3LSVA

Structure of the a237f mutant of the pentameric ligand gated ion channel from gloeobacter violaceus
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ligand-gated ion channel
publication title One-microsecond molecular dynamics simulation of channel gating in a nicotinic receptor homologue.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 99
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3lsvA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3lsvA01
4UXUA 3PMZA 3WTNA 2LKHA 4Z91A 4ZK1A 4HFHA 4AFHA 2XQ9A 2BG9C 2X00A 4ZR6A 4TWFA 2XNUA 4ZJSA 3SIOA 1OEDE 5IUXA 4QH5A 3UQ7A 2YOEA 2M6BA 2YMDA 4EZ1A 4IL9A 4ILBA 3SQ9A 5AFNA 4B5DA 3JAEA 2YKSA 3RHWA 5L4EA 2BYSA 4UM3P 3U8LA 2XQ8A 5J5FA 2KSRA 2LLYA 2QC1B 2XNVA 4Z90A 4ZJTA 4ILAA 3SH1A 1UX2A 3UU4A 5HCMA 3U8KA 2W8GA 5TVCA 3LSVA 4WV9A 1OEDC 2M6IA 5AFLA 5HEJA 4ZRUA 5BW2A 3UUBA 4COFA 2PGZA 4ZZBA 2XQ5A 4X5TA 3RQWA 3WTJA 5AINA 3TLTA 2XQ3A 5L4HA 4NZBA 3UU6A 4TNVA 2X00D 1OEDA 5KE4A 2WN9A 3JADA 5J0ZA 4UM3S 2WNLA 2Y54A 3UU3A 2YN6A 3RIAA 2XYSA 4PIRA 5AFMA 4IL4A 2XQ4A 2BG9A 4LMLA 3ZKRA 4HQPA 3TLSA 5FJVA 4QACA 4DBMA 3JAFA 4TWDA 4HFCA 3C79A 3TLVA 2XQAA 5J5GA 2XQ7A 3P50A 5L47A 2XNTA 2W8FA 4QH1A 2Y58A 4ZZCA 3P4WA 2XYTA 5CO5A 1UV6A 3WTLA 2Y57A 2BR7A 4A97A 5J5HA 3EAMA 3U8MA 2Y56A 3UU5A 2ZJVA 2BG9B 4AFGA 2BYQA 2XQ6A 2WNJA 3WTIA 5KZUA 4TNWA 4IREA 3UQ4A 4TWHA 3GUAA 2YMEA 3ZDGA 5AFHA 4ILCA 5LXBA 2MAWA 3RQUA 2UZ6A 5HEHA 2BJ0A 5CFBA 4XK9A 4AFTA 4QH4A 4HFDA 5AFJA 3UU8A 5BRXA 3WTKA 4XHEA 3RI5A 4UY2A 4QABA 3T4MA 3EI0A 3TLUA 2WNCA 2BYRA 5HEUA 3WIPA 4QAAA 2WZYA 2BYPA 4FRRA 4ALXA 5LG3A 4F8HA 4NPPA 5AFKA 2VL0A 1OEDB 5JMEA 5SYOA 1UW6A 4D01A 3U8NA 3ZDHA 4UM1A 4ZK4A 3SQ6A 2XZ5A 2PH9A 5AFMB 3C84A 3RIFA 3WTMA 4HFIA 5HCJA 2BG9E 5J5IA 3U8JA 3IGQA 2ZJUA 2C9TA 4LMKA 5HEOA 3TLWA 4HFEA 4HFBA 2LM2A 4BFQA 5BP0A 2BYNA 5HEGA 2Y7YA 3PEOA 4BQTA 3WTOA 4LMJA 4A98A 2LKGA 2XZ6A 2BR8A 4UM3A 3WTHA 1I9BA 3EHZA
chains in the Genus database with same CATH superfamily
4UV8B 3SS1A 2CXFA 2XQ9A 1B7TA 5KX5E 4IE5A 2BS4A 5LGNB 2YOEA 3TKLB 4GIWA 3EUHA 3KBTA 4CXWA 5L4EA 2IMLA 4HE8A 4HEAA 1EZ3A 4H9OC 3K8PC 3ONLC 3PUGA 3SH1A 2E5VA 1UX2A 3ZMTB 2CBIA 1M62A 3PU3A 3B5MA 5CA0E 4B3RT 1S35A 5FXVA 3ABVA 3GWHA 3O1HA 5HXEA 2ES0A 5L4HA 1JNRA 3ZMSB 4JI8T 2C0SA 2XYSA 3CVRA 3N9MA 4H63H 3VKHA 4MHCA 4DBMA 2BVMA 4B3TT 5DABA 2LE8A 3RRWA 3MZKB 5J5GA 2XHEB 2H3RA 2K24A 4ZZCA 2QYWA 2CHOA 4HWIB 1HR0T 4JI0T 4AQGA 3AE9A 1MIYA 2D2SA 3QK6A 2CLYC 2HH7A 2VL8A 3ANWB 1WLXA 2UZ6A 4JI4T 3PV0F 5HEUA 3RH3A 3J9X1 2I59A 5LBMA 5LCYA 3AA0B 3SQ6A 2BS3A 5F3JA 3AVSA 5AQQB 3WTMA 2KLQA 3T8OA 3KFWX 4IT4A 3M3ZB 4H9PC 1MMNA 3MACA 4QX8B 2XASB 3PMZA 4OFZA 4JI2T 3NKZA 3PE0A 3CWZB 2YU1A 2XQ8A 4HWDA 4U2ZA 3PUWF 2CLYB 2LLYA 4ZJTA 5LHHB 5ABEA 1N36T 1WR0A 3FB2A 2C5IT 5FY1A 3ZCIA 3PUAA 4LF5T 4CZZB 1IJ6A 3R84B 1W0BA 3ZC1A 2XZEA 4XZCA 2WP9A 1KFYA 2KWHA 4GYRA 1I94T 2ZLYA 4JEHB 1UUSA 3N9PA 3AAEB 4EOZB 1US7B 5AQTB 2NW8A 4EEBA 2Y57A 5J5HA 3H37A 4E7ZA 3RGLA 4B3MT 3A7MA 5LJNA 3RI5A 5JREA 2E9XA 3N9QA 2V5DA 5E0OA 3V5UA 2YINA 1UCUA 5L3FB 2Q9QA 3O4XE 3RC3A 5J1GA 2XJ7A 3LJCA 4ERRA 4UM3A 5C2TA 2BR8A 3P7IA 2L3LA 4CQIA 4UXUA 3ZMUB 4TN7B 2H89A 4TWFA 3FXDB 4HKAA 3PUZF 3NRYA 1AJ3A 4XAXB 2QA7A 3A8YC 2LJLA 4B3ST 5KXJA 2IIUA 2N9DA 4ILAA 1M7KA 3UU4A 3FXEB 3LSVA 1E1HB 4U7YA 5AQLB 2M6IA 4ANJA 2JQ9A 5DJQC 4KHZF 4WZXA 2CCQA 3L09A 4O4LE 5LA6E 3WTJA 1Y01A 3DP7A 4PJJA 5J0ZA 2W63A 5AQVB 3RPUA 3UTKA 4KP3C 3AE4A 4AXPA 1KF6A 3SFEA 3TLSA 4HWHA 3AB3B 3ZN1B 3IEEA 5F8PA 1UV6A 5JDQA 4X62T 3WTLA 3VU7H 2CXDA 4EIWA 1D1AA 2CA5A 2UUBT 4ZHQE 3CK6A 4OHFA 2X9YA 4A5XA 4TNWA 5L3EB 4CN4A 2E9XC 4AFTA 5LOVE 4L5GA 3ZMZB 4YTPA 2BYRA 2PBIA 2UU9T 5HXSA 2NP9A 5FYMA 5SYOA 4Z8XA 3U8NA 5FKYA 1XZYA 2XZ5A 1L0VA 4EZ4A 2V6YA 2JJ9A 2XY8B 3U8JA 1W9RA 2VKDA 5BP0A 2V5CA 3Q5DA 3WTHA 1NENA 3ZT6A 2V7MA 4IDNA 4HFHA 3RYIE 2BG9C 1LVKA 5JR9C 3SIOA 3QNUA 2M6BA 2XTLA 4B5DA 3ZT7A 2BKNA 3T1YT 1WRDA 3RLFF 4TV8E 3QUJA 2DLRA 1YKHB 4JYAT 1XMOT 2E9XB 3U78A 5AFLA 1V9DA 4ZZBA 2Q9QB 4PFOA 2WU2A 2EHOA 4QX7B 2AXDS 3KBUA 4HQPA 4FJOA 3RIUC 4ZS3A 2CWOA 2CWYA 2XUEA 3A5XA 4QWNB 2Y58A 2HHHT 5JDLA 4KHPT 5FY7A 2CBJA 3AVRA 2XM1A 4PW8A 1UGOA 2ZJVA 4I4TE 2BG9B 3AEDA 3OKQA 3FZHB 5JR9B 1YKEB 2W61A 2FJDA 4ILCA 2EHOD 5HEHA 5AQUB 4O4JE 5AFJA 1FJGT 3FZLB 3SFDA 1MIWA 4CI1B 2LHRA 2V7IA 3AE2A 2MPKA 3ZDHA 3DJBA 3AE8A 2QRXA 2KWIB 2XAFB 3RIFA 5LMNT 4CI2B 1SA0E 3IGQA 1X9BA 2WWUA 2CE7A 3AEEA 2LOSA 1HNXT 3KV6A 4NUVA 2V7JA 2UXNB 1FEWA 2DNXA 4UF0A 4QH5A 4J2CA 4WYVA 2FJEA 4BJMA 2A2FX 4YT0A 3AE3A 4I0UA 4NUUA 1UURA 4WV9A 5FP3A 2EHOC 4NIQA 4NXMT 4JI3T 4DBRA 4X5TA 5IWAT 2NTYA 2V6YB 3N9LA 5ABHA 5LB7B 3NBXX 4JV5T 2LM9A 3Q5WA 4QHOA 2WM9A 4YJ3E 4DR3T 4L0RA 3R6NA 4HN9A 3NWIA 4PNIA 3HKDE 2I6HA 3X1DA 2BR7A 3HA4A 3MKDA 1U5PA 4L9IA 1KNZA 2CHNA 4AKRB 1WYBA 2VASA 3PUXF 3C98B 4KBMB 1YD8G 2WBLA 2BJ0A 3WAKA 3PUSA 3FZMB 3EI0A 1HTJF 2WZYA 3KV4A 2V6XA 4NPPA 2DCFA 4E7SA 5HYAA 2EHOB 2XAJB 2JMHA 3C84A 5AQOB 2W2UA 4KX6A 4PK6A 2DL1A 5BMVE 5HXRA 2OLTA 1J1JA 3AE6A 2YU2A 4AKIA 2IUBA 3EHZA 3FBZA 3P4SA 3VHLA 3ONXA 4DV5T 3HKEE 4I50E 3O9XA 4DR1T 2MYSA 4PJLA 3UQ7A 4ILBA 3SQ9A 4UM3P 3HR0A 2FJAA 4HTEA 2ODVA 5JDNA 5LGUB 4HWFA 5HEJA 3B13A 4UV9B 2PFVA 5JTGA 4H9NC 2K5BB 3T1HT 5LYJE 4TUYE 1HF8A 1CHUA 4YLHA 1HFAA 2BKOA 3UU3A 2YN6A 4IE6A 2D0TA 1UX5A 1LVFA 5FY0A 2XQ7A 3AAIA 4UF0B 3ONJA 2XQYA 2W0GA 5CJ5A 3UT5E 4YSXA 1SUMB 1FMVA 4O8SA 2LSIA 1ZP0A 3UUMA 2XQ6A 1N33T 3ZSSA 1ZKEA 1KK7A 3OTOT 5KZUA 3CQXC 2OA5A 4IIJE 4UY2A 1IAPA 3WIPA 3KVBA 1D0YA 4D01A 3ZN0B 4U33A 2IAKA 2AE9A 1XNQT 2ZM6T 3OBVE 3IA3A 1BR0A 4IE4A 3EDUA 3ETUA 3MA9A 3OPCA 5H6RB 3N2GE 1HX1B 4Z91A 2MOZA 3C50A 5FL1A 4GYSA 3RHWA 2XAHB 5LJMA 2NOXA 3B57A 5J5FA 1T7SA 3AXJA 3I1AA 3RF1A 5JH7E 2HPLA 3H3MA 3AA7B 2PTFA 3N2KE 4X20E 5LMUT 2WDRA 3UUBA 2UUCT 4O4IE 2XQ5A 2IC6A 5FXZA 2F4VT 5KE4A 1X79A 2VVSA 4LF7T 3AAAB 4YHHT 4DR5T 3RRCA 1SHZC 3Q2MA 1BR4A 2BBJA 4YTMA 1KNRA 2PJQA 4ISSA 5L2LA 2C5KT 2WNJA 4M1PA 4QXHB 3CPZA 4TWHA 2H88A 3ZDGA 4EYYR 3C4WA 2XM2A 2I0MA 2ODUA 3I9YA 1W09A 1NEKA 5LG3A 3ZLIA 5AFKA 5LXTE 2V7KA 4LFBT 3J7Yq 3CQGB 4H9RC 4HFIA 2BG9E 3PDYA 4IDPA 3IBPA 1Y64B 2L9QA 2LSJA 5KMGP 2UXDT 2X0HA 3HL6A 4Q25A 4AKLA 4ZJSA 4P0AA 3NZPA 1FIOA 3QB5K 2IW5B 2WMOA 3K1SA 3O1IA 2Z6EA 4YJ2E 2PGZA 4NZBA 1T98A 3PUQA 1YXRA 4GKKT 3N5LA 5JDMA 4UM3S 1YQ4A 4EZHA 3RIAA 3G06A 2H7OA 4IDOA 2HN2A 2BG9A 5JR9A 2W4XA 2XQAA 4U74A 3I0QA 4IDZA 3C51A 5IYZE 1WFDA 3CX8B 2IDOB 4A97A 2BKPA 3AXJB 3UU5A 4U3CA 4IREA 2KINB 3C64A 3F57A 4LFCT 3RQUA 3MK7C 5CFBA 5BRXA 4HFDA 3AE5A 1IBKT 3T4MA 2E5LT 2BYPA 4FRRA 2VKHA 3I9WA 2CXLA 4ISTA 3RIUA 3GA8A 5LBQB 3KV9A 5TAOA 3SWHA 2LM2A 4NXNT 2YDQA 4DR4T 5HEGA 2W62A 3WAJA 2YDRA 2C5JA 4JLEA 2CEAA 3UFGA 1N34T 3WTNA 2LKHA 2KT9A 2Y6XA 4K0UA 2FUPA 3HKCE 4ZXLA 5C3JA 4P0BA 3LBXB 5HXCA 4ZI3D 2YK0A 1WR6A 4IL9A 3UFEA 3C4ZA 2M67A 4I43B 1MMGA 4JI6T 3M65A 5AQKB 2QC1B 2XNVA 3GN5A 4MALA 3JCFA 5JDHA 4ZRUA 3FZKB 1GQEA 3EABA 2XQ3A 3KV5A 4KMCA 3GMIA 4O2BE 3LG7A 2HN1A 3AEGA 2WS3A 3ZKRA 4CN6A 3JAFA 3C79A 4OK0A 2WQYA 1T8BA 2XYTA 3P4PA 2NW7A 3L39A 1DU2A 3E22E 4IHJE 2DI4A 4CXYA 4WW0A 5LG4A 3VKGA 5AQJB 3CIRA 3UQ4A 3GUAA 5LXBA 1SE7A 4XHEA 1D0ZA 2BVLA 1IBMT 4JEUB 4P09A 3P8CD 5LHIB 2H7VC 4DV1T 2NTXA 2VQET 2IHR1 2CRBA 2C9TA 4UXNB 1NWMX 4LMKA 4HFEA 3NRXA 4H9QC 4X1IE 3FBLA 1I9BA 3UUXB 5JDGA 2X00A 2WY2A 1OWAA 4DV6T 2E2AA 5AFNA 5ABGA 1QLBA 4JBWF 2KSRA 5HAXA 4C90A 4PFPA 4LF9T 5L3CB 4O2AE 2CPTA 1WYCA 4ASKA 3RC8A 4AIUA 4UEMA 5ABFA 5CGMA 4PAGA 1J5ET 4LF6T 4PJMA 1HG5A 3JC6D 5ETWA 2X00D 1OEDA 3AA6B 2V1DB 2WAUA 5FXWA 4LMLA 2N1GA 4JI5T 1VCTA 5AQPB 2ACZA 1IBLT 4UELA 1HCIA 5CO5A 4G2AA 3Q5XA 3EAMA 1VOMA 2HPJA 2KXPB 4BJNA 3GN5B 4AQYT 3QOFA 2DWGA 4N78D 1IZNB 4X1YE 3PU8A 3I0OA 5AQSB 2YDSA 2UXBT 4ADZA 4DV2T 2D5UA 4UM1A 4EEDA 1OXZA 3ZMVB 3OVUA 3UUNA 4HFBA 2VB6A 4JI1T 2W67A 3ZJ2A 3LDQB 3CQCB 4UVBB 3NVOA 4EZ1A 4U7IA 3FHNA 3Q5EA 4ZI7E 4PJNA 3ZYLA 5HCMA 3U8KA 1OEDC 3IF8B 4GOUA 1XMQT 5AQIB 4UR9A 5AQRB 3AE7A 5AQHB 4PK5A 3RX6A 1JNZA 4MBQA 4UVCB 2A3DA 4QACA 2A9UA 4HFCA 5EZYE 1XNRT 4V1Av 5L47A 2XNTA 2ZM2A 4ZOLE 5CB4E 5LNKA 2X68A 4DO0A 2X0YA 3OYXA 2RPAA 2YMEA 4QXCB 2X66A 5ABFB 4IGUA 2E8IA 2JPFA 5KDMC 1LKXA 4U2YA 3OJAA 1OEDB 2X51A 4DV4T 2JQHA 2VK9A 5HWXA 1HS7A 1UX4A 4YSZA 5L3BB 5JVDE 2LKGA 2JRKA 2WZIA 2PG8A 4AFHA 1HNZT 1ZHCA 4TX5A 2K3WA 2BYSA 3U8LA 5AQFB 2QGSA 5LGTB 3E08A 4YHJA 2DHRA 3H3AA 4LF4T 3K3OA 4O4HE 4TNVA 4FI5A 2NW9A 2WNLA 1MIVA 5AFMA 2R6GF 4IL4A 3VRAA 5CA1E 2KMFA 1N32T 2BZBA 5FJVA 5J2TE 1XWMA 3P50A 2P9BA 4G63A 2VQFT 2WU5A 3HKBE 1MNEA 5FVKA 3ZEFB 2Y56A 4GKJT 3SRZA 1WCRA 2SPCA 2MAWA 4QH4A 2G0UA 4JUYA 4QABA 1BR1A 3TLUA 2VKOA 4F6RC 2LRKA 2A72A 5HXHA 4EXTA 4UVAB 4H9SE 2JQKA 4EV6A 1UW6A 3P4RA 1HX8A 4U72A 2DWKA 4ZK4A 1ZV4X 3LBXA 3PJAJ 2B1EA 3MJXA 3QB5A 4LMJA 4LF8T 2XPKA 4KI0F 2BDEA 4ZK1A 4AISA 1O3XA 4ZR6A 1G73A 5F5WA 4DV0T 4OYJA 3KVAA 3VR9A 4WBNE 2L8KA 4Z90A 4GK0E 3AA1B 3K3NA 2MBGA 2K48A 5FXXA 4COFA 3ZYKA 2FJBA 3F31A 4AQFA 3UU6A 5IHYA 4ZI2D 2IC9A 3LK2B 2WSSV 2N2NA 4DMWA 5EK4A 4DV7T 3ETVA 2YEVC 2JMKA 2D0UA 2QVAA 4JI7T 3ZCJA 3RKGA 1MMAA 3V5SA 1XDPA 3D0TA 3WTIA 5AFHA 3EVYA 5J2UE 1I6ZA 1Z8UA 4XK9A 2XSAA 1FMWA 1T72A 2WDVA 2WNCA 2J62A 4QAAA 3DTOA 2LT3A 3P4QA 4ALXA 2V8SV 1J5WA 2W00A 2J47A 2E9XD 3ZC0A 2X67A 1KNPA 3N9NA 2V26A 2PH9A 3KDSE 2VWAA 5AFMB 3N2OA 3C4XA 2Q9QD 3AEAA 4BFQA 2XAGB 2Y7YA 2J1DG 4DNDA 3ZJ1A 4A98A 2ZMAA 4ZI2C 1ZEEA 1W0AA 4AKGA 2XNUA 5IUXA 2WZHA 5FNVE 2YMDA 3BQKA 3JAEA 5BR8T 4CI3B 2FBWA 4X66T 2X0LB 5AQMB 2X9XA 5M4YA 4YFSA 3CKDA 3FZFB 5L3DB 4AQFC 4EYUA 5TVCA 3CX7B 3L8RA 2NR4A 3N9OA 2UXXB 2KZ7B 5A1LA 3RQWA 5AINA 5EK3A 2WN9A 3PUVF 1KEYA 4DIDB 1QSDA 1YW0A 4DMVA 3PUYF 4TWDA 3CX6B 1BR2A 2Q9QC 4HGAA 4TZ4C 2LHNA 1H7CA 2BYQA 1D1CA 3EDVA 4ILUA 5L3GB 2UXCT 4EAHA 4X64T 3UU8A 3BK9A 3L3PA 1D0XA 2LRLA 2JQQA 4OX9T 4BA9A 4AKHA 1G8XA 4UIGA 4HFVA 3OYZA 4BAYB 3VR8A 5H6QB 4DVDA 5GONE 5LP6E 2ZJUA 3TLWA 2WB5A 4ZI3C 4XBFB 3W15B 3PTRB 5HWYA 3K3QC 4LFAT 4P1NA 3NZQA 2RP4A 3RYHE 1OEDE 2BBHA 3LFMA 4ZS2A 5JRCA 1E7PA 2YKSA 3E0ZA 3LK42 2VURA 4K0KT 4YSYA 2CMRA 4YXDA 5DQWA 3BQLA 3ZT5A 3F2EA 3UULA 4DV3T 4DUYT 4KUMB 3JADA 2OV9A 4DR7T 4QKNA 2W66A 4IE0A 5JQGE 4CN1A 4QH1A 3P4WA 2KNDA 1U4QA 4YTNA 5AFUL 3RKOA 5FMNA 4QXBB 2MTQA 3U8MA 1NAFA 2LSGA 4AFGA 3QC9A 1HG2A 2VVNA 5AQGB 2CM0A 2LEHA 2ZM8A 3ESLA 4X1KE 1E2AA 2LOPA 4DR2T 5AQNB 1UK5A 2ZM0A 4F8HA 4H63V 4EGWA 3PJAA 3RYCE 1MNDA 3SOLA 4MLKA 1VRBA 4TV9E 2V7LA 1QUUA 4I55E 4IDQA 4BQTA 3WTOA 1R8IA 3LK3B 2XZ6A 2K9AA 2D9DA 5FVLA 4PK4A 2J4GA 5DQVA 4B6XA 2GK9A 1ZOYA 2WCAA 4DR6T 3ANWA 3JC6C 5LHGB 3AEBA 2W8GA 3CMLA 3KINB 5BW2A 4HWCA 2X9WA 5C8YE 3ZSTA 4A56A 2RA1A 3TLTA 4X65T 3VRBA 4ZEYA 4EB6E 4AI6A 3IHRA 2Y54A 3O1JA 2X9HA 5FL0A 1HNWT 2VKJA 4PIRA 2Y8DA 2B76A 3RYFE 2XQ4A 4OYKA 5ADXL 4MFRA 1VCSA 3BQIA 4U31A 1D1BA 2W8FA 2XSBA 4C91A 3MXZA 2LSYA 4IE7A 2WMNA 3S4UA 1YQ3A 1S94A 4DBQA 5JRCB 1CUNA 4DUZT 1LRZA 4WNKA 3AEFA 3HI2A 4GK5E 2NWBA 3WTKA 1Z0PA 1XDOA 4CXXA 3ZYMA 2UUAT 3PURA 1IJ5A 2XAQB 3Q9DA 2VL0A 2JIWA 2WDQA 3AECA 5JMEA 3AE1A 5EK2A 2ACXA 1MMDA 2BS2A 3ZPOA 5HCJA 5J5IA 3WI3A 4WBOA 2Y48B 5HEOA 3U3IA 2WWVA 2BYNA 3PEOA 2LSKA 5JDFA 3TLVA 4YY3T
chains in the Genus database with same CATH topology
4UXUA 3PMZA 3WTNA 2LKHA 4Z91A 4ZK1A 4HFHA 4AFHA 2XQ9A 2BG9C 2X00A 4ZR6A 4TWFA 2XNUA 4ZJSA 3SIOA 1OEDE 5IUXA 4QH5A 3UQ7A 2YOEA 2M6BA 2YMDA 4EZ1A 4IL9A 4ILBA 3SQ9A 5AFNA 4B5DA 3JAEA 2YKSA 3RHWA 5L4EA 2BYSA 4UM3P 3U8LA 2XQ8A 5J5FA 2KSRA 2LLYA 2QC1B 2XNVA 4Z90A 4ZJTA 4ILAA 3SH1A 1UX2A 3UU4A 5HCMA 3U8KA 2W8GA 5TVCA 3LSVA 4WV9A 1OEDC 2M6IA 5AFLA 5HEJA 4ZRUA 5BW2A 3UUBA 4COFA 2PGZA 4ZZBA 2XQ5A 4X5TA 3RQWA 3WTJA 5AINA 3TLTA 2XQ3A 5L4HA 4NZBA 3UU6A 4TNVA 2X00D 1OEDA 5KE4A 2WN9A 3JADA 5J0ZA 4UM3S 2WNLA 2Y54A 3UU3A 2YN6A 3RIAA 2XYSA 4PIRA 5AFMA 4IL4A 2XQ4A 2BG9A 4LMLA 3ZKRA 4HQPA 3TLSA 5FJVA 4QACA 4DBMA 3JAFA 4TWDA 4HFCA 3C79A 3TLVA 2XQAA 5J5GA 2XQ7A 3P50A 5L47A 2XNTA 2W8FA 4QH1A 2Y58A 4ZZCA 3P4WA 2XYTA 5CO5A 1UV6A 3WTLA 2Y57A 2BR7A 4A97A 5J5HA 3EAMA 3U8MA 2Y56A 3UU5A 2ZJVA 2BG9B 4AFGA 2BYQA 2XQ6A 2WNJA 3WTIA 5KZUA 4TNWA 4IREA 3UQ4A 4TWHA 3GUAA 2YMEA 3ZDGA 5AFHA 4ILCA 5LXBA 2MAWA 3RQUA 2UZ6A 5HEHA 2BJ0A 5CFBA 4XK9A 4AFTA 4QH4A 4HFDA 5AFJA 3UU8A 5BRXA 3WTKA 4XHEA 3RI5A 4UY2A 4QABA 3T4MA 3EI0A 3TLUA 2WNCA 2BYRA 5HEUA 3WIPA 4QAAA 2WZYA 2BYPA 4FRRA 4ALXA 5LG3A 4F8HA 4NPPA 5AFKA 2VL0A 1OEDB 5JMEA 5SYOA 1UW6A 4D01A 3U8NA 3ZDHA 4UM1A 4ZK4A 3SQ6A 2XZ5A 2PH9A 5AFMB 3C84A 3RIFA 3WTMA 4HFIA 5HCJA 2BG9E 5J5IA 3U8JA 3IGQA 2ZJUA 2C9TA 4LMKA 5HEOA 3TLWA 4HFEA 4HFBA 2LM2A 4BFQA 5BP0A 2BYNA 5HEGA 2Y7YA 3PEOA 4BQTA 3WTOA 4LMJA 4A98A 2LKGA 2XZ6A 2BR8A 4UM3A 3WTHA 1I9BA 3EHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UXU A;  3PMZ A;  3WTN A;  2LKH A;  4Z91 A;  4ZK1 A;  4HFH A;  4AFH A;  2XQ9 A;  2BG9 C;  2X00 A;  4ZR6 A;  4TWF A;  2XNU A;  4ZJS A;  3SIO A;  1OED E;  5IUX A;  4QH5 A;  3UQ7 A;  2YOE A;  2M6B A;  2YMD A;  4EZ1 A;  4IL9 A;  4ILB A;  3SQ9 A;  5AFN A;  4B5D A;  3JAE A;  2YKS A;  3RHW A;  5L4E A;  2BYS A;  4UM3 P;  3U8L A;  2XQ8 A;  5J5F A;  2KSR A;  2LLY A;  2QC1 B;  2XNV A;  4Z90 A;  4ZJT A;  4ILA A;  3SH1 A;  1UX2 A;  3UU4 A;  5HCM A;  3U8K A;  2W8G A;  5TVC A;  3LSV A;  4WV9 A;  1OED C;  2M6I A;  5AFL A;  5HEJ A;  4ZRU A;  5BW2 A;  3UUB A;  4COF A;  2PGZ A;  4ZZB A;  2XQ5 A;  4X5T A;  3RQW A;  3WTJ A;  5AIN A;  3TLT A;  2XQ3 A;  5L4H A;  4NZB A;  3UU6 A;  4TNV A;  2X00 D;  1OED A;  5KE4 A;  2WN9 A;  3JAD A;  5J0Z A;  4UM3 S;  2WNL A;  2Y54 A;  3UU3 A;  2YN6 A;  3RIA A;  2XYS A;  4PIR A;  5AFM A;  4IL4 A;  2XQ4 A;  2BG9 A;  4LML A;  3ZKR A;  4HQP A;  3TLS A;  5FJV A;  4QAC A;  4DBM A;  3JAF A;  4TWD A;  4HFC A;  3C79 A;  3TLV A;  2XQA A;  5J5G A;  2XQ7 A;  3P50 A;  5L47 A;  2XNT A;  2W8F A;  4QH1 A;  2Y58 A;  4ZZC A;  3P4W A;  2XYT A;  5CO5 A;  1UV6 A;  3WTL A;  2Y57 A;  2BR7 A;  4A97 A;  5J5H A;  3EAM A;  3U8M A;  2Y56 A;  3UU5 A;  2ZJV A;  2BG9 B;  4AFG A;  2BYQ A;  2XQ6 A;  2WNJ A;  3WTI A;  5KZU A;  4TNW A;  4IRE A;  3UQ4 A;  4TWH A;  3GUA A;  2YME A;  3ZDG A;  5AFH A;  4ILC A;  5LXB A;  2MAW A;  3RQU A;  2UZ6 A;  5HEH A;  2BJ0 A;  5CFB A;  4XK9 A;  4AFT A;  4QH4 A;  4HFD A;  5AFJ A;  3UU8 A;  5BRX A;  3WTK A;  4XHE A;  3RI5 A;  4UY2 A;  4QAB A;  3T4M A;  3EI0 A;  3TLU A;  2WNC A;  2BYR A;  5HEU A;  3WIP A;  4QAA A;  2WZY A;  2BYP A;  4FRR A;  4ALX A;  5LG3 A;  4F8H A;  4NPP A;  5AFK A;  2VL0 A;  1OED B;  5JME A;  5SYO A;  1UW6 A;  4D01 A;  3U8N A;  3ZDH A;  4UM1 A;  4ZK4 A;  3SQ6 A;  2XZ5 A;  2PH9 A;  5AFM B;  3C84 A;  3RIF A;  3WTM A;  4HFI A;  5HCJ A;  2BG9 E;  5J5I A;  3U8J A;  3IGQ A;  2ZJU A;  2C9T A;  4LMK A;  5HEO A;  3TLW A;  4HFE A;  4HFB A;  2LM2 A;  4BFQ A;  5BP0 A;  2BYN A;  5HEG A;  2Y7Y A;  3PEO A;  4BQT A;  3WTO A;  4LMJ A;  4A98 A;  2LKG A;  2XZ6 A;  2BR8 A;  4UM3 A;  3WTH A;  1I9B A;  3EHZ A; 
#chains in the Genus database with same CATH topology
 4UV8 B;  3SS1 A;  2CXF A;  2XQ9 A;  1B7T A;  5KX5 E;  4IE5 A;  2BS4 A;  5LGN B;  2YOE A;  3TKL B;  4GIW A;  3EUH A;  3KBT A;  4CXW A;  5L4E A;  2IML A;  4HE8 A;  4HEA A;  1EZ3 A;  4H9O C;  3K8P C;  3ONL C;  3PUG A;  3SH1 A;  2E5V A;  1UX2 A;  3ZMT B;  2CBI A;  1M62 A;  3PU3 A;  3B5M A;  5CA0 E;  4B3R T;  1S35 A;  5FXV A;  3ABV A;  3GWH A;  3O1H A;  5HXE A;  2ES0 A;  5L4H A;  1JNR A;  3ZMS B;  4JI8 T;  2C0S A;  2XYS A;  3CVR A;  3N9M A;  4H63 H;  3VKH A;  4MHC A;  4DBM A;  2BVM A;  4B3T T;  5DAB A;  2LE8 A;  3RRW A;  3MZK B;  5J5G A;  2XHE B;  2H3R A;  2K24 A;  4ZZC A;  2QYW A;  2CHO A;  4HWI B;  1HR0 T;  4JI0 T;  4AQG A;  3AE9 A;  1MIY A;  2D2S A;  3QK6 A;  2CLY C;  2HH7 A;  2VL8 A;  3ANW B;  1WLX A;  2UZ6 A;  4JI4 T;  3PV0 F;  5HEU A;  3RH3 A;  3J9X 1;  2I59 A;  5LBM A;  5LCY A;  3AA0 B;  3SQ6 A;  2BS3 A;  5F3J A;  3AVS A;  5AQQ B;  3WTM A;  2KLQ A;  3T8O A;  3KFW X;  4IT4 A;  3M3Z B;  4H9P C;  1MMN A;  3MAC A;  4QX8 B;  2XAS B;  3PMZ A;  4OFZ A;  4JI2 T;  3NKZ A;  3PE0 A;  3CWZ B;  2YU1 A;  2XQ8 A;  4HWD A;  4U2Z A;  3PUW F;  2CLY B;  2LLY A;  4ZJT A;  5LHH B;  5ABE A;  1N36 T;  1WR0 A;  3FB2 A;  2C5I T;  5FY1 A;  3ZCI A;  3PUA A;  4LF5 T;  4CZZ B;  1IJ6 A;  3R84 B;  1W0B A;  3ZC1 A;  2XZE A;  4XZC A;  2WP9 A;  1KFY A;  2KWH A;  4GYR A;  1I94 T;  2ZLY A;  4JEH B;  1UUS A;  3N9P A;  3AAE B;  4EOZ B;  1US7 B;  5AQT B;  2NW8 A;  4EEB A;  2Y57 A;  5J5H A;  3H37 A;  4E7Z A;  3RGL A;  4B3M T;  3A7M A;  5LJN A;  3RI5 A;  5JRE A;  2E9X A;  3N9Q A;  2V5D A;  5E0O A;  3V5U A;  2YIN A;  1UCU A;  5L3F B;  2Q9Q A;  3O4X E;  3RC3 A;  5J1G A;  2XJ7 A;  3LJC A;  4ERR A;  4UM3 A;  5C2T A;  2BR8 A;  3P7I A;  2L3L A;  4CQI A;  4UXU A;  3ZMU B;  4TN7 B;  2H89 A;  4TWF A;  3FXD B;  4HKA A;  3PUZ F;  3NRY A;  1AJ3 A;  4XAX B;  2QA7 A;  3A8Y C;  2LJL A;  4B3S T;  5KXJ A;  2IIU A;  2N9D A;  4ILA A;  1M7K A;  3UU4 A;  3FXE B;  3LSV A;  1E1H B;  4U7Y A;  5AQL B;  2M6I A;  4ANJ A;  2JQ9 A;  5DJQ C;  4KHZ F;  4WZX A;  2CCQ A;  3L09 A;  4O4L E;  5LA6 E;  3WTJ A;  1Y01 A;  3DP7 A;  4PJJ A;  5J0Z A;  2W63 A;  5AQV B;  3RPU A;  3UTK A;  4KP3 C;  3AE4 A;  4AXP A;  1KF6 A;  3SFE A;  3TLS A;  4HWH A;  3AB3 B;  3ZN1 B;  3IEE A;  5F8P A;  1UV6 A;  5JDQ A;  4X62 T;  3WTL A;  3VU7 H;  2CXD A;  4EIW A;  1D1A A;  2CA5 A;  2UUB T;  4ZHQ E;  3CK6 A;  4OHF A;  2X9Y A;  4A5X A;  4TNW A;  5L3E B;  4CN4 A;  2E9X C;  4AFT A;  5LOV E;  4L5G A;  3ZMZ B;  4YTP A;  2BYR A;  2PBI A;  2UU9 T;  5HXS A;  2NP9 A;  5FYM A;  5SYO A;  4Z8X A;  3U8N A;  5FKY A;  1XZY A;  2XZ5 A;  1L0V A;  4EZ4 A;  2V6Y A;  2JJ9 A;  2XY8 B;  3U8J A;  1W9R A;  2VKD A;  5BP0 A;  2V5C A;  3Q5D A;  3WTH A;  1NEN A;  3ZT6 A;  2V7M A;  4IDN A;  4HFH A;  3RYI E;  2BG9 C;  1LVK A;  5JR9 C;  3SIO A;  3QNU A;  2M6B A;  2XTL A;  4B5D A;  3ZT7 A;  2BKN A;  3T1Y T;  1WRD A;  3RLF F;  4TV8 E;  3QUJ A;  2DLR A;  1YKH B;  4JYA T;  1XMO T;  2E9X B;  3U78 A;  5AFL A;  1V9D A;  4ZZB A;  2Q9Q B;  4PFO A;  2WU2 A;  2EHO A;  4QX7 B;  2AXD S;  3KBU A;  4HQP A;  4FJO A;  3RIU C;  4ZS3 A;  2CWO A;  2CWY A;  2XUE A;  3A5X A;  4QWN B;  2Y58 A;  2HHH T;  5JDL A;  4KHP T;  5FY7 A;  2CBJ A;  3AVR A;  2XM1 A;  4PW8 A;  1UGO A;  2ZJV A;  4I4T E;  2BG9 B;  3AED A;  3OKQ A;  3FZH B;  5JR9 B;  1YKE B;  2W61 A;  2FJD A;  4ILC A;  2EHO D;  5HEH A;  5AQU B;  4O4J E;  5AFJ A;  1FJG T;  3FZL B;  3SFD A;  1MIW A;  4CI1 B;  2LHR A;  2V7I A;  3AE2 A;  2MPK A;  3ZDH A;  3DJB A;  3AE8 A;  2QRX A;  2KWI B;  2XAF B;  3RIF A;  5LMN T;  4CI2 B;  1SA0 E;  3IGQ A;  1X9B A;  2WWU A;  2CE7 A;  3AEE A;  2LOS A;  1HNX T;  3KV6 A;  4NUV A;  2V7J A;  2UXN B;  1FEW A;  2DNX A;  4UF0 A;  4QH5 A;  4J2C A;  4WYV A;  2FJE A;  4BJM A;  2A2F X;  4YT0 A;  3AE3 A;  4I0U A;  4NUU A;  1UUR A;  4WV9 A;  5FP3 A;  2EHO C;  4NIQ A;  4NXM T;  4JI3 T;  4DBR A;  4X5T A;  5IWA T;  2NTY A;  2V6Y B;  3N9L A;  5ABH A;  5LB7 B;  3NBX X;  4JV5 T;  2LM9 A;  3Q5W A;  4QHO A;  2WM9 A;  4YJ3 E;  4DR3 T;  4L0R A;  3R6N A;  4HN9 A;  3NWI A;  4PNI A;  3HKD E;  2I6H A;  3X1D A;  2BR7 A;  3HA4 A;  3MKD A;  1U5P A;  4L9I A;  1KNZ A;  2CHN A;  4AKR B;  1WYB A;  2VAS A;  3PUX F;  3C98 B;  4KBM B;  1YD8 G;  2WBL A;  2BJ0 A;  3WAK A;  3PUS A;  3FZM B;  3EI0 A;  1HTJ F;  2WZY A;  3KV4 A;  2V6X A;  4NPP A;  2DCF A;  4E7S A;  5HYA A;  2EHO B;  2XAJ B;  2JMH A;  3C84 A;  5AQO B;  2W2U A;  4KX6 A;  4PK6 A;  2DL1 A;  5BMV E;  5HXR A;  2OLT A;  1J1J A;  3AE6 A;  2YU2 A;  4AKI A;  2IUB A;  3EHZ A;  3FBZ A;  3P4S A;  3VHL A;  3ONX A;  4DV5 T;  3HKE E;  4I50 E;  3O9X A;  4DR1 T;  2MYS A;  4PJL A;  3UQ7 A;  4ILB A;  3SQ9 A;  4UM3 P;  3HR0 A;  2FJA A;  4HTE A;  2ODV A;  5JDN A;  5LGU B;  4HWF A;  5HEJ A;  3B13 A;  4UV9 B;  2PFV A;  5JTG A;  4H9N C;  2K5B B;  3T1H T;  5LYJ E;  4TUY E;  1HF8 A;  1CHU A;  4YLH A;  1HFA A;  2BKO A;  3UU3 A;  2YN6 A;  4IE6 A;  2D0T A;  1UX5 A;  1LVF A;  5FY0 A;  2XQ7 A;  3AAI A;  4UF0 B;  3ONJ A;  2XQY A;  2W0G A;  5CJ5 A;  3UT5 E;  4YSX A;  1SUM B;  1FMV A;  4O8S A;  2LSI A;  1ZP0 A;  3UUM A;  2XQ6 A;  1N33 T;  3ZSS A;  1ZKE A;  1KK7 A;  3OTO T;  5KZU A;  3CQX C;  2OA5 A;  4IIJ E;  4UY2 A;  1IAP A;  3WIP A;  3KVB A;  1D0Y A;  4D01 A;  3ZN0 B;  4U33 A;  2IAK A;  2AE9 A;  1XNQ T;  2ZM6 T;  3OBV E;  3IA3 A;  1BR0 A;  4IE4 A;  3EDU A;  3ETU A;  3MA9 A;  3OPC A;  5H6R B;  3N2G E;  1HX1 B;  4Z91 A;  2MOZ A;  3C50 A;  5FL1 A;  4GYS A;  3RHW A;  2XAH B;  5LJM A;  2NOX A;  3B57 A;  5J5F A;  1T7S A;  3AXJ A;  3I1A A;  3RF1 A;  5JH7 E;  2HPL A;  3H3M A;  3AA7 B;  2PTF A;  3N2K E;  4X20 E;  5LMU T;  2WDR A;  3UUB A;  2UUC T;  4O4I E;  2XQ5 A;  2IC6 A;  5FXZ A;  2F4V T;  5KE4 A;  1X79 A;  2VVS A;  4LF7 T;  3AAA B;  4YHH T;  4DR5 T;  3RRC A;  1SHZ C;  3Q2M A;  1BR4 A;  2BBJ A;  4YTM A;  1KNR A;  2PJQ A;  4ISS A;  5L2L A;  2C5K T;  2WNJ A;  4M1P A;  4QXH B;  3CPZ A;  4TWH A;  2H88 A;  3ZDG A;  4EYY R;  3C4W A;  2XM2 A;  2I0M A;  2ODU A;  3I9Y A;  1W09 A;  1NEK A;  5LG3 A;  3ZLI A;  5AFK A;  5LXT E;  2V7K A;  4LFB T;  3J7Y q;  3CQG B;  4H9R C;  4HFI A;  2BG9 E;  3PDY A;  4IDP A;  3IBP A;  1Y64 B;  2L9Q A;  2LSJ A;  5KMG P;  2UXD T;  2X0H A;  3HL6 A;  4Q25 A;  4AKL A;  4ZJS A;  4P0A A;  3NZP A;  1FIO A;  3QB5 K;  2IW5 B;  2WMO A;  3K1S A;  3O1I A;  2Z6E A;  4YJ2 E;  2PGZ A;  4NZB A;  1T98 A;  3PUQ A;  1YXR A;  4GKK T;  3N5L A;  5JDM A;  4UM3 S;  1YQ4 A;  4EZH A;  3RIA A;  3G06 A;  2H7O A;  4IDO A;  2HN2 A;  2BG9 A;  5JR9 A;  2W4X A;  2XQA A;  4U74 A;  3I0Q A;  4IDZ A;  3C51 A;  5IYZ E;  1WFD A;  3CX8 B;  2IDO B;  4A97 A;  2BKP A;  3AXJ B;  3UU5 A;  4U3C A;  4IRE A;  2KIN B;  3C64 A;  3F57 A;  4LFC T;  3RQU A;  3MK7 C;  5CFB A;  5BRX A;  4HFD A;  3AE5 A;  1IBK T;  3T4M A;  2E5L T;  2BYP A;  4FRR A;  2VKH A;  3I9W A;  2CXL A;  4IST A;  3RIU A;  3GA8 A;  5LBQ B;  3KV9 A;  5TAO A;  3SWH A;  2LM2 A;  4NXN T;  2YDQ A;  4DR4 T;  5HEG A;  2W62 A;  3WAJ A;  2YDR A;  2C5J A;  4JLE A;  2CEA A;  3UFG A;  1N34 T;  3WTN A;  2LKH A;  2KT9 A;  2Y6X A;  4K0U A;  2FUP A;  3HKC E;  4ZXL A;  5C3J A;  4P0B A;  3LBX B;  5HXC A;  4ZI3 D;  2YK0 A;  1WR6 A;  4IL9 A;  3UFE A;  3C4Z A;  2M67 A;  4I43 B;  1MMG A;  4JI6 T;  3M65 A;  5AQK B;  2QC1 B;  2XNV A;  3GN5 A;  4MAL A;  3JCF A;  5JDH A;  4ZRU A;  3FZK B;  1GQE A;  3EAB A;  2XQ3 A;  3KV5 A;  4KMC A;  3GMI A;  4O2B E;  3LG7 A;  2HN1 A;  3AEG A;  2WS3 A;  3ZKR A;  4CN6 A;  3JAF A;  3C79 A;  4OK0 A;  2WQY A;  1T8B A;  2XYT A;  3P4P A;  2NW7 A;  3L39 A;  1DU2 A;  3E22 E;  4IHJ E;  2DI4 A;  4CXY A;  4WW0 A;  5LG4 A;  3VKG A;  5AQJ B;  3CIR A;  3UQ4 A;  3GUA A;  5LXB A;  1SE7 A;  4XHE A;  1D0Z A;  2BVL A;  1IBM T;  4JEU B;  4P09 A;  3P8C D;  5LHI B;  2H7V C;  4DV1 T;  2NTX A;  2VQE T;  2IHR 1;  2CRB A;  2C9T A;  4UXN B;  1NWM X;  4LMK A;  4HFE A;  3NRX A;  4H9Q C;  4X1I E;  3FBL A;  1I9B A;  3UUX B;  5JDG A;  2X00 A;  2WY2 A;  1OWA A;  4DV6 T;  2E2A A;  5AFN A;  5ABG A;  1QLB A;  4JBW F;  2KSR A;  5HAX A;  4C90 A;  4PFP A;  4LF9 T;  5L3C B;  4O2A E;  2CPT A;  1WYC A;  4ASK A;  3RC8 A;  4AIU A;  4UEM A;  5ABF A;  5CGM A;  4PAG A;  1J5E T;  4LF6 T;  4PJM A;  1HG5 A;  3JC6 D;  5ETW A;  2X00 D;  1OED A;  3AA6 B;  2V1D B;  2WAU A;  5FXW A;  4LML A;  2N1G A;  4JI5 T;  1VCT A;  5AQP B;  2ACZ A;  1IBL T;  4UEL A;  1HCI A;  5CO5 A;  4G2A A;  3Q5X A;  3EAM A;  1VOM A;  2HPJ A;  2KXP B;  4BJN A;  3GN5 B;  4AQY T;  3QOF A;  2DWG A;  4N78 D;  1IZN B;  4X1Y E;  3PU8 A;  3I0O A;  5AQS B;  2YDS A;  2UXB T;  4ADZ A;  4DV2 T;  2D5U A;  4UM1 A;  4EED A;  1OXZ A;  3ZMV B;  3OVU A;  3UUN A;  4HFB A;  2VB6 A;  4JI1 T;  2W67 A;  3ZJ2 A;  3LDQ B;  3CQC B;  4UVB B;  3NVO A;  4EZ1 A;  4U7I A;  3FHN A;  3Q5E A;  4ZI7 E;  4PJN A;  3ZYL A;  5HCM A;  3U8K A;  1OED C;  3IF8 B;  4GOU A;  1XMQ T;  5AQI B;  4UR9 A;  5AQR B;  3AE7 A;  5AQH B;  4PK5 A;  3RX6 A;  1JNZ A;  4MBQ A;  4UVC B;  2A3D A;  4QAC A;  2A9U A;  4HFC A;  5EZY E;  1XNR T;  4V1A v;  5L47 A;  2XNT A;  2ZM2 A;  4ZOL E;  5CB4 E;  5LNK A;  2X68 A;  4DO0 A;  2X0Y A;  3OYX A;  2RPA A;  2YME A;  4QXC B;  2X66 A;  5ABF B;  4IGU A;  2E8I A;  2JPF A;  5KDM C;  1LKX A;  4U2Y A;  3OJA A;  1OED B;  2X51 A;  4DV4 T;  2JQH A;  2VK9 A;  5HWX A;  1HS7 A;  1UX4 A;  4YSZ A;  5L3B B;  5JVD E;  2LKG A;  2JRK A;  2WZI A;  2PG8 A;  4AFH A;  1HNZ T;  1ZHC A;  4TX5 A;  2K3W A;  2BYS A;  3U8L A;  5AQF B;  2QGS A;  5LGT B;  3E08 A;  4YHJ A;  2DHR A;  3H3A A;  4LF4 T;  3K3O A;  4O4H E;  4TNV A;  4FI5 A;  2NW9 A;  2WNL A;  1MIV A;  5AFM A;  2R6G F;  4IL4 A;  3VRA A;  5CA1 E;  2KMF A;  1N32 T;  2BZB A;  5FJV A;  5J2T E;  1XWM A;  3P50 A;  2P9B A;  4G63 A;  2VQF T;  2WU5 A;  3HKB E;  1MNE A;  5FVK A;  3ZEF B;  2Y56 A;  4GKJ T;  3SRZ A;  1WCR A;  2SPC A;  2MAW A;  4QH4 A;  2G0U A;  4JUY A;  4QAB A;  1BR1 A;  3TLU A;  2VKO A;  4F6R C;  2LRK A;  2A72 A;  5HXH A;  4EXT A;  4UVA B;  4H9S E;  2JQK A;  4EV6 A;  1UW6 A;  3P4R A;  1HX8 A;  4U72 A;  2DWK A;  4ZK4 A;  1ZV4 X;  3LBX A;  3PJA J;  2B1E A;  3MJX A;  3QB5 A;  4LMJ A;  4LF8 T;  2XPK A;  4KI0 F;  2BDE A;  4ZK1 A;  4AIS A;  1O3X A;  4ZR6 A;  1G73 A;  5F5W A;  4DV0 T;  4OYJ A;  3KVA A;  3VR9 A;  4WBN E;  2L8K A;  4Z90 A;  4GK0 E;  3AA1 B;  3K3N A;  2MBG A;  2K48 A;  5FXX A;  4COF A;  3ZYK A;  2FJB A;  3F31 A;  4AQF A;  3UU6 A;  5IHY A;  4ZI2 D;  2IC9 A;  3LK2 B;  2WSS V;  2N2N A;  4DMW A;  5EK4 A;  4DV7 T;  3ETV A;  2YEV C;  2JMK A;  2D0U A;  2QVA A;  4JI7 T;  3ZCJ A;  3RKG A;  1MMA A;  3V5S A;  1XDP A;  3D0T A;  3WTI A;  5AFH A;  3EVY A;  5J2U E;  1I6Z A;  1Z8U A;  4XK9 A;  2XSA A;  1FMW A;  1T72 A;  2WDV A;  2WNC A;  2J62 A;  4QAA A;  3DTO A;  2LT3 A;  3P4Q A;  4ALX A;  2V8S V;  1J5W A;  2W00 A;  2J47 A;  2E9X D;  3ZC0 A;  2X67 A;  1KNP A;  3N9N A;  2V26 A;  2PH9 A;  3KDS E;  2VWA A;  5AFM B;  3N2O A;  3C4X A;  2Q9Q D;  3AEA A;  4BFQ A;  2XAG B;  2Y7Y A;  2J1D G;  4DND A;  3ZJ1 A;  4A98 A;  2ZMA A;  4ZI2 C;  1ZEE A;  1W0A A;  4AKG A;  2XNU A;  5IUX A;  2WZH A;  5FNV E;  2YMD A;  3BQK A;  3JAE A;  5BR8 T;  4CI3 B;  2FBW A;  4X66 T;  2X0L B;  5AQM B;  2X9X A;  5M4Y A;  4YFS A;  3CKD A;  3FZF B;  5L3D B;  4AQF C;  4EYU A;  5TVC A;  3CX7 B;  3L8R A;  2NR4 A;  3N9O A;  2UXX B;  2KZ7 B;  5A1L A;  3RQW A;  5AIN A;  5EK3 A;  2WN9 A;  3PUV F;  1KEY A;  4DID B;  1QSD A;  1YW0 A;  4DMV A;  3PUY F;  4TWD A;  3CX6 B;  1BR2 A;  2Q9Q C;  4HGA A;  4TZ4 C;  2LHN A;  1H7C A;  2BYQ A;  1D1C A;  3EDV A;  4ILU A;  5L3G B;  2UXC T;  4EAH A;  4X64 T;  3UU8 A;  3BK9 A;  3L3P A;  1D0X A;  2LRL A;  2JQQ A;  4OX9 T;  4BA9 A;  4AKH A;  1G8X A;  4UIG A;  4HFV A;  3OYZ A;  4BAY B;  3VR8 A;  5H6Q B;  4DVD A;  5GON E;  5LP6 E;  2ZJU A;  3TLW A;  2WB5 A;  4ZI3 C;  4XBF B;  3W15 B;  3PTR B;  5HWY A;  3K3Q C;  4LFA T;  4P1N A;  3NZQ A;  2RP4 A;  3RYH E;  1OED E;  2BBH A;  3LFM A;  4ZS2 A;  5JRC A;  1E7P A;  2YKS A;  3E0Z A;  3LK4 2;  2VUR A;  4K0K T;  4YSY A;  2CMR A;  4YXD A;  5DQW A;  3BQL A;  3ZT5 A;  3F2E A;  3UUL A;  4DV3 T;  4DUY T;  4KUM B;  3JAD A;  2OV9 A;  4DR7 T;  4QKN A;  2W66 A;  4IE0 A;  5JQG E;  4CN1 A;  4QH1 A;  3P4W A;  2KND A;  1U4Q A;  4YTN A;  5AFU L;  3RKO A;  5FMN A;  4QXB B;  2MTQ A;  3U8M A;  1NAF A;  2LSG A;  4AFG A;  3QC9 A;  1HG2 A;  2VVN A;  5AQG B;  2CM0 A;  2LEH A;  2ZM8 A;  3ESL A;  4X1K E;  1E2A A;  2LOP A;  4DR2 T;  5AQN B;  1UK5 A;  2ZM0 A;  4F8H A;  4H63 V;  4EGW A;  3PJA A;  3RYC E;  1MND A;  3SOL A;  4MLK A;  1VRB A;  4TV9 E;  2V7L A;  1QUU A;  4I55 E;  4IDQ A;  4BQT A;  3WTO A;  1R8I A;  3LK3 B;  2XZ6 A;  2K9A A;  2D9D A;  5FVL A;  4PK4 A;  2J4G A;  5DQV A;  4B6X A;  2GK9 A;  1ZOY A;  2WCA A;  4DR6 T;  3ANW A;  3JC6 C;  5LHG B;  3AEB A;  2W8G A;  3CML A;  3KIN B;  5BW2 A;  4HWC A;  2X9W A;  5C8Y E;  3ZST A;  4A56 A;  2RA1 A;  3TLT A;  4X65 T;  3VRB A;  4ZEY A;  4EB6 E;  4AI6 A;  3IHR A;  2Y54 A;  3O1J A;  2X9H A;  5FL0 A;  1HNW T;  2VKJ A;  4PIR A;  2Y8D A;  2B76 A;  3RYF E;  2XQ4 A;  4OYK A;  5ADX L;  4MFR A;  1VCS A;  3BQI A;  4U31 A;  1D1B A;  2W8F A;  2XSB A;  4C91 A;  3MXZ A;  2LSY A;  4IE7 A;  2WMN A;  3S4U A;  1YQ3 A;  1S94 A;  4DBQ A;  5JRC B;  1CUN A;  4DUZ T;  1LRZ A;  4WNK A;  3AEF A;  3HI2 A;  4GK5 E;  2NWB A;  3WTK A;  1Z0P A;  1XDO A;  4CXX A;  3ZYM A;  2UUA T;  3PUR A;  1IJ5 A;  2XAQ B;  3Q9D A;  2VL0 A;  2JIW A;  2WDQ A;  3AEC A;  5JME A;  3AE1 A;  5EK2 A;  2ACX A;  1MMD A;  2BS2 A;  3ZPO A;  5HCJ A;  5J5I A;  3WI3 A;  4WBO A;  2Y48 B;  5HEO A;  3U3I A;  2WWV A;  2BYN A;  3PEO A;  2LSK A;  5JDF A;  3TLV A;  4YY3 T; 
#chains in the Genus database with same CATH homology
 4UXU A;  3PMZ A;  3WTN A;  2LKH A;  4Z91 A;  4ZK1 A;  4HFH A;  4AFH A;  2XQ9 A;  2BG9 C;  2X00 A;  4ZR6 A;  4TWF A;  2XNU A;  4ZJS A;  3SIO A;  1OED E;  5IUX A;  4QH5 A;  3UQ7 A;  2YOE A;  2M6B A;  2YMD A;  4EZ1 A;  4IL9 A;  4ILB A;  3SQ9 A;  5AFN A;  4B5D A;  3JAE A;  2YKS A;  3RHW A;  5L4E A;  2BYS A;  4UM3 P;  3U8L A;  2XQ8 A;  5J5F A;  2KSR A;  2LLY A;  2QC1 B;  2XNV A;  4Z90 A;  4ZJT A;  4ILA A;  3SH1 A;  1UX2 A;  3UU4 A;  5HCM A;  3U8K A;  2W8G A;  5TVC A;  3LSV A;  4WV9 A;  1OED C;  2M6I A;  5AFL A;  5HEJ A;  4ZRU A;  5BW2 A;  3UUB A;  4COF A;  2PGZ A;  4ZZB A;  2XQ5 A;  4X5T A;  3RQW A;  3WTJ A;  5AIN A;  3TLT A;  2XQ3 A;  5L4H A;  4NZB A;  3UU6 A;  4TNV A;  2X00 D;  1OED A;  5KE4 A;  2WN9 A;  3JAD A;  5J0Z A;  4UM3 S;  2WNL A;  2Y54 A;  3UU3 A;  2YN6 A;  3RIA A;  2XYS A;  4PIR A;  5AFM A;  4IL4 A;  2XQ4 A;  2BG9 A;  4LML A;  3ZKR A;  4HQP A;  3TLS A;  5FJV A;  4QAC A;  4DBM A;  3JAF A;  4TWD A;  4HFC A;  3C79 A;  3TLV A;  2XQA A;  5J5G A;  2XQ7 A;  3P50 A;  5L47 A;  2XNT A;  2W8F A;  4QH1 A;  2Y58 A;  4ZZC A;  3P4W A;  2XYT A;  5CO5 A;  1UV6 A;  3WTL A;  2Y57 A;  2BR7 A;  4A97 A;  5J5H A;  3EAM A;  3U8M A;  2Y56 A;  3UU5 A;  2ZJV A;  2BG9 B;  4AFG A;  2BYQ A;  2XQ6 A;  2WNJ A;  3WTI A;  5KZU A;  4TNW A;  4IRE A;  3UQ4 A;  4TWH A;  3GUA A;  2YME A;  3ZDG A;  5AFH A;  4ILC A;  5LXB A;  2MAW A;  3RQU A;  2UZ6 A;  5HEH A;  2BJ0 A;  5CFB A;  4XK9 A;  4AFT A;  4QH4 A;  4HFD A;  5AFJ A;  3UU8 A;  5BRX A;  3WTK A;  4XHE A;  3RI5 A;  4UY2 A;  4QAB A;  3T4M A;  3EI0 A;  3TLU A;  2WNC A;  2BYR A;  5HEU A;  3WIP A;  4QAA A;  2WZY A;  2BYP A;  4FRR A;  4ALX A;  5LG3 A;  4F8H A;  4NPP A;  5AFK A;  2VL0 A;  1OED B;  5JME A;  5SYO A;  1UW6 A;  4D01 A;  3U8N A;  3ZDH A;  4UM1 A;  4ZK4 A;  3SQ6 A;  2XZ5 A;  2PH9 A;  5AFM B;  3C84 A;  3RIF A;  3WTM A;  4HFI A;  5HCJ A;  2BG9 E;  5J5I A;  3U8J A;  3IGQ A;  2ZJU A;  2C9T A;  4LMK A;  5HEO A;  3TLW A;  4HFE A;  4HFB A;  2LM2 A;  4BFQ A;  5BP0 A;  2BYN A;  5HEG A;  2Y7Y A;  3PEO A;  4BQT A;  3WTO A;  4LMJ A;  4A98 A;  2LKG A;  2XZ6 A;  2BR8 A;  4UM3 A;  3WTH A;  1I9B A;  3EHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...