA 2YN6A 1XMQT 4TWDA 3GWHA 3TLWA 2IIUA 2CWOA 2J1DG 2OA5A 4B3MT 5H6QB 3WIPA 2NWBA 3MACA 4F8HA 1OXZA 3ZC1A 4PFOA 2XM2A 2Y57A 1NEKA 4LMLA 4AKGA 2C5JA 3A5XA 3HL6A 3M65A 4HFBA 1ZHCA 4L5GA 3MA9A 3SFEA 5F8PA 5HAXA 2WQYA 5FJVA 4X5TA 5AQOB 2ZM6T 3PURA 5ABEA 4BA9A 2FJDA 2XAJB 4PFPA 3ZCIA 4QKNA 2NTYA 3BQLA 4O4IE 4UY2A 2EHOC 4MFRA 4LF5T 3T1HT 3LFMA 3UFEA 3L09A 4NZBA 4LFBT 4WZXA 3WI3A 3PJAA 3UUBA 3WAJA 4KHZF 2OLTA 5FKYA 5J5IA 2NP9A 4XAXB 4O4LE 4B3RT 3BQKA 1J5ET 5GONE 3P8CD 2V8SV 2XAFB 3H37A 4KI0F 5AFKA 5FMNA 2N1GA 2W8GA 5JQGE 4AIUA 3V5UA 3AECA 4DVDA 2DI4A 2PBIA 2X68A 1UURA 4PJMA 3ZSTA 4JYAT 2YK0A 2Y56A 4N78D 4HEAA 2BKPA 4HWFA 3NWIA 2J62A 4TUYE 1WYBA 4UF0A 3U8LA 2MPKA 3WAKA 2BS4A 5HXCA 1QUUA 4HTEA 3KBUA 4ZRUA 3N2KE 3AEDA 3UUMA 2HPLA 3FZLB 2V6YB 3U78A 4H9OC 2WS3A 2CBIA 3LK3B 2L3LA 3K3OA 1S35A 2XPKA 2HPJA 4LFAT 2W67A 3ZMTB 1E1HB 3LBXB 1HNXT 4YHHT 2UUAT 2H88A 2Y6XA 1FMWA 2WDQA 5LXTE 4ZZBA 2C5IT 3AXJA 1KK7A 4M1PA 3GMIA 5ADXL 3MK7C 3Q9DA 3PUWF 1UX5A 3CK6A 4U2YA 2VASA 4L9IA 4QWNB 2WWVA 2EHOD 2YDRA 2LSGA 4KHPT 5HEOA 1E2AA 3RIUA 3RGLA 5FVLA 4IHJE 3K3NA 1OEDC 1I6ZA 3E08A 4EOZB 2LM2A 2E9XD 2XZ5A 1LKXA 4UXNB 2VQET 3CKDA 5IUXA 2LT3A 1IBKT 4O4HE 4DR7T 4QABA 3PMZA 4JI7T 2E5LT 4ADZA 1MMNA 5AQHB 2YU1A 5LJMA 5E0OA 4IE6A 4AI6A 4KMCA 4X1IE 2X9XA 3LBXA 5HEGA 4EYYR 3WTMA 1WR6A 3QB5A 4AQFA 2W00A 3H3AA 1Z0PA 4B3ST 4QXHB 2DNXA 3RC8A 2UU9T 4PK4A 3P7IA 5FL1A 3ZDHA 1GQEA 4OHFA 4CQIA 3C4ZA 4LMJA 3JAEA 3U8KA 2BBHA 3Q5XA 3TLSA 4IE5A 2AE9A 1DU2A 3WTKA 2W66A 5AQLB 2PJQA 3VU7H 3KBTA 4EZ1A 1JNRA 4H9NC 2JIWA 4DR6T 4BFQA 4HFHA 4U7YA 1BR1A 2Z6EA 3RIFA 1XWMA 3J9X1 3F31A 3QNUA 2KZ7B 3NRXA 5AQGB 3C98B 3ZT6A 4EIWA 3C64A 5CJ5A 2DHRA 4I50E 2YMDA 3EUHA 3A7MA 3N5LA 4GK5E 5IYZE 5DABA 3HKBE 4MHCA 2BYRA 2WU5A 3C4XA 3KV9A 4TN7B 3B13A 5HXRA 4OX9T 4IGUA 2XZ6A 4YT0A 1E7PA 5AQIB 5L3BB 2E5VA 4AKLA 3P4PA 4AFTA 4JI6T 1O3XA 3C84A 4AXPA 2ACXA 3U8MA 3EDUA 3PDYA 4XBFB 1HS7A 4IDPA 4WYVA 4DR5T 4F6RC 2CXFA 4QH1A 1MIWA 4WW0A 3ZYMA 2H3RA 2JRKA 3ABVA 4YSXA 2MTQA 3UQ4A 1ZEEA 3Q5WA 4IREA 3FZKB 4H9SE 4H9RC 3O9XA 3LK42 5L4EA 2W0GA 5HYAA 2Y54A 3PV0F
chains in the Genus database with same CATH topology
1OEDE 4PIRA 2ZJVA 5J5FA 4HFDA 2LKHA 4ILBA 5J0ZA 3WTNA 2YMEA 3P50A 3JAFA 2VL0A 5FJVA 5HEJA 2XNVA 4X5TA 5AFHA 3UU8A 4BFQA 4HFHA 4ZZBA 5BRXA 5KZUA 5LG3A 3TLVA 2BG9A 2XNUA 2XQ9A 4FRRA 4A97A 4UM3P 1I9BA 5SYOA 4DBMA 2XQ3A 4TNVA 3RIFA 2X00A 4QACA 3U8NA 2X00D 2XQ7A 2BYSA 2Y58A 4Z90A 5HCJA 1UV6A 4UY2A 3RI5A 4TWFA 4ZJSA 3SQ6A 4A98A 4TNWA 4QH4A 3JADA 3LSVA 4NZBA 1OEDA 4ZR6A 3WTOA 5AFLA 3RIAA 3RQUA 2BG9E 2YMDA 2XNTA 5AFMA 5LXBA 2XQ4A 3EI0A 5HEOA 4ZJTA 2XQ5A 2M6IA 3UUBA 2WNLA 3T4MA 4ZK4A 3WTJA 2BR7A 4AFGA 2BYRA 4ALXA 4TWHA 3UU5A 4HQPA 4QH5A 5J5IA 5L47A 2BYNA 1OEDC 3ZKRA 4HFEA 2YKSA 2PH9A 5BP0A 3TLUA 4ZZCA 3IGQA 3SH1A 2XQ8A 5KE4A 4XK9A 2LM2A 3WTLA 4ZK1A 3PEOA 2XZ5A 2XZ6A 5TVCA 5AFKA 5JMEA 5IUXA 2BG9B 4IL9A 2UZ6A 2W8GA 2LLYA 2XYTA 5CFBA 4QABA 3PMZA 2YN6A 4XHEA 4AFTA 4ILAA 4TWDA 4IL4A 1UX2A 2WNCA 3C79A 3C84A 3TLWA 4UM3A 4UXUA 4HFIA 3EAMA 4WV9A 3WTHA 2M6BA 3U8MA 2BR8A 2WNJA 5BW2A 4UM1A 2WZYA 5HEGA 3WTMA 2XQAA 3UU4A 2Y56A 5HCMA 3RHWA 5J5HA 2Y7YA 2PGZA 5AINA 5L4HA 4QH1A 2BG9C 3WIPA 2XQ6A 3U8LA 2LKGA 2BYQA 5AFJA 3P4WA 3UQ7A 4F8HA 2QC1B 3ZDGA 3UU3A 5AFMB 4HFCA 2KSRA 5CO5A 3ZDHA 5AFNA 3UQ4A 2BJ0A 4Z91A 2Y57A 4D01A 3RQWA 4LMLA 2WN9A 2XYSA 5HEHA 4ZRUA 2YOEA 1OEDB 4IREA 3JAEA 4LMJA 3SQ9A 4AFHA 3U8KA 3TLSA 2BYPA 5J5GA 3UU6A 4NPPA 4B5DA 3U8JA 2C9TA 5L4EA 3WTKA 2MAWA 3TLTA 2W8FA 2ZJUA 3EHZA 3GUAA 4COFA 3WTIA 4LMKA 4ILCA 4HFBA 4QAAA 1UW6A 4BQTA 4EZ1A 2Y54A 3SIOA 5HEUA 4UM3S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OED E;  4PIR A;  2ZJV A;  5J5F A;  4HFD A;  2LKH A;  4ILB A;  5J0Z A;  3WTN A;  2YME A;  3P50 A;  3JAF A;  2VL0 A;  5FJV A;  5HEJ A;  2XNV A;  4X5T A;  5AFH A;  3UU8 A;  4BFQ A;  4HFH A;  4ZZB A;  5BRX A;  5KZU A;  5LG3 A;  3TLV A;  2BG9 A;  2XNU A;  2XQ9 A;  4FRR A;  4A97 A;  4UM3 P;  1I9B A;  5SYO A;  4DBM A;  2XQ3 A;  4TNV A;  3RIF A;  2X00 A;  4QAC A;  3U8N A;  2X00 D;  2XQ7 A;  2BYS A;  2Y58 A;  4Z90 A;  5HCJ A;  1UV6 A;  4UY2 A;  3RI5 A;  4TWF A;  4ZJS A;  3SQ6 A;  4A98 A;  4TNW A;  4QH4 A;  3JAD A;  3LSV A;  4NZB A;  1OED A;  4ZR6 A;  3WTO A;  5AFL A;  3RIA A;  3RQU A;  2BG9 E;  2YMD A;  2XNT A;  5AFM A;  5LXB A;  2XQ4 A;  3EI0 A;  5HEO A;  4ZJT A;  2XQ5 A;  2M6I A;  3UUB A;  2WNL A;  3T4M A;  4ZK4 A;  3WTJ A;  2BR7 A;  4AFG A;  2BYR A;  4ALX A;  4TWH A;  3UU5 A;  4HQP A;  4QH5 A;  5J5I A;  5L47 A;  2BYN A;  1OED C;  3ZKR A;  4HFE A;  2YKS A;  2PH9 A;  5BP0 A;  3TLU A;  4ZZC A;  3IGQ A;  3SH1 A;  2XQ8 A;  5KE4 A;  4XK9 A;  2LM2 A;  3WTL A;  4ZK1 A;  3PEO A;  2XZ5 A;  2XZ6 A;  5TVC A;  5AFK A;  5JME A;  5IUX A;  2BG9 B;  4IL9 A;  2UZ6 A;  2W8G A;  2LLY A;  2XYT A;  5CFB A;  4QAB A;  3PMZ A;  2YN6 A;  4XHE A;  4AFT A;  4ILA A;  4TWD A;  4IL4 A;  1UX2 A;  2WNC A;  3C79 A;  3C84 A;  3TLW A;  4UM3 A;  4UXU A;  4HFI A;  3EAM A;  4WV9 A;  3WTH A;  2M6B A;  3U8M A;  2BR8 A;  2WNJ A;  5BW2 A;  4UM1 A;  2WZY A;  5HEG A;  3WTM A;  2XQA A;  3UU4 A;  2Y56 A;  5HCM A;  3RHW A;  5J5H A;  2Y7Y A;  2PGZ A;  5AIN A;  5L4H A;  4QH1 A;  2BG9 C;  3WIP A;  2XQ6 A;  3U8L A;  2LKG A;  2BYQ A;  5AFJ A;  3P4W A;  3UQ7 A;  4F8H A;  2QC1 B;  3ZDG A;  3UU3 A;  5AFM B;  4HFC A;  2KSR A;  5CO5 A;  3ZDH A;  5AFN A;  3UQ4 A;  2BJ0 A;  4Z91 A;  2Y57 A;  4D01 A;  3RQW A;  4LML A;  2WN9 A;  2XYS A;  5HEH A;  4ZRU A;  2YOE A;  1OED B;  4IRE A;  3JAE A;  4LMJ A;  3SQ9 A;  4AFH A;  3U8K A;  3TLS A;  2BYP A;  5J5G A;  3UU6 A;  4NPP A;  4B5D A;  3U8J A;  2C9T A;  5L4E A;  3WTK A;  2MAW A;  3TLT A;  2W8F A;  2ZJU A;  3EHZ A;  3GUA A;  4COF A;  3WTI A;  4LMK A;  4ILC A;  4HFB A;  4QAA A;  1UW6 A;  4BQT A;  4EZ1 A;  2Y54 A;  3SIO A;  5HEU A;  4UM3 S; 
#chains in the Genus database with same CATH topology
 2G0U A;  3OKQ A;  3AE7 A;  4YSZ A;  1XZY A;  5KZU A;  5FY0 A;  2A9U A;  4YFS A;  4UVB B;  4TNV A;  4EB6 E;  3AE2 A;  2X9Y A;  2WAU A;  2CHO A;  5LMU T;  5JR9 A;  3KDS E;  4TX5 A;  4ZJS A;  4TNW A;  4ZR6 A;  2B1E A;  5FNV E;  3KIN B;  2BDE A;  5LP6 E;  3WTJ A;  1J5W A;  3PUA A;  1X9B A;  3AA7 B;  2QGS A;  3DP7 A;  1VRB A;  2FUP A;  4JEH B;  3RIU C;  2BG9 B;  1S94 A;  3ZN0 B;  4G63 A;  5IWA T;  2VQF T;  4DUZ T;  2GK9 A;  3EAM A;  5FXW A;  1XNQ T;  3Q5D A;  2BVL A;  4LF9 T;  2CPT A;  5JDQ A;  2CCQ A;  1UGO A;  3RHW A;  3MJX A;  3PUS A;  2V7M A;  3C50 A;  2YEV C;  2LKG A;  3L3P A;  4P09 A;  2BYQ A;  3S4U A;  2WB5 A;  3CQX C;  1MMD A;  3PU8 A;  3N2G E;  4ZEY A;  4AFH A;  1CUN A;  5ETW A;  3UUX B;  3HKD E;  4X65 T;  3TLT A;  3VHL A;  4YTM A;  5JDF A;  4ILU A;  4P0B A;  4ZXL A;  1YD8 G;  3IF8 B;  2J4G A;  5LMN T;  3E0Z A;  4LF4 T;  3ZYK A;  3RRC A;  4ISS A;  3NZQ A;  2OV9 A;  1BR2 A;  3AEF A;  4UM3 P;  5FXZ A;  2LHN A;  5JDM A;  3ANW B;  3U8N A;  2X00 D;  4JI8 T;  1B7T A;  4MLK A;  2LSJ A;  1T8B A;  2ODV A;  4CI1 B;  2W2U A;  1SHZ C;  1XNR T;  3T4M A;  3UUN A;  5EK3 A;  4YXD A;  2HH7 A;  2DCF A;  5FL0 A;  3R84 B;  3F57 A;  2BKN A;  1FJG T;  2E8I A;  4OFZ A;  2FJE A;  2VKO A;  4DBQ A;  5L2L A;  4EED A;  1D0Z A;  1WYC A;  2V7I A;  1D1C A;  2WNC A;  4I4T E;  4PK5 A;  4UM1 A;  5KMG P;  2M67 A;  4KBM B;  5AQS B;  4ERR A;  2E9X B;  2Y7Y A;  1IJ6 A;  5AIN A;  1U5P A;  1SE7 A;  1XDP A;  5DQW A;  4JV5 T;  3SOL A;  5LNK A;  2LSY A;  2LSI A;  1WRD A;  2XJ7 A;  2QYW A;  3F2E A;  3AAA B;  2BS3 A;  4JEU B;  4YY3 T;  3RF1 A;  4DMV A;  4QXC B;  4UF0 B;  3CVR A;  5CB4 E;  4BQT A;  2JQQ A;  3I9W A;  1T72 A;  5LYJ E;  3JCF A;  2UUB T;  3VKH A;  4H9P C;  4PIR A;  4IDO A;  3UUL A;  5AFH A;  5J2T E;  2CXL A;  3QC9 A;  1HX1 B;  5JRC A;  5EK4 A;  2XQ7 A;  4Z90 A;  3B5M A;  4C90 A;  2VKD A;  5KDM C;  4X1K E;  1WR0 A;  2X9W A;  3OYZ A;  4FI5 A;  4ZI3 C;  5FVK A;  3C51 A;  5ABF B;  2KLQ A;  4LF6 T;  3I1A A;  5EZY E;  3PJA J;  5FYM A;  2LJL A;  2QA7 A;  4IT4 A;  5FXX A;  5L47 A;  3PE0 A;  4DV4 T;  3CIR A;  4NXM T;  4CXY A;  1FIO A;  5KE4 A;  3PEO A;  1W09 A;  2NR4 A;  4UR9 A;  2A72 A;  4GYR A;  3QOF A;  3EAB A;  1HNZ T;  1EZ3 A;  3UT5 E;  3C79 A;  3TKL B;  2BR8 A;  3CX6 B;  2XQA A;  5BMV E;  4IIJ E;  2WWU A;  1YXR A;  4LFC T;  3UQ7 A;  2QC1 B;  3ZC0 A;  1IJ5 A;  5C8Y E;  2W61 A;  3SS1 A;  2V26 A;  5J5G A;  4PAG A;  2I59 A;  1H7C A;  4HWH A;  4GK0 E;  4K0U A;  5ABF A;  3U8J A;  3L39 A;  3ZT5 A;  4QAA A;  3AAE B;  2D0U A;  3NKZ A;  3A8Y C;  3M3Z B;  4P1N A;  3IBP A;  5KXJ A;  5HWX A;  1OWA A;  4CZZ B;  2L8K A;  2XQ9 A;  4DR1 T;  4U33 A;  1D1A A;  2Y58 A;  2H7V C;  3ZCJ A;  4TWF A;  5F5W A;  4ZI2 D;  3RLF F;  4CN1 A;  5HXS A;  5HWY A;  2UUC T;  3EVY A;  3RIA A;  1YW0 A;  5AQV B;  5LJN A;  5AQU B;  1MIY A;  2RP4 A;  4AFG A;  4UEM A;  4K0K T;  4X1Y E;  2FBW A;  2NW7 A;  3P4Q A;  3P4R A;  2XQ8 A;  2X67 A;  3AE1 A;  3RH3 A;  5LHI B;  1KNR A;  3R6N A;  4CI3 B;  1NWM X;  2P9B A;  4I0U A;  2XAH B;  2XQY A;  4WV9 A;  3PU3 A;  5J1G A;  2WBL A;  5H6R B;  1VCS A;  2EHO B;  2NW8 A;  3FZH B;  2V1D B;  2IC9 A;  3SQ9 A;  5AQP B;  2ZM0 A;  4DR2 T;  2C9T A;  2WDR A;  1OED E;  2QVA A;  3ESL A;  4E7S A;  3WTN A;  2V7J A;  2VL0 A;  2CBJ A;  4DV5 T;  3DTO A;  3OPC A;  3PUX F;  2Q9Q D;  3ZSS A;  2XQ3 A;  3OTO T;  1HCI A;  3DJB A;  4YJ3 E;  2YDQ A;  1MMA A;  3J7Y q;  3N9N A;  3ONX A;  4QH4 A;  5M4Y A;  2F4V T;  2XQ4 A;  4YJ2 E;  2EHO A;  4UVC B;  5BR8 T;  2WM9 A;  2X51 A;  2BYN A;  4U3C A;  4JI5 T;  3CX8 B;  3VRA A;  4ASK A;  2K3W A;  4ZZC A;  4XK9 A;  4PJL A;  3ZMS B;  3AE4 A;  4QXB B;  5JME A;  4A56 A;  1FEW A;  4H9Q C;  2JQH A;  5LBQ B;  2L9Q A;  4IL4 A;  2XAG B;  2VKH A;  5AQK B;  1HFA A;  1ZP0 A;  3RYI E;  4DV0 T;  2CM0 A;  5JDN A;  2PGZ A;  3RYH E;  2D9D A;  2LRL A;  4HFC A;  4DUY T;  3UFG A;  2DWG A;  2XSA A;  1L0V A;  4Z91 A;  1KNZ A;  5KX5 E;  1HNW T;  3ZT7 A;  3AEG A;  4DV1 T;  2BYP A;  4HGA A;  4U74 A;  4JI2 T;  4IST A;  4NPP A;  4X62 T;  4JI0 T;  2W8F A;  2ZJU A;  4JI1 T;  3HR0 A;  4NUU A;  4EXT A;  3WTI A;  3QB5 K;  2WZI A;  5AFU L;  5CA0 E;  5LBM A;  1N36 T;  2Q9Q A;  5HXH A;  5AQF B;  3SWH A;  4ZI7 E;  4AKR B;  2JQ9 A;  2DL1 A;  2JMK A;  2BG9 A;  2XNU A;  5JTG A;  4A97 A;  4CN4 A;  1I9B A;  1BR4 A;  1UUS A;  3RKG A;  4O2A E;  2FJA A;  4A5X A;  3SRZ A;  2V5D A;  3U3I A;  4V1A v;  4WBO A;  1YQ3 A;  3MXZ A;  3VR9 A;  1W0A A;  3Q2M A;  2IDO B;  4NIQ A;  3RKO A;  2NOX A;  2RA1 A;  3PUQ A;  2BR7 A;  3ZLI A;  3HKE E;  4JUY A;  3ZMV B;  5L3D B;  4CXX A;  3IA3 A;  4ZK1 A;  4DV6 T;  2XZE A;  3ZN1 B;  2LE8 A;  3ZJ2 A;  1HX8 A;  5FY7 A;  2K24 A;  3G06 A;  2D5U A;  2WMO A;  2IML A;  1HG2 A;  4UM3 A;  4UXU A;  2UXN B;  2PFV A;  2D0T A;  3K1S A;  5J5H A;  3OVU A;  2KMF A;  1W0B A;  1QSD A;  3KV6 A;  3O1J A;  4D01 A;  2LHR A;  2XYS A;  4ZOL E;  4DO0 A;  4AKH A;  4ZS3 A;  2ZMA A;  4HKA A;  3IEE A;  5AQT B;  1WLX A;  4CXW A;  4IE4 A;  3GUA A;  4GIW A;  5L3F B;  1MIV A;  2ZJV A;  3VKG A;  1LVK A;  5DQV A;  4O4J E;  2YME A;  3JAF A;  2K9A A;  4JI3 T;  1JNZ A;  3VRB A;  4FRR A;  2XHE B;  2W62 A;  4DBM A;  4ZI3 D;  4JI4 T;  1HTJ F;  2DLR A;  1MND A;  3NZP A;  2LOP A;  5FP3 A;  5JR9 C;  1BR0 A;  5C2T A;  3AVR A;  1AJ3 A;  4E7Z A;  2I6H A;  2RPA A;  4Z8X A;  2CEA A;  3ZKR A;  2WDV A;  3HKC E;  2IUB A;  2VVS A;  3WTL A;  5TVC A;  2CA5 A;  1MNE A;  5LA6 E;  4XHE A;  5JRC B;  4EYU A;  2N2N A;  2M6B A;  5ABH A;  2WZY A;  5CGM A;  2V6Y A;  3T8O A;  3PTR B;  2X9H A;  2ZM2 A;  3ZMZ B;  2CHN A;  3UU3 A;  2WN9 A;  2YOE A;  1OED B;  4YLH A;  3OYX A;  5JDG A;  3JC6 D;  2PTF A;  4LMK A;  3SIO A;  2KWH A;  5HEU A;  4QX7 B;  3I0O A;  3OBV E;  3RYF E;  4MBQ A;  3ZPO A;  1T7S A;  1US7 B;  4HWC A;  5L3C B;  3FHN A;  2JMH A;  3N9L A;  4DMW A;  3X1D A;  4IE7 A;  4YSY A;  4DND A;  2IW5 B;  2UXB T;  3GN5 A;  3LG7 A;  4DR3 T;  3V5S A;  3N9M A;  1X79 A;  5LHG B;  4Q25 A;  5AFM A;  3ETV A;  3IHR A;  3EI0 A;  4TZ4 C;  2XQ5 A;  2YDS A;  2B76 A;  3HI2 A;  3UU5 A;  1KNP A;  2WCA A;  4DID B;  2PH9 A;  4C91 A;  4DV7 T;  5HXE A;  4H63 V;  4GOU A;  2VUR A;  2K48 A;  4AQY T;  5EK2 A;  4QHO A;  4HFI A;  3E22 E;  5JDH A;  5AQM B;  2LEH A;  4U31 A;  1G8X A;  3N9O A;  2DWK A;  5HCM A;  3CPZ A;  4GKJ T;  3Q5E A;  3ONJ A;  2ZLY A;  3HA4 A;  4KUM B;  4KX6 A;  4UIG A;  2NW9 A;  1Y01 A;  1CHU A;  1KEY A;  5HEH A;  5AQN B;  1LVF A;  3BQI A;  4B5D A;  3KV4 A;  2JPF A;  4UVA B;  3EHZ A;  3RRW A;  1UX4 A;  4I55 E;  3N9P A;  3H3M A;  4B6X A;  2VB6 A;  5AQQ B;  2V7K A;  2V5C A;  5J5F A;  4DV3 T;  4L0R A;  3AEA A;  5ABG A;  4EAH A;  4U7I A;  2A2F X;  2XNV A;  3AA0 B;  3UU8 A;  4NXN T;  2X0L B;  5LG3 A;  2X0Y A;  2KIN B;  2WZH A;  3FXD B;  2BS2 A;  2Y48 B;  5CA1 E;  3LSV A;  4UV8 B;  2ODU A;  2I0M A;  4EZ4 A;  2W63 A;  3D0T A;  4ALX A;  4TWH A;  2UXX B;  4PK6 A;  3NBX X;  4QH5 A;  2QRX A;  3ETU A;  3AA1 B;  3QUJ A;  4G2A A;  3GA8 A;  2UZ6 A;  3LJC A;  4BJM A;  1YKH B;  4YTP A;  4UV9 B;  1R8I A;  4ILA A;  1V9D A;  3AAI A;  1UX2 A;  2PG8 A;  5JRE A;  1D0X A;  3CML A;  3ZMU B;  4IDN A;  2Q9Q C;  2W4X A;  5JDL A;  2XY8 B;  3AB3 B;  5L4H A;  1ZKE A;  2BG9 C;  3P4W A;  5CO5 A;  1IBM T;  3UTK A;  1Z8U A;  3MKD A;  3FBZ A;  3FBL A;  3AE3 A;  2KWI B;  3GN5 B;  4GKK T;  5LGT B;  4WNK A;  2FJB A;  4GYS A;  2VVN A;  4P0A A;  3UU6 A;  4DR4 T;  5LHH B;  2MAW A;  2WY2 A;  4EZH A;  1UW6 A;  2LSK A;  3O1I A;  2A3D A;  4AKI A;  4UM3 S;  1D1B A;  4QX8 B;  2KT9 A;  4HFD A;  2CLY B;  5IHY A;  5LB7 B;  3EDV A;  2XSB A;  5BRX A;  2VWA A;  4MAL A;  2WSS V;  4HE8 A;  4X20 E;  2MYS A;  4OK0 A;  3FZF B;  2JQK A;  4PJN A;  1D0Y A;  3PUG A;  3JAD A;  1HF8 A;  2JJ9 A;  2XUE A;  4BAY B;  2IAK A;  2M6I A;  4TV9 E;  2WNL A;  4J2C A;  3ZYL A;  2CRB A;  3QK6 A;  2CWY A;  4HFE A;  2YKS A;  3FZM B;  2BBJ A;  4NUV A;  3TLU A;  4IDZ A;  2MOZ A;  2E9X A;  3AEB A;  4TV8 E;  1ZOY A;  3K3Q C;  3RPU A;  4U72 A;  2XYT A;  2LLY A;  2ES0 A;  5CFB A;  4CI2 B;  1FMV A;  1YQ4 A;  1SA0 E;  1XMO T;  4ANJ A;  2WNJ A;  5DJQ C;  3C4W A;  4BJN A;  3I9Y A;  4DV2 T;  4UEL A;  4IDQ A;  4HWI B;  1VCT A;  1J1J A;  2HN2 A;  2XQ6 A;  2BZB A;  3AA6 B;  5AFN A;  3ONL C;  2BJ0 A;  3L8R A;  5LGN B;  3AEE A;  2IC6 A;  3AE5 A;  4ZI2 C;  1U4Q A;  3LK2 B;  2K5B B;  4AQG A;  2NTX A;  4EGW A;  4ILC A;  1XDO A;  5JR9 B;  2LKH A;  5J0Z A;  1YKE B;  3PUZ F;  5AQJ B;  3RC3 A;  4AIS A;  5LCY A;  4H63 H;  1NEN A;  2E2A A;  3JC6 C;  2J47 A;  3P4S A;  4HN9 A;  2CXD A;  4PW8 A;  1VOM A;  2H7O A;  5LXB A;  1WFD A;  2E9X C;  4ZK4 A;  3B57 A;  5LOV E;  4HQP A;  1N33 T;  4EV6 A;  3PUY F;  2HN1 A;  3LDQ B;  3SH1 A;  2LRK A;  1KFY A;  3K8P C;  3AE8 A;  2Y8D A;  3CX7 B;  3AXJ B;  2KXP B;  4O2B E;  1UK5 A;  2HHH T;  4X64 T;  3KVB A;  1T98 A;  3T1Y T;  5C3J A;  5BW2 A;  3AVS A;  3UU4 A;  5LG4 A;  4O8S A;  4OYK A;  3N2O A;  1N32 T;  1HR0 T;  3I0Q A;  5FXV A;  2XAQ B;  2SPC A;  2KND A;  3RX6 A;  3ZDG A;  5AFJ A;  2XTL A;  4XZC A;  1Y64 B;  4ZS2 A;  2D2S A;  3RQW A;  1QLB A;  4PNI A;  3FB2 A;  4HWD A;  3PUV F;  3VR8 A;  3BK9 A;  2YU2 A;  3CWZ B;  3CQC B;  4COF A;  3NVO A;  4X66 T;  5FY1 A;  5L3E B;  2MBG A;  3KFW X;  1IAP A;  2LOS A;  5HEJ A;  5L3G B;  2LM9 A;  3NRY A;  2BKO A;  3TLV A;  4U2Z A;  2V6X A;  4PJJ A;  4QAC A;  1W9R A;  2VKJ A;  4KP3 C;  5HCJ A;  1UV6 A;  1I94 T;  4B3T T;  4A98 A;  1MMG A;  1OED A;  3WTO A;  5AFL A;  4LF7 T;  3RQU A;  2BG9 E;  2XNT A;  2CLY C;  4AQF C;  1ZV4 X;  4OYJ A;  2AXD S;  4EEB A;  4JLE A;  1HG5 A;  4FJO A;  5J2U E;  3FXE B;  1IZN B;  3ZEF B;  2WP9 A;  5BP0 A;  2C5K T;  1N34 T;  1IBL T;  2YIN A;  4HFV A;  2WMN A;  3ANW A;  5JH7 E;  4YHJ A;  2X66 A;  3WTH A;  2UXD T;  3RYC E;  3N9Q A;  2Q9Q B;  1NAF A;  4YTN A;  4LF8 T;  2CMR A;  5AFM B;  2KSR A;  5TAO A;  1SUM B;  3MZK B;  3ZJ1 A;  3O4X E;  2CE7 A;  1UCU A;  3O1H A;  2XM1 A;  2ACZ A;  2IHR 1;  4ILB A;  2UXC T;  5A1L A;  3P50 A;  1LRZ A;  5AQR B;  1M62 A;  2XAS B;  4ZHQ E;  5SYO A;  2C0S A;  2X0H A;  2X00 A;  2BVM A;  2BYS A;  3RI5 A;  3OJA A;  3KV5 A;  3SFD A;  3KVA A;  3SQ6 A;  3W15 B;  5LGU B;  3AE9 A;  4ZJT A;  5JVD E;  3AE6 A;  2V7L A;  2VL8 A;  3CQG B;  2R6G F;  4JBW F;  2N9D A;  2ZM8 A;  1KF6 A;  3IGQ A;  1M7K A;  2VK9 A;  1WCR A;  2WU2 A;  4I43 B;  1G73 A;  4CN6 A;  4IL9 A;  4WBN E;  5F3J A;  2H89 A;  4IE0 A;  4DBR A;  2YN6 A;  1XMQ T;  4TWD A;  3GWH A;  3TLW A;  2IIU A;  2CWO A;  2J1D G;  2OA5 A;  4B3M T;  5H6Q B;  3WIP A;  2NWB A;  3MAC A;  4F8H A;  1OXZ A;  3ZC1 A;  4PFO A;  2XM2 A;  2Y57 A;  1NEK A;  4LML A;  4AKG A;  2C5J A;  3A5X A;  3HL6 A;  3M65 A;  4HFB A;  1ZHC A;  4L5G A;  3MA9 A;  3SFE A;  5F8P A;  5HAX A;  2WQY A;  5FJV A;  4X5T A;  5AQO B;  2ZM6 T;  3PUR A;  5ABE A;  4BA9 A;  2FJD A;  2XAJ B;  4PFP A;  3ZCI A;  4QKN A;  2NTY A;  3BQL A;  4O4I E;  4UY2 A;  2EHO C;  4MFR A;  4LF5 T;  3T1H T;  3LFM A;  3UFE A;  3L09 A;  4NZB A;  4LFB T;  4WZX A;  3WI3 A;  3PJA A;  3UUB A;  3WAJ A;  4KHZ F;  2OLT A;  5FKY A;  5J5I A;  2NP9 A;  4XAX B;  4O4L E;  4B3R T;  3BQK A;  1J5E T;  5GON E;  3P8C D;  2V8S V;  2XAF B;  3H37 A;  4KI0 F;  5AFK A;  5FMN A;  2N1G A;  2W8G A;  5JQG E;  4AIU A;  3V5U A;  3AEC A;  4DVD A;  2DI4 A;  2PBI A;  2X68 A;  1UUR A;  4PJM A;  3ZST A;  4JYA T;  2YK0 A;  2Y56 A;  4N78 D;  4HEA A;  2BKP A;  4HWF A;  3NWI A;  2J62 A;  4TUY E;  1WYB A;  4UF0 A;  3U8L A;  2MPK A;  3WAK A;  2BS4 A;  5HXC A;  1QUU A;  4HTE A;  3KBU A;  4ZRU A;  3N2K E;  3AED A;  3UUM A;  2HPL A;  3FZL B;  2V6Y B;  3U78 A;  4H9O C;  2WS3 A;  2CBI A;  3LK3 B;  2L3L A;  3K3O A;  1S35 A;  2XPK A;  2HPJ A;  4LFA T;  2W67 A;  3ZMT B;  1E1H B;  3LBX B;  1HNX T;  4YHH T;  2UUA T;  2H88 A;  2Y6X A;  1FMW A;  2WDQ A;  5LXT E;  4ZZB A;  2C5I T;  3AXJ A;  1KK7 A;  4M1P A;  3GMI A;  5ADX L;  3MK7 C;  3Q9D A;  3PUW F;  1UX5 A;  3CK6 A;  4U2Y A;  2VAS A;  4L9I A;  4QWN B;  2WWV A;  2EHO D;  2YDR A;  2LSG A;  4KHP T;  5HEO A;  1E2A A;  3RIU A;  3RGL A;  5FVL A;  4IHJ E;  3K3N A;  1OED C;  1I6Z A;  3E08 A;  4EOZ B;  2LM2 A;  2E9X D;  2XZ5 A;  1LKX A;  4UXN B;  2VQE T;  3CKD A;  5IUX A;  2LT3 A;  1IBK T;  4O4H E;  4DR7 T;  4QAB A;  3PMZ A;  4JI7 T;  2E5L T;  4ADZ A;  1MMN A;  5AQH B;  2YU1 A;  5LJM A;  5E0O A;  4IE6 A;  4AI6 A;  4KMC A;  4X1I E;  2X9X A;  3LBX A;  5HEG A;  4EYY R;  3WTM A;  1WR6 A;  3QB5 A;  4AQF A;  2W00 A;  3H3A A;  1Z0P A;  4B3S T;  4QXH B;  2DNX A;  3RC8 A;  2UU9 T;  4PK4 A;  3P7I A;  5FL1 A;  3ZDH A;  1GQE A;  4OHF A;  4CQI A;  3C4Z A;  4LMJ A;  3JAE A;  3U8K A;  2BBH A;  3Q5X A;  3TLS A;  4IE5 A;  2AE9 A;  1DU2 A;  3WTK A;  2W66 A;  5AQL B;  2PJQ A;  3VU7 H;  3KBT A;  4EZ1 A;  1JNR A;  4H9N C;  2JIW A;  4DR6 T;  4BFQ A;  4HFH A;  4U7Y A;  1BR1 A;  2Z6E A;  3RIF A;  1XWM A;  3J9X 1;  3F31 A;  3QNU A;  2KZ7 B;  3NRX A;  5AQG B;  3C98 B;  3ZT6 A;  4EIW A;  3C64 A;  5CJ5 A;  2DHR A;  4I50 E;  2YMD A;  3EUH A;  3A7M A;  3N5L A;  4GK5 E;  5IYZ E;  5DAB A;  3HKB E;  4MHC A;  2BYR A;  2WU5 A;  3C4X A;  3KV9 A;  4TN7 B;  3B13 A;  5HXR A;  4OX9 T;  4IGU A;  2XZ6 A;  4YT0 A;  1E7P A;  5AQI B;  5L3B B;  2E5V A;  4AKL A;  3P4P A;  4AFT A;  4JI6 T;  1O3X A;  3C84 A;  4AXP A;  2ACX A;  3U8M A;  3EDU A;  3PDY A;  4XBF B;  1HS7 A;  4IDP A;  4WYV A;  4DR5 T;  4F6R C;  2CXF A;  4QH1 A;  1MIW A;  4WW0 A;  3ZYM A;  2H3R A;  2JRK A;  3ABV A;  4YSX A;  2MTQ A;  3UQ4 A;  1ZEE A;  3Q5W A;  4IRE A;  3FZK B;  4H9S E;  4H9R C;  3O9X A;  3LK4 2;  5L4E A;  2W0G A;  5HYA A;  2Y54 A;  3PV0 F; 
#chains in the Genus database with same CATH homology
 1OED E;  4PIR A;  2ZJV A;  5J5F A;  4HFD A;  2LKH A;  4ILB A;  5J0Z A;  3WTN A;  2YME A;  3P50 A;  3JAF A;  2VL0 A;  5FJV A;  5HEJ A;  2XNV A;  4X5T A;  5AFH A;  3UU8 A;  4BFQ A;  4HFH A;  4ZZB A;  5BRX A;  5KZU A;  5LG3 A;  3TLV A;  2BG9 A;  2XNU A;  2XQ9 A;  4FRR A;  4A97 A;  4UM3 P;  1I9B A;  5SYO A;  4DBM A;  2XQ3 A;  4TNV A;  3RIF A;  2X00 A;  4QAC A;  3U8N A;  2X00 D;  2XQ7 A;  2BYS A;  2Y58 A;  4Z90 A;  5HCJ A;  1UV6 A;  4UY2 A;  3RI5 A;  4TWF A;  4ZJS A;  3SQ6 A;  4A98 A;  4TNW A;  4QH4 A;  3JAD A;  3LSV A;  4NZB A;  1OED A;  4ZR6 A;  3WTO A;  5AFL A;  3RIA A;  3RQU A;  2BG9 E;  2YMD A;  2XNT A;  5AFM A;  5LXB A;  2XQ4 A;  3EI0 A;  5HEO A;  4ZJT A;  2XQ5 A;  2M6I A;  3UUB A;  2WNL A;  3T4M A;  4ZK4 A;  3WTJ A;  2BR7 A;  4AFG A;  2BYR A;  4ALX A;  4TWH A;  3UU5 A;  4HQP A;  4QH5 A;  5J5I A;  5L47 A;  2BYN A;  1OED C;  3ZKR A;  4HFE A;  2YKS A;  2PH9 A;  5BP0 A;  3TLU A;  4ZZC A;  3IGQ A;  3SH1 A;  2XQ8 A;  5KE4 A;  4XK9 A;  2LM2 A;  3WTL A;  4ZK1 A;  3PEO A;  2XZ5 A;  2XZ6 A;  5TVC A;  5AFK A;  5JME A;  5IUX A;  2BG9 B;  4IL9 A;  2UZ6 A;  2W8G A;  2LLY A;  2XYT A;  5CFB A;  4QAB A;  3PMZ A;  2YN6 A;  4XHE A;  4AFT A;  4ILA A;  4TWD A;  4IL4 A;  1UX2 A;  2WNC A;  3C79 A;  3C84 A;  3TLW A;  4UM3 A;  4UXU A;  4HFI A;  3EAM A;  4WV9 A;  3WTH A;  2M6B A;  3U8M A;  2BR8 A;  2WNJ A;  5BW2 A;  4UM1 A;  2WZY A;  5HEG A;  3WTM A;  2XQA A;  3UU4 A;  2Y56 A;  5HCM A;  3RHW A;  5J5H A;  2Y7Y A;  2PGZ A;  5AIN A;  5L4H A;  4QH1 A;  2BG9 C;  3WIP A;  2XQ6 A;  3U8L A;  2LKG A;  2BYQ A;  5AFJ A;  3P4W A;  3UQ7 A;  4F8H A;  2QC1 B;  3ZDG A;  3UU3 A;  5AFM B;  4HFC A;  2KSR A;  5CO5 A;  3ZDH A;  5AFN A;  3UQ4 A;  2BJ0 A;  4Z91 A;  2Y57 A;  4D01 A;  3RQW A;  4LML A;  2WN9 A;  2XYS A;  5HEH A;  4ZRU A;  2YOE A;  1OED B;  4IRE A;  3JAE A;  4LMJ A;  3SQ9 A;  4AFH A;  3U8K A;  3TLS A;  2BYP A;  5J5G A;  3UU6 A;  4NPP A;  4B5D A;  3U8J A;  2C9T A;  5L4E A;  3WTK A;  2MAW A;  3TLT A;  2W8F A;  2ZJU A;  3EHZ A;  3GUA A;  4COF A;  3WTI A;  4LMK A;  4ILC A;  4HFB A;  4QAA A;  1UW6 A;  4BQT A;  4EZ1 A;  2Y54 A;  3SIO A;  5HEU A;  4UM3 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...