3LSVA

Structure of the a237f mutant of the pentameric ligand gated ion channel from gloeobacter violaceus
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ligand-gated ion channel
molecule tags Membrane protein, transport protein
source organism Gloeobacter violaceus
publication title One-microsecond molecular dynamics simulation of channel gating in a nicotinic receptor homologue.
pubmed doi rcsb
total genus 99
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3lsvA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3lsvA01
4HFCA 5KE4A 2C9TA 2PGZA 4PIRA 5AFMA 5J5IA 3ZDHA 2M6IA 2YMDA 3WTKA 2XQAA 5J0ZA 3TLUA 4LMLA 2ZJVA 4ZRUA 1OEDA 3IGQA 3UQ4A 4D01A 3WTIA 3RQWA 4LMKA 5BP0A 3JAFA 3WTHA 5CO5A 3ZDGA 5AFMB 3UU8A 2BG9E 5BRXA 2BR7A 3P4WA 5HEJA 2QC1B 1UX2A 4ILBA 4F8HA 2UZ6A 2BG9B 2LM2A 5AFLA 2XQ3A 3RHWA 5IUXA 2WNJA 2BG9C 5HEGA 4EZ1A 4BQTA 4HFEA 2XQ4A 4ZZCA 2KSRA 5KZUA 3P50A 3UUBA 3TLVA 4XHEA 2WN9A 4UM3P 4Z91A 3U8LA 4AFHA 4TWHA 4B5DA 4LMJA 3WIPA 5L47A 4AFGA 2XZ6A 5JMEA 3WTLA 3TLTA 2XQ7A 4WV9A 3U8NA 2LKGA 3EHZA 2WNLA 2W8GA 3UU3A 3ZKRA 2LLYA 4UM3S 3SQ6A 3UQ7A 5L4EA 4ZJSA 4TNWA 1UW6A 5CFBA 3WTMA 4TWDA 1OEDC 3C84A 3T4MA 4ZZBA 2BYNA 2XNVA 2Y56A 5HCMA 4DBMA 5AFKA 3SIOA 4HFDA 3TLSA 2Y54A 5HEHA 2BR8A 4NPPA 1I9BA 2XNTA 4FRRA 4ZJTA 5J5FA 4Z90A 4QABA 5FJVA 4ZK1A 2Y7YA 2BYPA 1OEDE 5HEUA 2Y57A 5J5HA 1OEDB 3EI0A 4ILAA 4IL9A 4HFBA 3RIAA 3RQUA 2X00D 2X00A 3U8KA 4ALXA 5AFHA 4QH5A 5BW2A 4A97A 2M6BA 2XQ9A 3WTNA 4HFHA 2LKHA 3PMZA 4XK9A 2VL0A 3TLWA 4QH4A 4QH1A 3EAMA 5L4HA 2ZJUA 2BYQA 3LSVA 2W8FA 4A98A 5LG3A 5SYOA 5AINA 5AFJA 4X5TA 3UU6A 2YOEA 2XYTA 3JADA 2YN6A 3UU4A 2MAWA 4QACA 2XYSA 3SH1A 3UU5A 2BG9A 1UV6A 2XNUA 3U8JA 4AFTA 2XQ5A 5LXBA 4COFA 2YKSA 2WZYA 3SQ9A 2BYSA 4UM1A 4NZBA 4TNVA 4UM3A 2PH9A 4UXUA 4ILCA 3U8MA 4TWFA 3WTJA 3GUAA 5AFNA 3RIFA 2XQ6A 4HQPA 3WTOA 5HCJA 2WNCA 4BFQA 2BJ0A 2YMEA 3C79A 2BYRA 2XQ8A 3JAEA 5HEOA 4HFIA 2XZ5A 4UY2A 5TVCA 4ZK4A 2Y58A 4QAAA 4ZR6A 4IL4A 5J5GA 3RI5A 3PEOA 4IREA
chains in the Genus database with same CATH superfamily
5AQNB 3N9PA 2YMDA 1VCTA 3KBUA 3JAFA 1XMQT 3NRXA 5IWAT 3N2OA 2BVLA 5HXHA 3OVUA 3AAIA 4DNDA 3PUYF 2H88A 2W2UA 1HR0T 4ASKA 2I59A 4YXDA 4TWHA 5LOVE 2I6HA 2FJDA 4EEDA 1FJGT 4KMCA 4AQGA 1IZNB 4X64T 2PTFA 3EHZA 3P4RA 3QK6A 3SQ6A 1IBLT 5JRCA 1XDOA 5HCMA 5AFKA 4YY3T 2V5CA 3AA6B 5L3GB 4CI1B 4L0RA 1I9BA 4ZK1A 4H9SE 4ILAA 4HEAA 4IHJE 4IDNA 2Q9QB 2XQ9A 4JEUB 4DV1T 3AXJB 5LG3A 3UU4A 5LA6E 1G73A 3OTOT 3ZSTA 5AQVB 3WI3A 3N9OA 2X51A 5FVKA 4YHHT 4UXUA 3ANWA 3WTJA 1W0BA 5ABFB 3C4WA 3C79A 4GYRA 2XZEA 4LFCT 3N9LA 4ILUA 4ISSA 1YKEB 1MIYA 1WYBA 1ZP0A 4GIWA 5J0ZA 1ZKEA 4ZRUA 4B3MT 1OEDA 4AFTA 3RRWA 3UU8A 4IDOA 2UZ6A 4C90A 4DMWA 3FBLA 3W15B 3EVYA 5AQIB 4ZOLE 2JQ9A 1BR2A 4UVBB 2WU2A 5JH7E 2CWYA 5EK4A 3ZKRA 2KXPB 5BMVE 4BAYB 4WZXA 2UXNB 2UUBT 1D1AA 2XUEA 1L0VA 2XAHB 4KHPT 3OPCA 2E9XA 4NPPA 4UV8B 3VHLA 3PV0F 4QX7B 4G63A 5BR8T 4DV7T 5DABA 2WDRA 1Y64B 5FNVE 4DR5T 5KXJA 2BZBA 2YDSA 1LVKA 3IF8B 2WWVA 4TV8E 1T8BA 3CKDA 2WY2A 4ZI3D 3AEFA 2XNUA 4U33A 1MNEA 1D0YA 2YK0A 2AE9A 4NXNT 3AEEA 5AQRB 5JDGA 1N36T 1O3XA 2XQ8A 3RPUA 2Y6XA 2Y58A 3ZMVB 4IREA 3EUHA 2PGZA 5A1LA 1H7CA 5LBQB 3IHRA 2ODVA 2KWIB 3ZLIA 3AE1A 3P4WA 3R6NA 5HEJA 1KNPA 2WWUA 5AFLA 3E22E 4NUUA 1HS7A 5CB4E 4TUYE 3AAAB 2NP9A 4QKNA 4O2AE 4EZHA 3QNUA 2W63A 2Y56A 2BKNA 1NWMX 3TLSA 2VK9A 4WW0A 2Y57A 5J5HA 3RQUA 2CA5A 5FY1A 5LGNB 5L3BB 4M1PA 2NWBA 5CA1E 2WQYA 1YW0A 4JI0T 4A98A 3UU6A 2MAWA 3QB5A 4QACA 4IIJE 4KX6A 3ZSSA 4ANJA 5AQFB 2W62A 5HAXA 2BBJA 1SE7A 3ANWB 4UM1A 3O1HA 2VURA 2SPCA 5LGUB 2X9WA 5M4YA 3HKEE 4TN7B 4EYUA 5C2TA 2XQ6A 5FL1A 4DV0T 2XTLA 3JC6D 4YJ3E 1HNZT 4B6XA 5LHIB 2X9XA 2V8SV 3K3QC 2V5DA 4CXXA 5LHGB 4H63H 5ABGA 3PUWF 3N2GE 1T72A 4DV4T 3L09A 5AFMB 5LCYA 1SHZC 1UCUA 1Y01A 5CA0E 1S35A 3RHWA 2V6XA 2XQ4A 3I0OA 2IAKA 5KZUA 3NZQA 4IE4A 2J62A 4K0UA 2KT9A 4AKIA 4X65T 2CM0A 2KNDA 3A5XA 3N9QA 5JREA 2LKGA 5HYAA 4UM3S 4LF5T 3WTMA 3PJAA 1YD8G 2GK9A 4AQYT 2IUBA 3E0ZA 5FP3A 4A97A 5JDLA 3C51A 4NUVA 3V5UA 2DHRA 3N5LA 2LKHA 2LSYA 3HI2A 1W0AA 5SYOA 1BR1A 2ZMAA 4F6RC 2XYSA 1LRZA 2JMKA 5TAOA 4COFA 1XWMA 2IIUA 2LRKA 1U5PA 3CIRA 3FXEB 2V7MA 4ILCA 4U7YA 3NKZA 5JVDE 3OJAA 5KMGP 1J5ET 3CQCB 3AVRA 5TVCA 3KV4A 2LOSA 3RYIE 2V7KA 2AXDS 4B3RT 1M62A 4AXPA 3N9NA 3B13A 4DBQA 4X62T 3H3AA 2VWAA 5CGMA 4HWFA 1IAPA 2H7VC 1YKHB 4O4LE 3PDYA 4UR9A 4EAHA 2KSRA 2X9HA 2CLYC 2WSSV 4IE7A 3KFWX 3FZFB 3P4QA 4BA9A 1UURA 4NIQA 3U78A 3P4PA 2XQ7A 1SA0E 1WFDA 3QUJA 3C84A 3T4MA 2L8KA 2BYNA 5L3DB 4YHJA 3SIOA 4QWNB 1X79A 4JI4T 4DR7T 2MOZA 5HEUA 4ZI7E 5ADXL 2NW8A 2RPAA 1N34T 3RF1A 3WTNA 4U7IA 1X9BA 1ZEEA 1Z8UA 4UV9B 4DVDA 3LSVA 1HTJF 4HWHA 3AE9A 2PG8A 3CX6B 3JADA 2XAJB 4JV5T 5LBMA 1MNDA 3BQIA 2UU9T 5FVLA 4O2BE 1KK7A 2CRBA 4X1KE 4CN1A 5FYMA 5IYZE 4O8SA 5HWXA 4IE5A 4LF8T 4X1IE 3SFDA 3LK3B 4HWDA 3UFEA 4HQPA 4H9RC 2HN2A 5AQTB 4CXYA 3LBXB 5FXVA 1KNRA 4MHCA 3NVOA 4CXWA 2DNXA 4PAGA 3LJCA 4N78D 4L5GA 2V7IA 5JDNA 2NR4A 3RRCA 5BP0A 1IBKT 4JUYA 3RC3A 4P1NA 2A72A 5JQGE 3EDVA 4U3CA 2WB5A 1HNXT 1HF8A 3KVBA 3UT5E 4QXHB 4HE8A 1XNQT 4AFGA 2UXXB 2XZ6A 2A2FX 4EXTA 1WR0A 2LSIA 3UU3A 4LF4T 2XSAA 4MFRA 3RYFE 4CZZB 4JI8T 4ZJTA 2Q9QA 3P7IA 4HGAA 2OLTA 3RLFF 3H37A 2YU2A 4XK9A 4QH1A 5LYJE 5DJQC 4ZHQE 1NAFA 3O1JA 2YOEA 2H3RA 2XYTA 4BJNA 1D0ZA 4CI2B 3HL6A 2N2NA 2XJ7A 1IJ6A 4DV2T 4PJJA 4PJMA 5FL0A 4YTPA 1QUUA 2HH7A 4PJLA 1UK5A 4PFPA 3AE6A 4AI6A 1HFAA 4H63V 2NTYA 3PEOA 4DV3T 1QLBA 4X66T 2ZJVA 2CCQA 3KBTA 3JCFA 4IDPA 1OWAA 3P4SA 2BG9E 3ABVA 5AQGB 1MMDA 4EIWA 4ERRA 4ILBA 1IBMT 1YQ4A 2IMLA 3A8YC 4BQTA 5DQVA 4V1Av 5HXRA 5L3FB 3ZN0B 1KF6A 2XPKA 2FJBA 3WIPA 4AIUA 3VKHA 4CN6A 4I43B 3E08A 4UVCB 3ZN1B 4WNKA 3GMIA 2QGSA 3Q5EA 2CBJA 1I94T 2LM9A 2XNVA 4CQIA 2JRKA 3ZT6A 3EI0A 4HFBA 5BW2A 2WBLA 3UULA 2CLYB 3PUXF 3EAMA 5FY7A 4H9NC 4HWIB 5AINA 2CXLA 3GN5B 5AFJA 4X5TA 5LP6E 3FZHB 3C4XA 5GONE 3O1IA 3UU5A 4O4HE 5ABFA 2PFVA 4CI3B 2BS4A 4FI5A 3KV9A 2QRXA 2G0UA 1LKXA 3L3PA 3F2EA 4AKLA 2X0LB 3HKBE 4UEMA 1HX8A 4E7ZA 2D0UA 2NW9A 2KWHA 4GKJT 2BR7A 3SS1A 4UXNB 2DI4A 3B5MA 5F8PA 1D1BA 5FXXA 4BJMA 1CHUA 3OYXA 2JMHA 2WM9A 5JDQA 4AFHA 2YEVC 4OX9T 4LFBT 5AQHB 2HPLA 1UX4A 2BDEA 4KUMB 3LFMA 3ZJ1A 5CFBA 1J1JA 2XM2A 4DBMA 2ACXA 2XM1A 2XNTA 2YDRA 4Z90A 2Y8DA 5FJVA 5AQJB 5LJNA 2BYPA 3ETUA 4IL9A 2W4XA 3AE3A 1QSDA 3T1YT 2W61A 3C4ZA 2BKPA 2JIWA 4QH4A 2J1DG 3KVAA 3IBPA 5AQUB 3V5SA 3LDQB 4FJOA 3A7MA 3SH1A 2B1EA 3C50A 4DR6T 4JI7T 5H6QB 3TKLB 4QXBB 4UM3A 3F31A 4I0UA 4GK0E 4AKHA 1FMVA 4WBOA 2UUCT 1N33T 4B3TT 2WNCA 2X0YA 3EABA 2BJ0A 2XQYA 3ZEFB 2XZ5A 3PU8A 3RI5A 2BS3A 2C9TA 2E9XB 1G8XA 1MMGA 5AFMA 4JBWF 3CVRA 3UQ4A 3WTHA 3ZC0A 1JNRA 2BS2A 3ZMZB 4DBRA 1T7SA 3CWZB 2XQ3A 5HEGA 1E7PA 1YQ3A 2IC9A 3AVSA 1OXZA 3UUBA 3ONJA 3HKDE 3MK7C 3U8LA 4LMJA 1KNZA 1N32T 5JMEA 4GYSA 3CX8B 3TLTA 2NW7A 3ZYMA 3I1AA 4J2CA 5AFUL 2WAUA 2DWGA 2VVSA 1UUSA 1XMOT 5HEHA 4FRRA 1UGOA 4JEHB 4IDQA 5J2UE 3MZKB 5JR9C 3KDSE 3RYHE 5LMNT 2IW5B 3ZYKA 5FXZA 3H3MA 3TLWA 3Q5DA 3PUSA 4L9IA 4WBNE 5LNKA 4KHZF 3T8OA 3FZLB 2WZHA 4U72A 4YTNA 2B76A 4WYVA 3U8JA 2WS3A 5LXBA 2YKSA 2WZYA 3EDUA 1BR0A 3Q9DA 4ZI3C 4KP3C 2LSKA 5JDHA 2N1GA 2HPJA 3AEAA 3AEGA 2ZM2A 4OFZA 1HX1B 4PFOA 4DUZT 5KE4A 4IT4A 4JI3T 2VQFT 4PIRA 5J5IA 5ABEA 4D01A 1SUMB 2DCFA 1E1HB 4LMKA 5CO5A 3J7Yq 3CX7B 5E0OA 3X1DA 3ONLC 1NENA 1WR6A 2V1DB 2HHHT 4ZS3A 3HR0A 5LHHB 2WNJA 5HWYA 4YSYA 1WCRA 3ONXA 4JI6T 2LEHA 4UM3P 4XBFB 4B5DA 4YT0A 3Q2MA 2H89A 2C5KT 2WNLA 4AKGA 3J9X1 2LRLA 2CXFA 2XAFB 4LF9T 4HFDA 4DV5T 2D0TA 4EOZB 2Y54A 2X66A 2A3DA 2X00A 4DR2T 4I50E 2WDQA 3FBZA 3CQXC 1W9RA 1KEYA 3PMZA 4Z8XA 1M7KA 5FXWA 3BQKA 3WAKA 4QXCB 2PBIA 3PTRB 2XQ5A 4AQFA 2V7JA 3VR9A 3SQ9A 4JI5T 2PH9A 3GWHA 2UXBT 3VRBA 5HCJA 2K48A 3ESLA 2K5BB 4JYAT 3JAEA 2W67A 5HEOA 2FJEA 2XSBA 4ZXLA 2RP4A 3RC8A 3ZPOA 2LJLA 3ZT5A 4HFCA 2OV9A 3VR8A 3ZDHA 2XQAA 2ES0A 2DWKA 3RQWA 3AA1B 3PUQA 3PUZF 3RIUC 5BRXA 2WCAA 3BK9A 3LK42 2XAGB 3B57A 4X20E 2K24A 2P9BA 1U4QA 3O4XE 5IUXA 4AISA 4EZ1A 4I55E 2M67A 4C91A 2LE8A 2X0HA 2X67A 2E8IA 2IC6A 3OBVE 3SFEA 2MYSA 3PE0A 2CBIA 3HA4A 1MMNA 4ZI2D 3WTLA 3CPZA 1UW6A 4OYJA 2J47A 4DUYT 1IJ5A 3NBXX 1V9DA 2BR8A 2CHOA 3UUXB 4OK0A 1OEDE 4DMVA 1OEDB 2A9UA 2PJQA 5J1GA 1GQEA 2E9XD 3PJAJ 4ZS2A 4YSZA 2ZM0A 4B3ST 2LHRA 3AEBA 4QX8B 5KDMC 1FIOA 4YFSA 4PNIA 4A56A 2JQQA 4MBQA 1E2AA 4K0KT 2QVAA 2XY8B 2VKOA 2BBHA 1HG2A 1JNZA 2L9QA 2QYWA 3KV5A 3GUAA 4BFQA 3WTOA 1WLXA 3DJBA 3DP7A 4EB6E 4GK5E 3FB2A 3R84B 3NWIA 4YLHA 2VKJA 4ZI2C 3TLUA 5AQQB 2QC1B 2QA7A 2JPFA 3ZJ2A 1MIWA 2BG9C 4IDZA 4Z91A 2XASB 5FMNA 2LSGA 2DLRA 5LXTE 3VRAA 2V26A 5JDFA 4PK4A 2LLYA 5EK3A 5L4EA 2D2SA 4TWDA 4H9QC 4TX5A 4ZZBA 2IDOB 3ZC1A 3NRYA 4UVAB 4QABA 2UUAT 4PK6A 3RIAA 4ALXA 2OA5A 3QB5K 4U74A 2BKOA 2YU1A 4MLKA 4UF0B 1BR4A 2ZLYA 5LGTB 4OHFA 3AXJA 5HXEA 3ZMTB 2BG9A 1MMAA 2VQET 3PUAA 4X1YE 2CWOA 2RA1A 3PU3A 5EZYE 4NZBA 3M3ZB 3RGLA 1ZHCA 4DR4T 2VVNA 4QHOA 3U8MA 4HFVA 1US7B 5LG4A 2KLQA 1WRDA 3AE5A 2YMEA 3RIUA 1YXRA 4ZK4A 4U31A 2MTQA 2BVMA 3OYZA 2CE7A 2M6IA 4GKKT 2K3WA 2MBGA 3WTIA 3ZDGA 2NOXA 1W09A 4HKAA 2ACZA 2XAQB 3K1SA 4F8HA 1I6ZA 1EZ3A 3BQLA 4YJ2E 3TLVA 4XHEA 4EYYR 5FY0A 2MPKA 2X68A 4LFAT 3U8NA 1HG5A 3UQ7A 2H7OA 3MA9A 2V7LA 4XZCA 2F4VT 2WMOA 4PK5A 2UXCT 2X00D 4H9PC 3U8KA 3AAEB 2VASA 2IHR1 1ZV4X 4U2ZA 2VL0A 3GA8A 2ZJUA 5F5WA 3Q5XA 4EV6A 3PUGA 3MXZA 3CQGB 3K3OA 3AE7A 3VKGA 4CN4A 1HNWT 5AQLB 2WP9A 5JR9A 2LOPA 3M65A 1HCIA 1XNRT 3MKDA 4ADZA 2FBWA 2KZ7B 4QAAA 2V6YA 4A5XA 4JLEA 2E2AA 3AB3B 3KV6A 4H9OC 4EEBA 2C5JA 5AQKB 4IE0A 2CPTA 3JC6C 4LMLA 4EGWA 3IGQA 2FUPA 3FZKB 4LF6T 2EHOD 4Q25A 1XDPA 2LM2A 1B7TA 5AQOB 1VOMA 3FXDB 2VKDA 3FHNA 2XHEB 3AE4A 3P50A 3O9XA 3IEEA 3ZMSB 3ZCJA 2Z6EA 3Q5WA 2K9AA 3PURA 2EHOC 2UXDT 1OEDC 5C3JA 4U2YA 2WU5A 4O4JE 3UTKA 2LHNA 2Y48B 5H6RB 2LSJA 1FEWA 5HXSA 1R8IA 5AFHA 4QH5A 1J5WA 2VKHA 4JI2T 2CXDA 5HXCA 4O4IE 5JDMA 3RKGA 3AECA 2JQKA 3GN5A 3MJXA 1AJ3A 2ODUA 4OYKA 1UV6A 4UF0A 5EK2A 2YINA 3AA0B 4XAXB 4GOUA 2BYSA 4P0BA 3LK2B 4TNVA 2CEAA 4TWFA 2WZIA 5IHYA 2E9XC 3AE2A 3SOLA 3K8PC 2D9DA 3L8RA 5JRCB 2W0GA 2JQHA 4TV9E 5AQSB 3I9WA 3N9MA 1DU2A 3ZT7A 3WTKA 4E7SA 3N2KE 5AQMB 4ISTA 3LBXA 4AQFC 5CJ5A 3G06A 3ZYLA 5FKYA 3KINB 3AE8A 5F3JA 1S94A 4G2AA 4HFEA 4TZ4C 2KINB 3UUNA 2C0SA 2WDVA 3CMLA 1Z0PA 1XZYA 3RKOA 2W8GA 1UX5A 3ZCIA 4ZEYA 4IGUA 5DQWA 2HN1A 3SRZA 2KMFA 3AEDA 2E5LT 3PUVF 1VCSA 4AKRB 2E5VA 4YSXA 3NZPA 3MACA 4HTEA 2W8FA 5ETWA 3SWHA 2YN6A 4KBMB 2FJAA 2X9YA 2LT3A 1D1CA 2VB6A 3ETVA 5C8YE 5J2TE 3P8CD 2ZM6T 3T1HT 2D5UA 2CMRA 5KX5E 2W66A 1CUNA 5AFNA 1MIVA 2J4GA 2V6YB 2JJ9A 4I4TE 1KFYA 4UY2A 4NXMT 4PJNA 5JTGA 4IL4A 4ZR6A 5J5GA 3OKQA 3IA3A 4EZ4A 2DL1A 3I0QA 4JI1T 2I0MA 4UELA 1LVFA 3LG7A 2EHOA 4PW8A 1UX2A 2BG9B 5L2LA 3K3NA 5L3EB 3AA7B 4HN9A 3RYCE 4ZZCA 2N9DA 2WN9A 1T98A 5LMUT 5L47A 4DV6T 3I9YA 2NTXA 4WV9A 4KI0F 4ZJSA 4TNWA 5JR9B 5ABHA 2L3LA 4DR3T 3U3IA 1VRBA 3ZMUB 2WMNA 3RX6A 2R6GF 3HKCE 4YTMA 4P0AA 2ZM8A 3C98B 5J5FA 2Q9QD 2Y7YA 5AQPB 2CHNA 2YDQA 3D0TA 3WAJA 2M6BA 4DIDB 4HFHA 1D0XA 4P09A 3UFGA 5LJMA 3DTOA 5L4HA 2BYQA 4MALA 3CK6A 1ZOYA 2EHOB 3UUMA 3L39A 1FMWA 3RH3A 1NEKA 1WYCA 3F57A 3S4UA 4LF7T 5L3CB 3VU7H 4HWCA 3FZMB 2VL8A 2Q9QC 3RIFA 4UIGA 3C64A 5LB7B 4DO0A 2BYRA 3QC9A 4HFIA 4DR1T 3QOFA 4IE6A 2W00A 2C5IT
chains in the Genus database with same CATH topology
4HFCA 5KE4A 2C9TA 2PGZA 4PIRA 5AFMA 5J5IA 3ZDHA 2M6IA 2YMDA 3WTKA 2XQAA 5J0ZA 3TLUA 4LMLA 2ZJVA 4ZRUA 1OEDA 3IGQA 3UQ4A 4D01A 3WTIA 3RQWA 4LMKA 5BP0A 3JAFA 3WTHA 5CO5A 3ZDGA 5AFMB 3UU8A 2BG9E 5BRXA 2BR7A 3P4WA 5HEJA 2QC1B 1UX2A 4ILBA 4F8HA 2UZ6A 2BG9B 2LM2A 5AFLA 2XQ3A 3RHWA 5IUXA 2WNJA 2BG9C 5HEGA 4EZ1A 4BQTA 4HFEA 2XQ4A 4ZZCA 2KSRA 5KZUA 3P50A 3UUBA 3TLVA 4XHEA 2WN9A 4UM3P 4Z91A 3U8LA 4AFHA 4TWHA 4B5DA 4LMJA 3WIPA 5L47A 4AFGA 2XZ6A 5JMEA 3WTLA 3TLTA 2XQ7A 4WV9A 3U8NA 2LKGA 3EHZA 2WNLA 2W8GA 3UU3A 3ZKRA 2LLYA 4UM3S 3SQ6A 3UQ7A 5L4EA 4ZJSA 4TNWA 1UW6A 5CFBA 3WTMA 4TWDA 1OEDC 3C84A 3T4MA 4ZZBA 2BYNA 2XNVA 2Y56A 5HCMA 4DBMA 5AFKA 3SIOA 4HFDA 3TLSA 2Y54A 5HEHA 2BR8A 4NPPA 1I9BA 2XNTA 4FRRA 4ZJTA 5J5FA 4Z90A 4QABA 5FJVA 4ZK1A 2Y7YA 2BYPA 1OEDE 5HEUA 2Y57A 5J5HA 1OEDB 3EI0A 4ILAA 4IL9A 4HFBA 3RIAA 3RQUA 2X00D 2X00A 3U8KA 4ALXA 5AFHA 4QH5A 5BW2A 4A97A 2M6BA 2XQ9A 3WTNA 4HFHA 2LKHA 3PMZA 4XK9A 2VL0A 3TLWA 4QH4A 4QH1A 3EAMA 5L4HA 2ZJUA 2BYQA 3LSVA 2W8FA 4A98A 5LG3A 5SYOA 5AINA 5AFJA 4X5TA 3UU6A 2YOEA 2XYTA 3JADA 2YN6A 3UU4A 2MAWA 4QACA 2XYSA 3SH1A 3UU5A 2BG9A 1UV6A 2XNUA 3U8JA 4AFTA 2XQ5A 5LXBA 4COFA 2YKSA 2WZYA 3SQ9A 2BYSA 4UM1A 4NZBA 4TNVA 4UM3A 2PH9A 4UXUA 4ILCA 3U8MA 4TWFA 3WTJA 3GUAA 5AFNA 3RIFA 2XQ6A 4HQPA 3WTOA 5HCJA 2WNCA 4BFQA 2BJ0A 2YMEA 3C79A 2BYRA 2XQ8A 3JAEA 5HEOA 4HFIA 2XZ5A 4UY2A 5TVCA 4ZK4A 2Y58A 4QAAA 4ZR6A 4IL4A 5J5GA 3RI5A 3PEOA 4IREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFC A;  5KE4 A;  2C9T A;  2PGZ A;  4PIR A;  5AFM A;  5J5I A;  3ZDH A;  2M6I A;  2YMD A;  3WTK A;  2XQA A;  5J0Z A;  3TLU A;  4LML A;  2ZJV A;  4ZRU A;  1OED A;  3IGQ A;  3UQ4 A;  4D01 A;  3WTI A;  3RQW A;  4LMK A;  5BP0 A;  3JAF A;  3WTH A;  5CO5 A;  3ZDG A;  5AFM B;  3UU8 A;  2BG9 E;  5BRX A;  2BR7 A;  3P4W A;  5HEJ A;  2QC1 B;  1UX2 A;  4ILB A;  4F8H A;  2UZ6 A;  2BG9 B;  2LM2 A;  5AFL A;  2XQ3 A;  3RHW A;  5IUX A;  2WNJ A;  2BG9 C;  5HEG A;  4EZ1 A;  4BQT A;  4HFE A;  2XQ4 A;  4ZZC A;  2KSR A;  5KZU A;  3P50 A;  3UUB A;  3TLV A;  4XHE A;  2WN9 A;  4UM3 P;  4Z91 A;  3U8L A;  4AFH A;  4TWH A;  4B5D A;  4LMJ A;  3WIP A;  5L47 A;  4AFG A;  2XZ6 A;  5JME A;  3WTL A;  3TLT A;  2XQ7 A;  4WV9 A;  3U8N A;  2LKG A;  3EHZ A;  2WNL A;  2W8G A;  3UU3 A;  3ZKR A;  2LLY A;  4UM3 S;  3SQ6 A;  3UQ7 A;  5L4E A;  4ZJS A;  4TNW A;  1UW6 A;  5CFB A;  3WTM A;  4TWD A;  1OED C;  3C84 A;  3T4M A;  4ZZB A;  2BYN A;  2XNV A;  2Y56 A;  5HCM A;  4DBM A;  5AFK A;  3SIO A;  4HFD A;  3TLS A;  2Y54 A;  5HEH A;  2BR8 A;  4NPP A;  1I9B A;  2XNT A;  4FRR A;  4ZJT A;  5J5F A;  4Z90 A;  4QAB A;  5FJV A;  4ZK1 A;  2Y7Y A;  2BYP A;  1OED E;  5HEU A;  2Y57 A;  5J5H A;  1OED B;  3EI0 A;  4ILA A;  4IL9 A;  4HFB A;  3RIA A;  3RQU A;  2X00 D;  2X00 A;  3U8K A;  4ALX A;  5AFH A;  4QH5 A;  5BW2 A;  4A97 A;  2M6B A;  2XQ9 A;  3WTN A;  4HFH A;  2LKH A;  3PMZ A;  4XK9 A;  2VL0 A;  3TLW A;  4QH4 A;  4QH1 A;  3EAM A;  5L4H A;  2ZJU A;  2BYQ A;  3LSV A;  2W8F A;  4A98 A;  5LG3 A;  5SYO A;  5AIN A;  5AFJ A;  4X5T A;  3UU6 A;  2YOE A;  2XYT A;  3JAD A;  2YN6 A;  3UU4 A;  2MAW A;  4QAC A;  2XYS A;  3SH1 A;  3UU5 A;  2BG9 A;  1UV6 A;  2XNU A;  3U8J A;  4AFT A;  2XQ5 A;  5LXB A;  4COF A;  2YKS A;  2WZY A;  3SQ9 A;  2BYS A;  4UM1 A;  4NZB A;  4TNV A;  4UM3 A;  2PH9 A;  4UXU A;  4ILC A;  3U8M A;  4TWF A;  3WTJ A;  3GUA A;  5AFN A;  3RIF A;  2XQ6 A;  4HQP A;  3WTO A;  5HCJ A;  2WNC A;  4BFQ A;  2BJ0 A;  2YME A;  3C79 A;  2BYR A;  2XQ8 A;  3JAE A;  5HEO A;  4HFI A;  2XZ5 A;  4UY2 A;  5TVC A;  4ZK4 A;  2Y58 A;  4QAA A;  4ZR6 A;  4IL4 A;  5J5G A;  3RI5 A;  3PEO A;  4IRE A; 
#chains in the Genus database with same CATH topology
 5AQN B;  3N9P A;  2YMD A;  1VCT A;  3KBU A;  3JAF A;  1XMQ T;  3NRX A;  5IWA T;  3N2O A;  2BVL A;  5HXH A;  3OVU A;  3AAI A;  4DND A;  3PUY F;  2H88 A;  2W2U A;  1HR0 T;  4ASK A;  2I59 A;  4YXD A;  4TWH A;  5LOV E;  2I6H A;  2FJD A;  4EED A;  1FJG T;  4KMC A;  4AQG A;  1IZN B;  4X64 T;  2PTF A;  3EHZ A;  3P4R A;  3QK6 A;  3SQ6 A;  1IBL T;  5JRC A;  1XDO A;  5HCM A;  5AFK A;  4YY3 T;  2V5C A;  3AA6 B;  5L3G B;  4CI1 B;  4L0R A;  1I9B A;  4ZK1 A;  4H9S E;  4ILA A;  4HEA A;  4IHJ E;  4IDN A;  2Q9Q B;  2XQ9 A;  4JEU B;  4DV1 T;  3AXJ B;  5LG3 A;  3UU4 A;  5LA6 E;  1G73 A;  3OTO T;  3ZST A;  5AQV B;  3WI3 A;  3N9O A;  2X51 A;  5FVK A;  4YHH T;  4UXU A;  3ANW A;  3WTJ A;  1W0B A;  5ABF B;  3C4W A;  3C79 A;  4GYR A;  2XZE A;  4LFC T;  3N9L A;  4ILU A;  4ISS A;  1YKE B;  1MIY A;  1WYB A;  1ZP0 A;  4GIW A;  5J0Z A;  1ZKE A;  4ZRU A;  4B3M T;  1OED A;  4AFT A;  3RRW A;  3UU8 A;  4IDO A;  2UZ6 A;  4C90 A;  4DMW A;  3FBL A;  3W15 B;  3EVY A;  5AQI B;  4ZOL E;  2JQ9 A;  1BR2 A;  4UVB B;  2WU2 A;  5JH7 E;  2CWY A;  5EK4 A;  3ZKR A;  2KXP B;  5BMV E;  4BAY B;  4WZX A;  2UXN B;  2UUB T;  1D1A A;  2XUE A;  1L0V A;  2XAH B;  4KHP T;  3OPC A;  2E9X A;  4NPP A;  4UV8 B;  3VHL A;  3PV0 F;  4QX7 B;  4G63 A;  5BR8 T;  4DV7 T;  5DAB A;  2WDR A;  1Y64 B;  5FNV E;  4DR5 T;  5KXJ A;  2BZB A;  2YDS A;  1LVK A;  3IF8 B;  2WWV A;  4TV8 E;  1T8B A;  3CKD A;  2WY2 A;  4ZI3 D;  3AEF A;  2XNU A;  4U33 A;  1MNE A;  1D0Y A;  2YK0 A;  2AE9 A;  4NXN T;  3AEE A;  5AQR B;  5JDG A;  1N36 T;  1O3X A;  2XQ8 A;  3RPU A;  2Y6X A;  2Y58 A;  3ZMV B;  4IRE A;  3EUH A;  2PGZ A;  5A1L A;  1H7C A;  5LBQ B;  3IHR A;  2ODV A;  2KWI B;  3ZLI A;  3AE1 A;  3P4W A;  3R6N A;  5HEJ A;  1KNP A;  2WWU A;  5AFL A;  3E22 E;  4NUU A;  1HS7 A;  5CB4 E;  4TUY E;  3AAA B;  2NP9 A;  4QKN A;  4O2A E;  4EZH A;  3QNU A;  2W63 A;  2Y56 A;  2BKN A;  1NWM X;  3TLS A;  2VK9 A;  4WW0 A;  2Y57 A;  5J5H A;  3RQU A;  2CA5 A;  5FY1 A;  5LGN B;  5L3B B;  4M1P A;  2NWB A;  5CA1 E;  2WQY A;  1YW0 A;  4JI0 T;  4A98 A;  3UU6 A;  2MAW A;  3QB5 A;  4QAC A;  4IIJ E;  4KX6 A;  3ZSS A;  4ANJ A;  5AQF B;  2W62 A;  5HAX A;  2BBJ A;  1SE7 A;  3ANW B;  4UM1 A;  3O1H A;  2VUR A;  2SPC A;  5LGU B;  2X9W A;  5M4Y A;  3HKE E;  4TN7 B;  4EYU A;  5C2T A;  2XQ6 A;  5FL1 A;  4DV0 T;  2XTL A;  3JC6 D;  4YJ3 E;  1HNZ T;  4B6X A;  5LHI B;  2X9X A;  2V8S V;  3K3Q C;  2V5D A;  4CXX A;  5LHG B;  4H63 H;  5ABG A;  3PUW F;  3N2G E;  1T72 A;  4DV4 T;  3L09 A;  5AFM B;  5LCY A;  1SHZ C;  1UCU A;  1Y01 A;  5CA0 E;  1S35 A;  3RHW A;  2V6X A;  2XQ4 A;  3I0O A;  2IAK A;  5KZU A;  3NZQ A;  4IE4 A;  2J62 A;  4K0U A;  2KT9 A;  4AKI A;  4X65 T;  2CM0 A;  2KND A;  3A5X A;  3N9Q A;  5JRE A;  2LKG A;  5HYA A;  4UM3 S;  4LF5 T;  3WTM A;  3PJA A;  1YD8 G;  2GK9 A;  4AQY T;  2IUB A;  3E0Z A;  5FP3 A;  4A97 A;  5JDL A;  3C51 A;  4NUV A;  3V5U A;  2DHR A;  3N5L A;  2LKH A;  2LSY A;  3HI2 A;  1W0A A;  5SYO A;  1BR1 A;  2ZMA A;  4F6R C;  2XYS A;  1LRZ A;  2JMK A;  5TAO A;  4COF A;  1XWM A;  2IIU A;  2LRK A;  1U5P A;  3CIR A;  3FXE B;  2V7M A;  4ILC A;  4U7Y A;  3NKZ A;  5JVD E;  3OJA A;  5KMG P;  1J5E T;  3CQC B;  3AVR A;  5TVC A;  3KV4 A;  2LOS A;  3RYI E;  2V7K A;  2AXD S;  4B3R T;  1M62 A;  4AXP A;  3N9N A;  3B13 A;  4DBQ A;  4X62 T;  3H3A A;  2VWA A;  5CGM A;  4HWF A;  1IAP A;  2H7V C;  1YKH B;  4O4L E;  3PDY A;  4UR9 A;  4EAH A;  2KSR A;  2X9H A;  2CLY C;  2WSS V;  4IE7 A;  3KFW X;  3FZF B;  3P4Q A;  4BA9 A;  1UUR A;  4NIQ A;  3U78 A;  3P4P A;  2XQ7 A;  1SA0 E;  1WFD A;  3QUJ A;  3C84 A;  3T4M A;  2L8K A;  2BYN A;  5L3D B;  4YHJ A;  3SIO A;  4QWN B;  1X79 A;  4JI4 T;  4DR7 T;  2MOZ A;  5HEU A;  4ZI7 E;  5ADX L;  2NW8 A;  2RPA A;  1N34 T;  3RF1 A;  3WTN A;  4U7I A;  1X9B A;  1ZEE A;  1Z8U A;  4UV9 B;  4DVD A;  3LSV A;  1HTJ F;  4HWH A;  3AE9 A;  2PG8 A;  3CX6 B;  3JAD A;  2XAJ B;  4JV5 T;  5LBM A;  1MND A;  3BQI A;  2UU9 T;  5FVL A;  4O2B E;  1KK7 A;  2CRB A;  4X1K E;  4CN1 A;  5FYM A;  5IYZ E;  4O8S A;  5HWX A;  4IE5 A;  4LF8 T;  4X1I E;  3SFD A;  3LK3 B;  4HWD A;  3UFE A;  4HQP A;  4H9R C;  2HN2 A;  5AQT B;  4CXY A;  3LBX B;  5FXV A;  1KNR A;  4MHC A;  3NVO A;  4CXW A;  2DNX A;  4PAG A;  3LJC A;  4N78 D;  4L5G A;  2V7I A;  5JDN A;  2NR4 A;  3RRC A;  5BP0 A;  1IBK T;  4JUY A;  3RC3 A;  4P1N A;  2A72 A;  5JQG E;  3EDV A;  4U3C A;  2WB5 A;  1HNX T;  1HF8 A;  3KVB A;  3UT5 E;  4QXH B;  4HE8 A;  1XNQ T;  4AFG A;  2UXX B;  2XZ6 A;  2A2F X;  4EXT A;  1WR0 A;  2LSI A;  3UU3 A;  4LF4 T;  2XSA A;  4MFR A;  3RYF E;  4CZZ B;  4JI8 T;  4ZJT A;  2Q9Q A;  3P7I A;  4HGA A;  2OLT A;  3RLF F;  3H37 A;  2YU2 A;  4XK9 A;  4QH1 A;  5LYJ E;  5DJQ C;  4ZHQ E;  1NAF A;  3O1J A;  2YOE A;  2H3R A;  2XYT A;  4BJN A;  1D0Z A;  4CI2 B;  3HL6 A;  2N2N A;  2XJ7 A;  1IJ6 A;  4DV2 T;  4PJJ A;  4PJM A;  5FL0 A;  4YTP A;  1QUU A;  2HH7 A;  4PJL A;  1UK5 A;  4PFP A;  3AE6 A;  4AI6 A;  1HFA A;  4H63 V;  2NTY A;  3PEO A;  4DV3 T;  1QLB A;  4X66 T;  2ZJV A;  2CCQ A;  3KBT A;  3JCF A;  4IDP A;  1OWA A;  3P4S A;  2BG9 E;  3ABV A;  5AQG B;  1MMD A;  4EIW A;  4ERR A;  4ILB A;  1IBM T;  1YQ4 A;  2IML A;  3A8Y C;  4BQT A;  5DQV A;  4V1A v;  5HXR A;  5L3F B;  3ZN0 B;  1KF6 A;  2XPK A;  2FJB A;  3WIP A;  4AIU A;  3VKH A;  4CN6 A;  4I43 B;  3E08 A;  4UVC B;  3ZN1 B;  4WNK A;  3GMI A;  2QGS A;  3Q5E A;  2CBJ A;  1I94 T;  2LM9 A;  2XNV A;  4CQI A;  2JRK A;  3ZT6 A;  3EI0 A;  4HFB A;  5BW2 A;  2WBL A;  3UUL A;  2CLY B;  3PUX F;  3EAM A;  5FY7 A;  4H9N C;  4HWI B;  5AIN A;  2CXL A;  3GN5 B;  5AFJ A;  4X5T A;  5LP6 E;  3FZH B;  3C4X A;  5GON E;  3O1I A;  3UU5 A;  4O4H E;  5ABF A;  2PFV A;  4CI3 B;  2BS4 A;  4FI5 A;  3KV9 A;  2QRX A;  2G0U A;  1LKX A;  3L3P A;  3F2E A;  4AKL A;  2X0L B;  3HKB E;  4UEM A;  1HX8 A;  4E7Z A;  2D0U A;  2NW9 A;  2KWH A;  4GKJ T;  2BR7 A;  3SS1 A;  4UXN B;  2DI4 A;  3B5M A;  5F8P A;  1D1B A;  5FXX A;  4BJM A;  1CHU A;  3OYX A;  2JMH A;  2WM9 A;  5JDQ A;  4AFH A;  2YEV C;  4OX9 T;  4LFB T;  5AQH B;  2HPL A;  1UX4 A;  2BDE A;  4KUM B;  3LFM A;  3ZJ1 A;  5CFB A;  1J1J A;  2XM2 A;  4DBM A;  2ACX A;  2XM1 A;  2XNT A;  2YDR A;  4Z90 A;  2Y8D A;  5FJV A;  5AQJ B;  5LJN A;  2BYP A;  3ETU A;  4IL9 A;  2W4X A;  3AE3 A;  1QSD A;  3T1Y T;  2W61 A;  3C4Z A;  2BKP A;  2JIW A;  4QH4 A;  2J1D G;  3KVA A;  3IBP A;  5AQU B;  3V5S A;  3LDQ B;  4FJO A;  3A7M A;  3SH1 A;  2B1E A;  3C50 A;  4DR6 T;  4JI7 T;  5H6Q B;  3TKL B;  4QXB B;  4UM3 A;  3F31 A;  4I0U A;  4GK0 E;  4AKH A;  1FMV A;  4WBO A;  2UUC T;  1N33 T;  4B3T T;  2WNC A;  2X0Y A;  3EAB A;  2BJ0 A;  2XQY A;  3ZEF B;  2XZ5 A;  3PU8 A;  3RI5 A;  2BS3 A;  2C9T A;  2E9X B;  1G8X A;  1MMG A;  5AFM A;  4JBW F;  3CVR A;  3UQ4 A;  3WTH A;  3ZC0 A;  1JNR A;  2BS2 A;  3ZMZ B;  4DBR A;  1T7S A;  3CWZ B;  2XQ3 A;  5HEG A;  1E7P A;  1YQ3 A;  2IC9 A;  3AVS A;  1OXZ A;  3UUB A;  3ONJ A;  3HKD E;  3MK7 C;  3U8L A;  4LMJ A;  1KNZ A;  1N32 T;  5JME A;  4GYS A;  3CX8 B;  3TLT A;  2NW7 A;  3ZYM A;  3I1A A;  4J2C A;  5AFU L;  2WAU A;  2DWG A;  2VVS A;  1UUS A;  1XMO T;  5HEH A;  4FRR A;  1UGO A;  4JEH B;  4IDQ A;  5J2U E;  3MZK B;  5JR9 C;  3KDS E;  3RYH E;  5LMN T;  2IW5 B;  3ZYK A;  5FXZ A;  3H3M A;  3TLW A;  3Q5D A;  3PUS A;  4L9I A;  4WBN E;  5LNK A;  4KHZ F;  3T8O A;  3FZL B;  2WZH A;  4U72 A;  4YTN A;  2B76 A;  4WYV A;  3U8J A;  2WS3 A;  5LXB A;  2YKS A;  2WZY A;  3EDU A;  1BR0 A;  3Q9D A;  4ZI3 C;  4KP3 C;  2LSK A;  5JDH A;  2N1G A;  2HPJ A;  3AEA A;  3AEG A;  2ZM2 A;  4OFZ A;  1HX1 B;  4PFO A;  4DUZ T;  5KE4 A;  4IT4 A;  4JI3 T;  2VQF T;  4PIR A;  5J5I A;  5ABE A;  4D01 A;  1SUM B;  2DCF A;  1E1H B;  4LMK A;  5CO5 A;  3J7Y q;  3CX7 B;  5E0O A;  3X1D A;  3ONL C;  1NEN A;  1WR6 A;  2V1D B;  2HHH T;  4ZS3 A;  3HR0 A;  5LHH B;  2WNJ A;  5HWY A;  4YSY A;  1WCR A;  3ONX A;  4JI6 T;  2LEH A;  4UM3 P;  4XBF B;  4B5D A;  4YT0 A;  3Q2M A;  2H89 A;  2C5K T;  2WNL A;  4AKG A;  3J9X 1;  2LRL A;  2CXF A;  2XAF B;  4LF9 T;  4HFD A;  4DV5 T;  2D0T A;  4EOZ B;  2Y54 A;  2X66 A;  2A3D A;  2X00 A;  4DR2 T;  4I50 E;  2WDQ A;  3FBZ A;  3CQX C;  1W9R A;  1KEY A;  3PMZ A;  4Z8X A;  1M7K A;  5FXW A;  3BQK A;  3WAK A;  4QXC B;  2PBI A;  3PTR B;  2XQ5 A;  4AQF A;  2V7J A;  3VR9 A;  3SQ9 A;  4JI5 T;  2PH9 A;  3GWH A;  2UXB T;  3VRB A;  5HCJ A;  2K48 A;  3ESL A;  2K5B B;  4JYA T;  3JAE A;  2W67 A;  5HEO A;  2FJE A;  2XSB A;  4ZXL A;  2RP4 A;  3RC8 A;  3ZPO A;  2LJL A;  3ZT5 A;  4HFC A;  2OV9 A;  3VR8 A;  3ZDH A;  2XQA A;  2ES0 A;  2DWK A;  3RQW A;  3AA1 B;  3PUQ A;  3PUZ F;  3RIU C;  5BRX A;  2WCA A;  3BK9 A;  3LK4 2;  2XAG B;  3B57 A;  4X20 E;  2K24 A;  2P9B A;  1U4Q A;  3O4X E;  5IUX A;  4AIS A;  4EZ1 A;  4I55 E;  2M67 A;  4C91 A;  2LE8 A;  2X0H A;  2X67 A;  2E8I A;  2IC6 A;  3OBV E;  3SFE A;  2MYS A;  3PE0 A;  2CBI A;  3HA4 A;  1MMN A;  4ZI2 D;  3WTL A;  3CPZ A;  1UW6 A;  4OYJ A;  2J47 A;  4DUY T;  1IJ5 A;  3NBX X;  1V9D A;  2BR8 A;  2CHO A;  3UUX B;  4OK0 A;  1OED E;  4DMV A;  1OED B;  2A9U A;  2PJQ A;  5J1G A;  1GQE A;  2E9X D;  3PJA J;  4ZS2 A;  4YSZ A;  2ZM0 A;  4B3S T;  2LHR A;  3AEB A;  4QX8 B;  5KDM C;  1FIO A;  4YFS A;  4PNI A;  4A56 A;  2JQQ A;  4MBQ A;  1E2A A;  4K0K T;  2QVA A;  2XY8 B;  2VKO A;  2BBH A;  1HG2 A;  1JNZ A;  2L9Q A;  2QYW A;  3KV5 A;  3GUA A;  4BFQ A;  3WTO A;  1WLX A;  3DJB A;  3DP7 A;  4EB6 E;  4GK5 E;  3FB2 A;  3R84 B;  3NWI A;  4YLH A;  2VKJ A;  4ZI2 C;  3TLU A;  5AQQ B;  2QC1 B;  2QA7 A;  2JPF A;  3ZJ2 A;  1MIW A;  2BG9 C;  4IDZ A;  4Z91 A;  2XAS B;  5FMN A;  2LSG A;  2DLR A;  5LXT E;  3VRA A;  2V26 A;  5JDF A;  4PK4 A;  2LLY A;  5EK3 A;  5L4E A;  2D2S A;  4TWD A;  4H9Q C;  4TX5 A;  4ZZB A;  2IDO B;  3ZC1 A;  3NRY A;  4UVA B;  4QAB A;  2UUA T;  4PK6 A;  3RIA A;  4ALX A;  2OA5 A;  3QB5 K;  4U74 A;  2BKO A;  2YU1 A;  4MLK A;  4UF0 B;  1BR4 A;  2ZLY A;  5LGT B;  4OHF A;  3AXJ A;  5HXE A;  3ZMT B;  2BG9 A;  1MMA A;  2VQE T;  3PUA A;  4X1Y E;  2CWO A;  2RA1 A;  3PU3 A;  5EZY E;  4NZB A;  3M3Z B;  3RGL A;  1ZHC A;  4DR4 T;  2VVN A;  4QHO A;  3U8M A;  4HFV A;  1US7 B;  5LG4 A;  2KLQ A;  1WRD A;  3AE5 A;  2YME A;  3RIU A;  1YXR A;  4ZK4 A;  4U31 A;  2MTQ A;  2BVM A;  3OYZ A;  2CE7 A;  2M6I A;  4GKK T;  2K3W A;  2MBG A;  3WTI A;  3ZDG A;  2NOX A;  1W09 A;  4HKA A;  2ACZ A;  2XAQ B;  3K1S A;  4F8H A;  1I6Z A;  1EZ3 A;  3BQL A;  4YJ2 E;  3TLV A;  4XHE A;  4EYY R;  5FY0 A;  2MPK A;  2X68 A;  4LFA T;  3U8N A;  1HG5 A;  3UQ7 A;  2H7O A;  3MA9 A;  2V7L A;  4XZC A;  2F4V T;  2WMO A;  4PK5 A;  2UXC T;  2X00 D;  4H9P C;  3U8K A;  3AAE B;  2VAS A;  2IHR 1;  1ZV4 X;  4U2Z A;  2VL0 A;  3GA8 A;  2ZJU A;  5F5W A;  3Q5X A;  4EV6 A;  3PUG A;  3MXZ A;  3CQG B;  3K3O A;  3AE7 A;  3VKG A;  4CN4 A;  1HNW T;  5AQL B;  2WP9 A;  5JR9 A;  2LOP A;  3M65 A;  1HCI A;  1XNR T;  3MKD A;  4ADZ A;  2FBW A;  2KZ7 B;  4QAA A;  2V6Y A;  4A5X A;  4JLE A;  2E2A A;  3AB3 B;  3KV6 A;  4H9O C;  4EEB A;  2C5J A;  5AQK B;  4IE0 A;  2CPT A;  3JC6 C;  4LML A;  4EGW A;  3IGQ A;  2FUP A;  3FZK B;  4LF6 T;  2EHO D;  4Q25 A;  1XDP A;  2LM2 A;  1B7T A;  5AQO B;  1VOM A;  3FXD B;  2VKD A;  3FHN A;  2XHE B;  3AE4 A;  3P50 A;  3O9X A;  3IEE A;  3ZMS B;  3ZCJ A;  2Z6E A;  3Q5W A;  2K9A A;  3PUR A;  2EHO C;  2UXD T;  1OED C;  5C3J A;  4U2Y A;  2WU5 A;  4O4J E;  3UTK A;  2LHN A;  2Y48 B;  5H6R B;  2LSJ A;  1FEW A;  5HXS A;  1R8I A;  5AFH A;  4QH5 A;  1J5W A;  2VKH A;  4JI2 T;  2CXD A;  5HXC A;  4O4I E;  5JDM A;  3RKG A;  3AEC A;  2JQK A;  3GN5 A;  3MJX A;  1AJ3 A;  2ODU A;  4OYK A;  1UV6 A;  4UF0 A;  5EK2 A;  2YIN A;  3AA0 B;  4XAX B;  4GOU A;  2BYS A;  4P0B A;  3LK2 B;  4TNV A;  2CEA A;  4TWF A;  2WZI A;  5IHY A;  2E9X C;  3AE2 A;  3SOL A;  3K8P C;  2D9D A;  3L8R A;  5JRC B;  2W0G A;  2JQH A;  4TV9 E;  5AQS B;  3I9W A;  3N9M A;  1DU2 A;  3ZT7 A;  3WTK A;  4E7S A;  3N2K E;  5AQM B;  4IST A;  3LBX A;  4AQF C;  5CJ5 A;  3G06 A;  3ZYL A;  5FKY A;  3KIN B;  3AE8 A;  5F3J A;  1S94 A;  4G2A A;  4HFE A;  4TZ4 C;  2KIN B;  3UUN A;  2C0S A;  2WDV A;  3CML A;  1Z0P A;  1XZY A;  3RKO A;  2W8G A;  1UX5 A;  3ZCI A;  4ZEY A;  4IGU A;  5DQW A;  2HN1 A;  3SRZ A;  2KMF A;  3AED A;  2E5L T;  3PUV F;  1VCS A;  4AKR B;  2E5V A;  4YSX A;  3NZP A;  3MAC A;  4HTE A;  2W8F A;  5ETW A;  3SWH A;  2YN6 A;  4KBM B;  2FJA A;  2X9Y A;  2LT3 A;  1D1C A;  2VB6 A;  3ETV A;  5C8Y E;  5J2T E;  3P8C D;  2ZM6 T;  3T1H T;  2D5U A;  2CMR A;  5KX5 E;  2W66 A;  1CUN A;  5AFN A;  1MIV A;  2J4G A;  2V6Y B;  2JJ9 A;  4I4T E;  1KFY A;  4UY2 A;  4NXM T;  4PJN A;  5JTG A;  4IL4 A;  4ZR6 A;  5J5G A;  3OKQ A;  3IA3 A;  4EZ4 A;  2DL1 A;  3I0Q A;  4JI1 T;  2I0M A;  4UEL A;  1LVF A;  3LG7 A;  2EHO A;  4PW8 A;  1UX2 A;  2BG9 B;  5L2L A;  3K3N A;  5L3E B;  3AA7 B;  4HN9 A;  3RYC E;  4ZZC A;  2N9D A;  2WN9 A;  1T98 A;  5LMU T;  5L47 A;  4DV6 T;  3I9Y A;  2NTX A;  4WV9 A;  4KI0 F;  4ZJS A;  4TNW A;  5JR9 B;  5ABH A;  2L3L A;  4DR3 T;  3U3I A;  1VRB A;  3ZMU B;  2WMN A;  3RX6 A;  2R6G F;  3HKC E;  4YTM A;  4P0A A;  2ZM8 A;  3C98 B;  5J5F A;  2Q9Q D;  2Y7Y A;  5AQP B;  2CHN A;  2YDQ A;  3D0T A;  3WAJ A;  2M6B A;  4DID B;  4HFH A;  1D0X A;  4P09 A;  3UFG A;  5LJM A;  3DTO A;  5L4H A;  2BYQ A;  4MAL A;  3CK6 A;  1ZOY A;  2EHO B;  3UUM A;  3L39 A;  1FMW A;  3RH3 A;  1NEK A;  1WYC A;  3F57 A;  3S4U A;  4LF7 T;  5L3C B;  3VU7 H;  4HWC A;  3FZM B;  2VL8 A;  2Q9Q C;  3RIF A;  4UIG A;  3C64 A;  5LB7 B;  4DO0 A;  2BYR A;  3QC9 A;  4HFI A;  4DR1 T;  3QOF A;  4IE6 A;  2W00 A;  2C5I T; 
#chains in the Genus database with same CATH homology
 4HFC A;  5KE4 A;  2C9T A;  2PGZ A;  4PIR A;  5AFM A;  5J5I A;  3ZDH A;  2M6I A;  2YMD A;  3WTK A;  2XQA A;  5J0Z A;  3TLU A;  4LML A;  2ZJV A;  4ZRU A;  1OED A;  3IGQ A;  3UQ4 A;  4D01 A;  3WTI A;  3RQW A;  4LMK A;  5BP0 A;  3JAF A;  3WTH A;  5CO5 A;  3ZDG A;  5AFM B;  3UU8 A;  2BG9 E;  5BRX A;  2BR7 A;  3P4W A;  5HEJ A;  2QC1 B;  1UX2 A;  4ILB A;  4F8H A;  2UZ6 A;  2BG9 B;  2LM2 A;  5AFL A;  2XQ3 A;  3RHW A;  5IUX A;  2WNJ A;  2BG9 C;  5HEG A;  4EZ1 A;  4BQT A;  4HFE A;  2XQ4 A;  4ZZC A;  2KSR A;  5KZU A;  3P50 A;  3UUB A;  3TLV A;  4XHE A;  2WN9 A;  4UM3 P;  4Z91 A;  3U8L A;  4AFH A;  4TWH A;  4B5D A;  4LMJ A;  3WIP A;  5L47 A;  4AFG A;  2XZ6 A;  5JME A;  3WTL A;  3TLT A;  2XQ7 A;  4WV9 A;  3U8N A;  2LKG A;  3EHZ A;  2WNL A;  2W8G A;  3UU3 A;  3ZKR A;  2LLY A;  4UM3 S;  3SQ6 A;  3UQ7 A;  5L4E A;  4ZJS A;  4TNW A;  1UW6 A;  5CFB A;  3WTM A;  4TWD A;  1OED C;  3C84 A;  3T4M A;  4ZZB A;  2BYN A;  2XNV A;  2Y56 A;  5HCM A;  4DBM A;  5AFK A;  3SIO A;  4HFD A;  3TLS A;  2Y54 A;  5HEH A;  2BR8 A;  4NPP A;  1I9B A;  2XNT A;  4FRR A;  4ZJT A;  5J5F A;  4Z90 A;  4QAB A;  5FJV A;  4ZK1 A;  2Y7Y A;  2BYP A;  1OED E;  5HEU A;  2Y57 A;  5J5H A;  1OED B;  3EI0 A;  4ILA A;  4IL9 A;  4HFB A;  3RIA A;  3RQU A;  2X00 D;  2X00 A;  3U8K A;  4ALX A;  5AFH A;  4QH5 A;  5BW2 A;  4A97 A;  2M6B A;  2XQ9 A;  3WTN A;  4HFH A;  2LKH A;  3PMZ A;  4XK9 A;  2VL0 A;  3TLW A;  4QH4 A;  4QH1 A;  3EAM A;  5L4H A;  2ZJU A;  2BYQ A;  3LSV A;  2W8F A;  4A98 A;  5LG3 A;  5SYO A;  5AIN A;  5AFJ A;  4X5T A;  3UU6 A;  2YOE A;  2XYT A;  3JAD A;  2YN6 A;  3UU4 A;  2MAW A;  4QAC A;  2XYS A;  3SH1 A;  3UU5 A;  2BG9 A;  1UV6 A;  2XNU A;  3U8J A;  4AFT A;  2XQ5 A;  5LXB A;  4COF A;  2YKS A;  2WZY A;  3SQ9 A;  2BYS A;  4UM1 A;  4NZB A;  4TNV A;  4UM3 A;  2PH9 A;  4UXU A;  4ILC A;  3U8M A;  4TWF A;  3WTJ A;  3GUA A;  5AFN A;  3RIF A;  2XQ6 A;  4HQP A;  3WTO A;  5HCJ A;  2WNC A;  4BFQ A;  2BJ0 A;  2YME A;  3C79 A;  2BYR A;  2XQ8 A;  3JAE A;  5HEO A;  4HFI A;  2XZ5 A;  4UY2 A;  5TVC A;  4ZK4 A;  2Y58 A;  4QAA A;  4ZR6 A;  4IL4 A;  5J5G A;  3RI5 A;  3PEO A;  4IRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...