3TLVA

The glic pentameric ligand-gated ion channel loop2-22' oxidized mutant in a locally-closed conformation (lc3 subtype)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
molecule tags Membrane protein, transport protein
source organism Gloeobacter violaceus
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
total genus 94
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tlvA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tlvA01
3U8MA 3JADA 4HFCA 4QAAA 2BR8A 5KE4A 3UU3A 4ZZCA 4LMKA 2BJ0A 2BG9A 4ZZBA 3SQ6A 2LM2A 4IL9A 5L47A 3U8JA 4UM3A 3ZKRA 2BYPA 5IUXA 5J5IA 3RIAA 3JAFA 2XQ7A 5J5FA 5HEGA 5AFMA 5J5HA 2XYSA 4B5DA 4UM1A 3RIFA 3WTIA 5AFNA 2WNJA 2YN6A 3UUBA 5BP0A 5J0ZA 3TLSA 5BW2A 2MAWA 1OEDB 4HFIA 2BYQA 2XZ6A 3TLWA 5HEJA 4BQTA 4F8HA 3UU4A 2PH9A 3WTHA 4PIRA 2QC1B 3U8KA 4UXUA 3SIOA 2YOEA 3RQUA 3WTJA 4LMJA 4DBMA 3WTOA 4ZJTA 3P50A 4ZK4A 3TLUA 3WTNA 4ILCA 5AFLA 5CFBA 4UY2A 2BG9B 5FJVA 3T4MA 4HQPA 2C9TA 4AFHA 4ZJSA 2BG9E 2WN9A 2YKSA 3EHZA 5J5GA 3PEOA 3P4WA 4QH1A 4QH4A 4FRRA 3IGQA 3WIPA 2BYRA 2XNTA 5AFMB 1UX2A 2ZJUA 3WTKA 1OEDC 4UM3P 4TWDA 5HEOA 1OEDA 2BG9C 2XQ3A 2XQ6A 4XK9A 4TWHA 3UU6A 2W8FA 2XNVA 5LG3A 1UV6A 2YMEA 4TWFA 3C84A 3WTLA 5LXBA 3WTMA 2Y7YA 4ZR6A 5AFKA 5BRXA 5KZUA 4AFGA 2XYTA 5HEUA 3TLTA 1I9BA 1UW6A 2WZYA 2XNUA 4ZRUA 3TLVA 4ILAA 3UU8A 5HEHA 2WNCA 4QACA 4IREA 2XQ8A 5TVCA 3U8LA 2LLYA 4XHEA 4EZ1A 4WV9A 2M6BA 3LSVA 5JMEA 2YMDA 2Y57A 4Z91A 3ZDHA 4ZK1A 5HCMA 2XQAA 2XZ5A 2LKGA 5AFHA 2KSRA 2Y58A 2M6IA 2BYSA 5L4HA 2BYNA 2X00A 4ILBA 3UQ7A 4IL4A 2LKHA 2X00D 4ALXA 4BFQA 3RHWA 2Y54A 2UZ6A 4A97A 4UM3S 3SH1A 3JAEA 4HFBA 4NZBA 3U8NA 4AFTA 2VL0A 4Z90A 4HFHA 3PMZA 4LMLA 1OEDE 3ZDGA 5HCJA 3SQ9A 2XQ4A 2XQ5A 3EI0A 2XQ9A 4A98A 4TNVA 4QH5A 5AFJA 5SYOA 3UU5A 4X5TA 2BR7A 3RQWA 2WNLA 3EAMA 2PGZA 2Y56A 4COFA 3GUAA 2ZJVA 4D01A 4HFDA 4QABA 5CO5A 4NPPA 3C79A 3RI5A 3UQ4A 4TNWA 2W8GA 4HFEA 5AINA 5L4EA
chains in the Genus database with same CATH superfamily
5L3DB 2BR8A 3ZEFB 1Z8UA 2P9BA 2LSKA 3MJXA 2KNDA 3JAFA 3K3QC 2JJ9A 3AE5A 2ZM8A 3RKGA 3V5SA 3AE3A 1OEDB 4HFIA 4ERRA 2E8IA 3AEBA 3UTKA 5LGNB 3ETVA 3RX6A 2BKNA 3TLUA 5HXHA 3N9NA 4WNKA 2CM0A 4EEDA 4JI1T 5H6RB 4U74A 3IHRA 5LG4A 3BQIA 3EHZA 3L09A 2WAUA 4QH4A 5JTGA 4PJMA 3UUMA 2BBHA 4KHZF 4IE0A 3RYIE 4TWHA 2X0YA 5LXBA 3GWHA 3WTLA 5BRXA 4V1Av 4ILAA 2Q9QC 3HR0A 5HEHA 1EZ3A 5TVCA 2XQ8A 3CX7B 5LMNT 4EZ1A 5ABGA 2WY2A 4ZK1A 4X1YE 3R84B 5L2LA 2LKGA 1AJ3A 4BFQA 1FEWA 1KNPA 3AEDA 1N36T 4X66T 2VL0A 2WWUA 3N2KE 2YEVC 5AQFB 5LA6E 3FBLA 2W67A 1HNZT 3RQWA 2ZJVA 4D01A 3ZYKA 2WDQA 4GK5E 2JMHA 2HH7A 4MLKA 1IBLT 1BR0A 3CQCB 3L3PA 4I50E 4C91A 4YJ3E 3AE6A 3ANWB 5FNVE 4EEBA 2LE8A 4AKIA 2XY8B 2X9WA 2X66A 3ONLC 4P09A 2IC6A 3SOLA 3B13A 5AFMA 5LXTE 4GYRA 5AQRB 2UXXB 2UXDT 1YD8G 3CX6B 2XM1A 1XWMA 4XAXB 3SIOA 3NWIA 3CWZB 4GYSA 2W0GA 2JMKA 5AFLA 3RH3A 3LG7A 4YSZA 5LHGB 5IWAT 4JI4T 2N2NA 2IHR1 5J5GA 2JQKA 1WRDA 2B1EA 3J7Yq 2VKDA 1W09A 2CCQA 4IE6A 2XQ3A 4X65T 3AA7B 5AFKA 1SHZC 3TLTA 2XNUA 4GOUA 2CEAA 4LF6T 4UV8B 3RGLA 1KF6A 4AXPA 4G2AA 3Q5WA 4Z91A 1HF8A 3T8OA 3CMLA 3AE9A 1CUNA 5FYMA 3VR9A 1MMAA 4PJNA 4CN4A 2ZM6T 4ANJA 4E7ZA 2IMLA 2BKPA 5H6QB 5L4EA 4HFCA 2W66A 4ZZCA 1FMWA 4DVDA 5JR9C 4B3MT 3NVOA 3RKOA 4UM3A 4DV2T 3Q2MA 5JDNA 4L9IA 3ZPOA 1ZV4X 3TLWA 4DO0A 4F8HA 5LNKA 3ZT7A 4QXCB 5FXXA 4N78D 3RQUA 4U2YA 1YQ3A 4U33A 2FJAA 5C8YE 2N1GA 2K24A 5FY7A 4FRRA 3IGQA 2XZEA 4OYKA 4NXNT 4O4JE 4YSXA 4TWFA 2XAJB 1GQEA 2BS4A 4X64T 2KZ7B 3RIUA 1ZP0A 1ZHCA 3N9QA 2YMDA 3OBVE 5HCMA 2Y6XA 4DR4T 5FXZA 2IUBA 3CQXC 2M6IA 3F31A 2V1DB 2V6YB 1ZOYA 2UZ6A 3ZN1B 4UM3S 4Z8XA 2A72A 4YTMA 2Q9QB 4HTEA 1YW0A 3C51A 4HWFA 3UU5A 4YTPA 2Q9QD 5F3JA 2LM9A 4TNWA 1WYBA 1WYCA 2CXFA 4IL9A 2RP4A 4ZI7E 2J4GA 4JI5T 1NWMX 4EV6A 2B76A 2WNJA 4IE5A 4H63H 2K48A 1HTJF 2BYQA 5KXJA 2C5KT 3KVBA 2PH9A 3MXZA 2CHNA 3ETUA 4CN1A 2VL8A 3NRYA 4DNDA 4P1NA 4AISA 3BK9A 4DMVA 3GMIA 3JC6D 5AFMB 4K0UA 2V7LA 1BR1A 5AQTB 3U3IA 2X9HA 2D0TA 4IDNA 4XK9A 2XNVA 1MMGA 4X1IE 1BR4A 1HR0T 1SA0E 2HPLA 5LB7B 3LFMA 5HEUA 2WZYA 5J2UE 2SPCA 4DV4T 4AQYT 3C4ZA 3KFWX 3AA1B 4M1PA 2VASA 2V6YA 2XZ5A 4JYAT 2YDQA 4FI5A 3NRXA 4ILBA 3EDUA 5HXEA 3P4PA 2BBJA 1LKXA 2F4VT 3ZLIA 3FBZA 4HFBA 3B5MA 4H9SE 2CHOA 3FHNA 1IBMT 2BVLA 4F6RC 4LF4T 1W9RA 3AE1A 2W8GA 3JADA 4AKHA 1U4QA 5FL1A 2BJ0A 2GK9A 3LK2B 3Q5XA 3M3ZB 4PJJA 5HWYA 2XQ7A 1D0ZA 4QX7B 2PBIA 3UFEA 3QK6A 2MAWA 4TV8E 2E5VA 3AAAB 3AEGA 2A3DA 3O1JA 4PIRA 4DV1T 1XDPA 2LJLA 1XMOT 4OYJA 3ZSTA 5JVDE 3S4UA 4UVAB 2VB6A 4AQGA 1E7PA 4CXWA 1N32T 3RYCE 2CMRA 3WIPA 3P8CD 2R6GF 4WBNE 4LFCT 3HI2A 1WR0A 4H9PC 3UU6A 4NUVA 3I0QA 5L3BB 3OVUA 2BZBA 4I0UA 2LLYA 2LOSA 3QB5K 3H3AA 2NOXA 5EZYE 5IHYA 3PJAA 3PUGA 1LRZA 2JQQA 4IDQA 4H9RC 2QRXA 4DR7T 3MKDA 4E7SA 4HWDA 3I0OA 5TAOA 4BA9A 4AFTA 3KBUA 2MOZA 3PUXF 3ZCIA 3ZC1A 1D1CA 2IAKA 4BJMA 3ZDGA 4ASKA 3GN5B 1UK5A 2C0SA 4ZXLA 2BR7A 2WP9A 2BKOA 2XSBA 1JNRA 3GUAA 3C79A 2DHRA 3QNUA 4ZS2A 5CA1E 5J2TE 2QYWA 2FUPA 4IDZA 2XSAA 1KNZA 5IYZE 1LVKA 1VOMA 3DTOA 4DR1T 3FZKB 5ABHA 4CI2B 1VCTA 3MZKB 2X67A 3JC6C 3PUVF 5FXVA 5LP6E 4JI8T 5CB4E 1W0BA 4KHPT 4JBWF 5HEJA 2WMOA 2QC1B 2I59A 3W15B 4LMJA 4ZK4A 1UX4A 3PU3A 2UXBT 3UFGA 2WWVA 3RF1A 4LF7T 4AFHA 3O4XE 2MBGA 4ZJSA 2H3RA 5C2TA 1ZKEA 2ACXA 3I1AA 3AECA 4EOZB 2QGSA 1UX2A 3WTKA 1U5PA 2EHOD 2LSGA 3I9WA 2W8FA 3O1HA 2YMEA 3ONXA 3TLVA 4QACA 3ESLA 3KDSE 1Y64B 4DV7T 2H7VC 2UXNB 4DV6T 5AQUB 2JQHA 3PUQA 1I94T 2X00A 5M4YA 4LF5T 4HWIB 1CHUA 3U8NA 3FB2A 2X0LB 3UT5E 4CXYA 2WNLA 3RRWA 2KMFA 1YQ4A 3N9MA 3ZMTB 5LHHB 4DR6T 4AQFA 2IIUA 3PDYA 1B7TA 3SQ6A 2WU5A 3SWHA 3OYZA 4IIJE 2BVMA 3UUNA 4JLEA 3PURA 2HPJA 1N34T 2XM2A 4O8SA 2E9XC 3HKDE 3TLSA 2CXLA 3VRBA 2XUEA 4UXUA 2C5JA 4H9QC 5ABFA 2FJEA 5AQJB 3KINB 3OYXA 1T72A 3PEOA 4JI0T 3LK42 3N9OA 1S35A 2CLYC 5FP3A 2KLQA 3V5UA 5L3CB 4ZI2C 3K3OA 3WTMA 4QXHB 3ZN0B 5KZUA 2EHOA 2XYTA 4ZI3D 1H7CA 3KV6A 3U8LA 1KK7A 2M6BA 3SFEA 2XAFB 4KMCA 1J5WA 4HE8A 1KFYA 4KBMB 3WAKA 5L4HA 2KWIB 2LKHA 3K1SA 4HFHA 2XAGB 4JV5T 3UULA 5HCJA 2XPKA 3SQ9A 2XQ5A 2KWHA 4AI6A 2XAHB 5CO5A 2QVAA 2HHHT 4B3ST 4HEAA 4LFBT 4YFSA 5KE4A 5EK3A 1QLBA 2LM2A 3U8JA 2X9YA 4O2BE 2BYPA 5J5FA 2LRLA 3PV0F 5J0ZA 4U31A 3GN5A 5HXRA 4DUZT 5ABFB 2PG8A 3NZPA 3N2GE 3NBXX 5AQSB 3WTJA 5L3GB 5HAXA 4YHHT 3ZC0A 2XASB 4ILUA 2BG9E 5F5WA 3P4WA 3F2EA 3FZLB 4XBFB 4NXMT 2DLRA 2I0MA 2D0UA 3HKBE 3LJCA 4PFPA 2C5IT 4PK5A 2XQ6A 3RC8A 3CX8B 2E5LT 3QOFA 5DQWA 1I9BA 1VRBA 4IDPA 2VURA 4EAHA 4PNIA 2LRKA 2DWKA 2YDRA 2L9QA 3G06A 2NW9A 3AAEB 1UURA 4IL4A 2WMNA 3MACA 5LJNA 1FJGT 1KNRA 3A8YC 3JAEA 4ZOLE 2WZHA 1M7KA 5LBMA 4LMLA 5E0OA 1I6ZA 4UXNB 4DMWA 2L8KA 2WS3A 5FMNA 1WR6A 5F8PA 2CWYA 4ZI3C 2LOPA 2CLYB 5KDMC 3IBPA 5JRCA 2LT3A 4QXBB 4B3RT 4U7IA 4GIWA 1MNDA 4DR5T 5J5HA 2XYSA 5BMVE 5BP0A 3C4WA 3ZMUB 4PK6A 2UUCT 4L5GA 3LDQB 3K3NA 4IE7A 4DBMA 2CA5A 2JIWA 4U72A 4O4IE 4ILCA 4DBRA 2XJ7A 2G0UA 1WLXA 3AVRA 2BG9B 5FJVA 3RC3A 3ZT6A 1IJ6A 3O9XA 3RYFE 4CQIA 4EYYR 1IZNB 1YKEB 3AEFA 4UM3P 4FJOA 5HEOA 2E9XB 1MIYA 2UU9T 1G73A 3AEAA 3L8RA 4HFVA 2VWAA 2V7JA 2Y7YA 1YXRA 3UU8A 3CPZA 2JQ9A 5LCYA 1DU2A 3AAIA 3PE0A 2V5CA 2XQAA 5FL0A 2UUBT 2X00D 2VKHA 2CBIA 2LSIA 4A97A 2W62A 3L39A 2DWGA 4OFZA 3PMZA 3E22E 3E08A 4TNVA 1S94A 3DP7A 4EGWA 1M62A 4I4TE 4LMKA 2CE7A 4O2AE 4MALA 1OWAA 4KI0F 3K8PC 3AE7A 4LF8T 5J5IA 3KV9A 1MMDA 3ZT5A 2VVNA 2NWBA 3M65A 3WTIA 2AXDS 2Q9QA 3UUBA 5JH7E 2XZ6A 5FXWA 2YK0A 1FMVA 3U8KA 4UVCB 2NW8A 4X1KE 2W00A 5CGMA 2MPKA 4PW8A 2H7OA 1XZYA 3HA4A 4JI7T 3Q9DA 4I43B 5GONE 3CIRA 4DBQA 2C9TA 2YKSA 5BR8T 2I6HA 4MFRA 5JDLA 2BYRA 2V7KA 5C3JA 3CK6A 4IGUA 2ZJUA 3NZQA 4PFOA 5JR9A 4A56A 3RPUA 2VVSA 5DJQC 5FKYA 2WNCA 3P7IA 4O4LE 4U2ZA 2D9DA 3IA3A 3RLFF 2Y57A 4GKKT 3ZDHA 2Y48B 4X20E 1IBKT 2D2SA 2IC9A 3QUJA 5JDHA 2BYNA 2BYSA 2DL1A 1YKHB 1SUMB 4U3CA 3HL6A 3BQKA 5LYJE 4NZBA 4Z90A 3EABA 1IAPA 1HX1B 4I55E 2FJDA 4AKGA 4COFA 4UEMA 1NEKA 1BR2A 1W0AA 5AINA 2V7IA 5L3EB 2V5DA 5HYAA 4EIWA 4HN9A 2FJBA 3D0TA 5AQLB 4ADZA 1R8IA 4JEUB 4YJ2E 3DJBA 2V6XA 3ANWA 2ACZA 2BS2A 2YINA 4ZI2D 4IE4A 3LBXA 2ZM0A 2KINB 3HKCE 1V9DA 3P50A 3PUWF 3RRCA 4PAGA 5JRCB 2H89A 5DABA 2BDEA 2K9AA 1D0XA 1WFDA 5LGTB 4JI2T 2N9DA 3VHLA 2PFVA 3C50A 3F57A 3LBXB 3PUZF 1UW6A 2ZMAA 3ZJ2A 1KEYA 5AQVB 2WDVA 2YDSA 3OTOT 4DV5T 2IW5B 1T7SA 3EDVA 2L3LA 3QC9A 3X1DA 4QX8B 3RI5A 5AQMB 3AVSA 2WCAA 2WQYA 3PUYF 5CA0E 4H9OC 4UVBB 4EXTA 5L47A 5AQIB 2ODUA 3ZKRA 5IUXA 5ETWA 1E2AA 3ZSSA 4LF9T 4TN7B 4H63V 5LBQB 1XNQT 4UM1A 2WZIA 1UGOA 4MBQA 2HN1A 2VQFT 4YLHA 3UU4A 3N9LA 3AA0B 3B57A 3WTNA 1OXZA 4NIQA 2X68A 5AQHB 3ZMSB 3ZJ1A 2RPAA 2V26A 4EZ4A 2XNTA 1OEDC 2JRKA 4GK0E 4MHCA 1UV6A 2DCFA 3OKQA 1L0VA 5AQQB 5LHIB 4O4HE 5HWXA 4H9NC 1D0YA 4IREA 1MNEA 4BAYB 4XHEA 3LSVA 2EHOB 2UXCT 2E9XD 2FBWA 2Y8DA 3AXJA 5JDMA 2X9XA 3U78A 2Y58A 2ZM2A 4Q25A 1LVFA 1XMQT 2X0HA 3UUXB 4CZZB 2NP9A 2WBLA 3R6NA 4YXDA 1HG2A 4X5TA 4YHJA 4K0KT 2OV9A 3GA8A 4AQFC 4UF0A 4HFEA 2XQYA 1Y01A 2BG9A 1X9BA 4AKLA 4ZZBA 3EUHA 4QHOA 3SS1A 4PK4A 4EZHA 4OHFA 3VU7H 1XNRT 5AFNA 1HNWT 5DQVA 3VRAA 5AQOB 3Q5DA 4WW0A 3SFDA 4EB6E 2VKOA 3KV5A 3CKDA 2A9UA 1MIVA 3MK7C 3ZMVB 2KT9A 1VCSA 3FZMB 3T4MA 2M67A 1JNZA 2J1DG 3LK3B 1HFAA 3N5LA 2YU1A 2D5UA 3A7MA 4U7YA 4QH1A 4AIUA 5ABEA 4CN6A 3PUSA 1OEDA 4G63A 5KX5E 1Z0PA 5LG3A 2CRBA 2VK9A 3AXJB 4ZHQE 3C98B 4YY3T 3NKZA 2NW7A 4HWHA 1MMNA 3ZCJA 4BJNA 2QA7A 2H88A 1OEDE 3EI0A 5FY1A 2WM9A 2XQ9A 5SYOA 3RYHE 2XAQB 3WI3A 4QABA 1N33T 3O1IA 3PTRB 5FY0A 4QAAA 2ODVA 4EYUA 4X62T 4DR3T 2LHNA 4DR2T 1XDOA 3SRZA 1J5ET 1UX5A 2Z6EA 1NAFA 2YN6A 3C4XA 5BW2A 2W4XA 1ZEEA 5AQNB 3FXEB 3PU8A 4UR9A 2CWOA 3WTHA 2ES0A 2XTLA 2K3WA 2LSYA 3WTOA 4ZJTA 1FIOA 5CFBA 2LEHA 4L0RA 5EK4A 4DUYT 2WN9A 2NTYA 4A5XA 4P0BA 2PTFA 1US7B 2W61A 3IEEA 4TV9E 4TWDA 2HN2A 2MYSA 4J2CA 3AE8A 3PUAA 3C84A 4ZR6A 3BQLA 1HX8A 4DV0T 4AFGA 2E9XA 2LSJA 4XZCA 4ISSA 2CBJA 3P4RA 2KXPB 5J1GA 3A5XA 4WV9A 2E2AA 3E0ZA 3ZYMA 2WDRA 2XHEB 4CXXA 3VKGA 1HNXT 4YSYA 4B3TT 5CJ5A 5ADXL 4QKNA 1X79A 4QWNB 3SH1A 4OK0A 5AQPB 1D1AA 4KP3C 3H37A 2W2UA 4ZS3A 3HKEE 4QH5A 2UUAT 3QB5A 5KMGP 2X51A 3UQ4A 4WYVA 2CXDA 3U8MA 2EHOC 3IF8B 3UU3A 1UCUA 5JREA 3N9PA 4JUYA 2K5BB 5JDQA 3RIAA 5LGUB 3KVAA 4LFAT 4B5DA 4TZ4C 1NENA 3MA9A 4BQTA 3H3MA 2NR4A 4UF0B 2YOEA 3AA6B 2WSSV 5HXCA 5HXSA 2CPTA 4B6XA 2BS3A 3T1YT 2RA1A 4JI6T 1O3XA 2NTXA 5AQKB 1QUUA 2DI4A 4AKRB 4C90A 1J1JA 5LJMA 4ISTA 4UELA 5A1LA 5JQGE 2VQET 3RIUC 2WU2A 1E1HB 3P4QA 2W63A 4WBOA 3KV4A 1G8XA 1HS7A 2V7MA 3CQGB 3ONJA 5AQGB 2V8SV 1QSDA 2J47A 2AE9A 4HKAA 5AFHA 5JDGA 2KSRA 1MIWA 4ALXA 5LOVE 3RHWA 2Y54A 2J62A 3J9X1 3CVRA 2OA5A 3AE4A 3T1HT 3N2OA 3C64A 5AFJA 2PGZA 2DNXA 1D1BA 4YT0A 4NPPA 4ZEYA 3WAJA 5AFUL 4HWCA 3AEEA 4IDOA 5L3FB 1IJ5A 1HCIA 4CI3B 4OX9T 1WCRA 4IHJE 4DIDB 1UUSA 4NUUA 2WB5A 2YU2A 5HEGA 2JPFA 4PJLA 3RIFA 5FVKA 2MTQA 3KBTA 3P4SA 5LMUT 3AB3B 3Q5EA 4WZXA 1HG5A 4UY2A 3ZMZB 4KX6A 4HQPA 2IDOB 2A2FX 3VKHA 3FZFB 2PJQA 4DV3T 3OJAA 4P0AA 3ZYLA 4YTNA 3TKLB 4CI1B 3ABVA 3VR8A 2BG9C 5FVLA 1T98A 4UV9B 4ZRUA 2LHRA 4KUMB 5JDFA 5JMEA 4IT4A 4HGAA 3AE2A 3JCFA 3FXDB 3UQ7A 1SE7A 4GKJT 3PJAJ 3FZHB 5JR9B 3I9YA 4JEHB 1T8BA 4TX5A 3OPCA 2XQ4A 3EVYA 4A98A 2VKJA 4TUYE 5EK2A 3EAMA 2OLTA 2Y56A 2ZLYA 4HFDA 4JI3T 4UIGA
chains in the Genus database with same CATH topology
3U8MA 3JADA 4HFCA 4QAAA 2BR8A 5KE4A 3UU3A 4ZZCA 4LMKA 2BJ0A 2BG9A 4ZZBA 3SQ6A 2LM2A 4IL9A 5L47A 3U8JA 4UM3A 3ZKRA 2BYPA 5IUXA 5J5IA 3RIAA 3JAFA 2XQ7A 5J5FA 5HEGA 5AFMA 5J5HA 2XYSA 4B5DA 4UM1A 3RIFA 3WTIA 5AFNA 2WNJA 2YN6A 3UUBA 5BP0A 5J0ZA 3TLSA 5BW2A 2MAWA 1OEDB 4HFIA 2BYQA 2XZ6A 3TLWA 5HEJA 4BQTA 4F8HA 3UU4A 2PH9A 3WTHA 4PIRA 2QC1B 3U8KA 4UXUA 3SIOA 2YOEA 3RQUA 3WTJA 4LMJA 4DBMA 3WTOA 4ZJTA 3P50A 4ZK4A 3TLUA 3WTNA 4ILCA 5AFLA 5CFBA 4UY2A 2BG9B 5FJVA 3T4MA 4HQPA 2C9TA 4AFHA 4ZJSA 2BG9E 2WN9A 2YKSA 3EHZA 5J5GA 3PEOA 3P4WA 4QH1A 4QH4A 4FRRA 3IGQA 3WIPA 2BYRA 2XNTA 5AFMB 1UX2A 2ZJUA 3WTKA 1OEDC 4UM3P 4TWDA 5HEOA 1OEDA 2BG9C 2XQ3A 2XQ6A 4XK9A 4TWHA 3UU6A 2W8FA 2XNVA 5LG3A 1UV6A 2YMEA 4TWFA 3C84A 3WTLA 5LXBA 3WTMA 2Y7YA 4ZR6A 5AFKA 5BRXA 5KZUA 4AFGA 2XYTA 5HEUA 3TLTA 1I9BA 1UW6A 2WZYA 2XNUA 4ZRUA 3TLVA 4ILAA 3UU8A 5HEHA 2WNCA 4QACA 4IREA 2XQ8A 5TVCA 3U8LA 2LLYA 4XHEA 4EZ1A 4WV9A 2M6BA 3LSVA 5JMEA 2YMDA 2Y57A 4Z91A 3ZDHA 4ZK1A 5HCMA 2XQAA 2XZ5A 2LKGA 5AFHA 2KSRA 2Y58A 2M6IA 2BYSA 5L4HA 2BYNA 2X00A 4ILBA 3UQ7A 4IL4A 2LKHA 2X00D 4ALXA 4BFQA 3RHWA 2Y54A 2UZ6A 4A97A 4UM3S 3SH1A 3JAEA 4HFBA 4NZBA 3U8NA 4AFTA 2VL0A 4Z90A 4HFHA 3PMZA 4LMLA 1OEDE 3ZDGA 5HCJA 3SQ9A 2XQ4A 2XQ5A 3EI0A 2XQ9A 4A98A 4TNVA 4QH5A 5AFJA 5SYOA 3UU5A 4X5TA 2BR7A 3RQWA 2WNLA 3EAMA 2PGZA 2Y56A 4COFA 3GUAA 2ZJVA 4D01A 4HFDA 4QABA 5CO5A 4NPPA 3C79A 3RI5A 3UQ4A 4TNWA 2W8GA 4HFEA 5AINA 5L4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8M A;  3JAD A;  4HFC A;  4QAA A;  2BR8 A;  5KE4 A;  3UU3 A;  4ZZC A;  4LMK A;  2BJ0 A;  2BG9 A;  4ZZB A;  3SQ6 A;  2LM2 A;  4IL9 A;  5L47 A;  3U8J A;  4UM3 A;  3ZKR A;  2BYP A;  5IUX A;  5J5I A;  3RIA A;  3JAF A;  2XQ7 A;  5J5F A;  5HEG A;  5AFM A;  5J5H A;  2XYS A;  4B5D A;  4UM1 A;  3RIF A;  3WTI A;  5AFN A;  2WNJ A;  2YN6 A;  3UUB A;  5BP0 A;  5J0Z A;  3TLS A;  5BW2 A;  2MAW A;  1OED B;  4HFI A;  2BYQ A;  2XZ6 A;  3TLW A;  5HEJ A;  4BQT A;  4F8H A;  3UU4 A;  2PH9 A;  3WTH A;  4PIR A;  2QC1 B;  3U8K A;  4UXU A;  3SIO A;  2YOE A;  3RQU A;  3WTJ A;  4LMJ A;  4DBM A;  3WTO A;  4ZJT A;  3P50 A;  4ZK4 A;  3TLU A;  3WTN A;  4ILC A;  5AFL A;  5CFB A;  4UY2 A;  2BG9 B;  5FJV A;  3T4M A;  4HQP A;  2C9T A;  4AFH A;  4ZJS A;  2BG9 E;  2WN9 A;  2YKS A;  3EHZ A;  5J5G A;  3PEO A;  3P4W A;  4QH1 A;  4QH4 A;  4FRR A;  3IGQ A;  3WIP A;  2BYR A;  2XNT A;  5AFM B;  1UX2 A;  2ZJU A;  3WTK A;  1OED C;  4UM3 P;  4TWD A;  5HEO A;  1OED A;  2BG9 C;  2XQ3 A;  2XQ6 A;  4XK9 A;  4TWH A;  3UU6 A;  2W8F A;  2XNV A;  5LG3 A;  1UV6 A;  2YME A;  4TWF A;  3C84 A;  3WTL A;  5LXB A;  3WTM A;  2Y7Y A;  4ZR6 A;  5AFK A;  5BRX A;  5KZU A;  4AFG A;  2XYT A;  5HEU A;  3TLT A;  1I9B A;  1UW6 A;  2WZY A;  2XNU A;  4ZRU A;  3TLV A;  4ILA A;  3UU8 A;  5HEH A;  2WNC A;  4QAC A;  4IRE A;  2XQ8 A;  5TVC A;  3U8L A;  2LLY A;  4XHE A;  4EZ1 A;  4WV9 A;  2M6B A;  3LSV A;  5JME A;  2YMD A;  2Y57 A;  4Z91 A;  3ZDH A;  4ZK1 A;  5HCM A;  2XQA A;  2XZ5 A;  2LKG A;  5AFH A;  2KSR A;  2Y58 A;  2M6I A;  2BYS A;  5L4H A;  2BYN A;  2X00 A;  4ILB A;  3UQ7 A;  4IL4 A;  2LKH A;  2X00 D;  4ALX A;  4BFQ A;  3RHW A;  2Y54 A;  2UZ6 A;  4A97 A;  4UM3 S;  3SH1 A;  3JAE A;  4HFB A;  4NZB A;  3U8N A;  4AFT A;  2VL0 A;  4Z90 A;  4HFH A;  3PMZ A;  4LML A;  1OED E;  3ZDG A;  5HCJ A;  3SQ9 A;  2XQ4 A;  2XQ5 A;  3EI0 A;  2XQ9 A;  4A98 A;  4TNV A;  4QH5 A;  5AFJ A;  5SYO A;  3UU5 A;  4X5T A;  2BR7 A;  3RQW A;  2WNL A;  3EAM A;  2PGZ A;  2Y56 A;  4COF A;  3GUA A;  2ZJV A;  4D01 A;  4HFD A;  4QAB A;  5CO5 A;  4NPP A;  3C79 A;  3RI5 A;  3UQ4 A;  4TNW A;  2W8G A;  4HFE A;  5AIN A;  5L4E A; 
#chains in the Genus database with same CATH topology
 5L3D B;  2BR8 A;  3ZEF B;  1Z8U A;  2P9B A;  2LSK A;  3MJX A;  2KND A;  3JAF A;  3K3Q C;  2JJ9 A;  3AE5 A;  2ZM8 A;  3RKG A;  3V5S A;  3AE3 A;  1OED B;  4HFI A;  4ERR A;  2E8I A;  3AEB A;  3UTK A;  5LGN B;  3ETV A;  3RX6 A;  2BKN A;  3TLU A;  5HXH A;  3N9N A;  4WNK A;  2CM0 A;  4EED A;  4JI1 T;  5H6R B;  4U74 A;  3IHR A;  5LG4 A;  3BQI A;  3EHZ A;  3L09 A;  2WAU A;  4QH4 A;  5JTG A;  4PJM A;  3UUM A;  2BBH A;  4KHZ F;  4IE0 A;  3RYI E;  4TWH A;  2X0Y A;  5LXB A;  3GWH A;  3WTL A;  5BRX A;  4V1A v;  4ILA A;  2Q9Q C;  3HR0 A;  5HEH A;  1EZ3 A;  5TVC A;  2XQ8 A;  3CX7 B;  5LMN T;  4EZ1 A;  5ABG A;  2WY2 A;  4ZK1 A;  4X1Y E;  3R84 B;  5L2L A;  2LKG A;  1AJ3 A;  4BFQ A;  1FEW A;  1KNP A;  3AED A;  1N36 T;  4X66 T;  2VL0 A;  2WWU A;  3N2K E;  2YEV C;  5AQF B;  5LA6 E;  3FBL A;  2W67 A;  1HNZ T;  3RQW A;  2ZJV A;  4D01 A;  3ZYK A;  2WDQ A;  4GK5 E;  2JMH A;  2HH7 A;  4MLK A;  1IBL T;  1BR0 A;  3CQC B;  3L3P A;  4I50 E;  4C91 A;  4YJ3 E;  3AE6 A;  3ANW B;  5FNV E;  4EEB A;  2LE8 A;  4AKI A;  2XY8 B;  2X9W A;  2X66 A;  3ONL C;  4P09 A;  2IC6 A;  3SOL A;  3B13 A;  5AFM A;  5LXT E;  4GYR A;  5AQR B;  2UXX B;  2UXD T;  1YD8 G;  3CX6 B;  2XM1 A;  1XWM A;  4XAX B;  3SIO A;  3NWI A;  3CWZ B;  4GYS A;  2W0G A;  2JMK A;  5AFL A;  3RH3 A;  3LG7 A;  4YSZ A;  5LHG B;  5IWA T;  4JI4 T;  2N2N A;  2IHR 1;  5J5G A;  2JQK A;  1WRD A;  2B1E A;  3J7Y q;  2VKD A;  1W09 A;  2CCQ A;  4IE6 A;  2XQ3 A;  4X65 T;  3AA7 B;  5AFK A;  1SHZ C;  3TLT A;  2XNU A;  4GOU A;  2CEA A;  4LF6 T;  4UV8 B;  3RGL A;  1KF6 A;  4AXP A;  4G2A A;  3Q5W A;  4Z91 A;  1HF8 A;  3T8O A;  3CML A;  3AE9 A;  1CUN A;  5FYM A;  3VR9 A;  1MMA A;  4PJN A;  4CN4 A;  2ZM6 T;  4ANJ A;  4E7Z A;  2IML A;  2BKP A;  5H6Q B;  5L4E A;  4HFC A;  2W66 A;  4ZZC A;  1FMW A;  4DVD A;  5JR9 C;  4B3M T;  3NVO A;  3RKO A;  4UM3 A;  4DV2 T;  3Q2M A;  5JDN A;  4L9I A;  3ZPO A;  1ZV4 X;  3TLW A;  4DO0 A;  4F8H A;  5LNK A;  3ZT7 A;  4QXC B;  5FXX A;  4N78 D;  3RQU A;  4U2Y A;  1YQ3 A;  4U33 A;  2FJA A;  5C8Y E;  2N1G A;  2K24 A;  5FY7 A;  4FRR A;  3IGQ A;  2XZE A;  4OYK A;  4NXN T;  4O4J E;  4YSX A;  4TWF A;  2XAJ B;  1GQE A;  2BS4 A;  4X64 T;  2KZ7 B;  3RIU A;  1ZP0 A;  1ZHC A;  3N9Q A;  2YMD A;  3OBV E;  5HCM A;  2Y6X A;  4DR4 T;  5FXZ A;  2IUB A;  3CQX C;  2M6I A;  3F31 A;  2V1D B;  2V6Y B;  1ZOY A;  2UZ6 A;  3ZN1 B;  4UM3 S;  4Z8X A;  2A72 A;  4YTM A;  2Q9Q B;  4HTE A;  1YW0 A;  3C51 A;  4HWF A;  3UU5 A;  4YTP A;  2Q9Q D;  5F3J A;  2LM9 A;  4TNW A;  1WYB A;  1WYC A;  2CXF A;  4IL9 A;  2RP4 A;  4ZI7 E;  2J4G A;  4JI5 T;  1NWM X;  4EV6 A;  2B76 A;  2WNJ A;  4IE5 A;  4H63 H;  2K48 A;  1HTJ F;  2BYQ A;  5KXJ A;  2C5K T;  3KVB A;  2PH9 A;  3MXZ A;  2CHN A;  3ETU A;  4CN1 A;  2VL8 A;  3NRY A;  4DND A;  4P1N A;  4AIS A;  3BK9 A;  4DMV A;  3GMI A;  3JC6 D;  5AFM B;  4K0U A;  2V7L A;  1BR1 A;  5AQT B;  3U3I A;  2X9H A;  2D0T A;  4IDN A;  4XK9 A;  2XNV A;  1MMG A;  4X1I E;  1BR4 A;  1HR0 T;  1SA0 E;  2HPL A;  5LB7 B;  3LFM A;  5HEU A;  2WZY A;  5J2U E;  2SPC A;  4DV4 T;  4AQY T;  3C4Z A;  3KFW X;  3AA1 B;  4M1P A;  2VAS A;  2V6Y A;  2XZ5 A;  4JYA T;  2YDQ A;  4FI5 A;  3NRX A;  4ILB A;  3EDU A;  5HXE A;  3P4P A;  2BBJ A;  1LKX A;  2F4V T;  3ZLI A;  3FBZ A;  4HFB A;  3B5M A;  4H9S E;  2CHO A;  3FHN A;  1IBM T;  2BVL A;  4F6R C;  4LF4 T;  1W9R A;  3AE1 A;  2W8G A;  3JAD A;  4AKH A;  1U4Q A;  5FL1 A;  2BJ0 A;  2GK9 A;  3LK2 B;  3Q5X A;  3M3Z B;  4PJJ A;  5HWY A;  2XQ7 A;  1D0Z A;  4QX7 B;  2PBI A;  3UFE A;  3QK6 A;  2MAW A;  4TV8 E;  2E5V A;  3AAA B;  3AEG A;  2A3D A;  3O1J A;  4PIR A;  4DV1 T;  1XDP A;  2LJL A;  1XMO T;  4OYJ A;  3ZST A;  5JVD E;  3S4U A;  4UVA B;  2VB6 A;  4AQG A;  1E7P A;  4CXW A;  1N32 T;  3RYC E;  2CMR A;  3WIP A;  3P8C D;  2R6G F;  4WBN E;  4LFC T;  3HI2 A;  1WR0 A;  4H9P C;  3UU6 A;  4NUV A;  3I0Q A;  5L3B B;  3OVU A;  2BZB A;  4I0U A;  2LLY A;  2LOS A;  3QB5 K;  3H3A A;  2NOX A;  5EZY E;  5IHY A;  3PJA A;  3PUG A;  1LRZ A;  2JQQ A;  4IDQ A;  4H9R C;  2QRX A;  4DR7 T;  3MKD A;  4E7S A;  4HWD A;  3I0O A;  5TAO A;  4BA9 A;  4AFT A;  3KBU A;  2MOZ A;  3PUX F;  3ZCI A;  3ZC1 A;  1D1C A;  2IAK A;  4BJM A;  3ZDG A;  4ASK A;  3GN5 B;  1UK5 A;  2C0S A;  4ZXL A;  2BR7 A;  2WP9 A;  2BKO A;  2XSB A;  1JNR A;  3GUA A;  3C79 A;  2DHR A;  3QNU A;  4ZS2 A;  5CA1 E;  5J2T E;  2QYW A;  2FUP A;  4IDZ A;  2XSA A;  1KNZ A;  5IYZ E;  1LVK A;  1VOM A;  3DTO A;  4DR1 T;  3FZK B;  5ABH A;  4CI2 B;  1VCT A;  3MZK B;  2X67 A;  3JC6 C;  3PUV F;  5FXV A;  5LP6 E;  4JI8 T;  5CB4 E;  1W0B A;  4KHP T;  4JBW F;  5HEJ A;  2WMO A;  2QC1 B;  2I59 A;  3W15 B;  4LMJ A;  4ZK4 A;  1UX4 A;  3PU3 A;  2UXB T;  3UFG A;  2WWV A;  3RF1 A;  4LF7 T;  4AFH A;  3O4X E;  2MBG A;  4ZJS A;  2H3R A;  5C2T A;  1ZKE A;  2ACX A;  3I1A A;  3AEC A;  4EOZ B;  2QGS A;  1UX2 A;  3WTK A;  1U5P A;  2EHO D;  2LSG A;  3I9W A;  2W8F A;  3O1H A;  2YME A;  3ONX A;  3TLV A;  4QAC A;  3ESL A;  3KDS E;  1Y64 B;  4DV7 T;  2H7V C;  2UXN B;  4DV6 T;  5AQU B;  2JQH A;  3PUQ A;  1I94 T;  2X00 A;  5M4Y A;  4LF5 T;  4HWI B;  1CHU A;  3U8N A;  3FB2 A;  2X0L B;  3UT5 E;  4CXY A;  2WNL A;  3RRW A;  2KMF A;  1YQ4 A;  3N9M A;  3ZMT B;  5LHH B;  4DR6 T;  4AQF A;  2IIU A;  3PDY A;  1B7T A;  3SQ6 A;  2WU5 A;  3SWH A;  3OYZ A;  4IIJ E;  2BVM A;  3UUN A;  4JLE A;  3PUR A;  2HPJ A;  1N34 T;  2XM2 A;  4O8S A;  2E9X C;  3HKD E;  3TLS A;  2CXL A;  3VRB A;  2XUE A;  4UXU A;  2C5J A;  4H9Q C;  5ABF A;  2FJE A;  5AQJ B;  3KIN B;  3OYX A;  1T72 A;  3PEO A;  4JI0 T;  3LK4 2;  3N9O A;  1S35 A;  2CLY C;  5FP3 A;  2KLQ A;  3V5U A;  5L3C B;  4ZI2 C;  3K3O A;  3WTM A;  4QXH B;  3ZN0 B;  5KZU A;  2EHO A;  2XYT A;  4ZI3 D;  1H7C A;  3KV6 A;  3U8L A;  1KK7 A;  2M6B A;  3SFE A;  2XAF B;  4KMC A;  1J5W A;  4HE8 A;  1KFY A;  4KBM B;  3WAK A;  5L4H A;  2KWI B;  2LKH A;  3K1S A;  4HFH A;  2XAG B;  4JV5 T;  3UUL A;  5HCJ A;  2XPK A;  3SQ9 A;  2XQ5 A;  2KWH A;  4AI6 A;  2XAH B;  5CO5 A;  2QVA A;  2HHH T;  4B3S T;  4HEA A;  4LFB T;  4YFS A;  5KE4 A;  5EK3 A;  1QLB A;  2LM2 A;  3U8J A;  2X9Y A;  4O2B E;  2BYP A;  5J5F A;  2LRL A;  3PV0 F;  5J0Z A;  4U31 A;  3GN5 A;  5HXR A;  4DUZ T;  5ABF B;  2PG8 A;  3NZP A;  3N2G E;  3NBX X;  5AQS B;  3WTJ A;  5L3G B;  5HAX A;  4YHH T;  3ZC0 A;  2XAS B;  4ILU A;  2BG9 E;  5F5W A;  3P4W A;  3F2E A;  3FZL B;  4XBF B;  4NXM T;  2DLR A;  2I0M A;  2D0U A;  3HKB E;  3LJC A;  4PFP A;  2C5I T;  4PK5 A;  2XQ6 A;  3RC8 A;  3CX8 B;  2E5L T;  3QOF A;  5DQW A;  1I9B A;  1VRB A;  4IDP A;  2VUR A;  4EAH A;  4PNI A;  2LRK A;  2DWK A;  2YDR A;  2L9Q A;  3G06 A;  2NW9 A;  3AAE B;  1UUR A;  4IL4 A;  2WMN A;  3MAC A;  5LJN A;  1FJG T;  1KNR A;  3A8Y C;  3JAE A;  4ZOL E;  2WZH A;  1M7K A;  5LBM A;  4LML A;  5E0O A;  1I6Z A;  4UXN B;  4DMW A;  2L8K A;  2WS3 A;  5FMN A;  1WR6 A;  5F8P A;  2CWY A;  4ZI3 C;  2LOP A;  2CLY B;  5KDM C;  3IBP A;  5JRC A;  2LT3 A;  4QXB B;  4B3R T;  4U7I A;  4GIW A;  1MND A;  4DR5 T;  5J5H A;  2XYS A;  5BMV E;  5BP0 A;  3C4W A;  3ZMU B;  4PK6 A;  2UUC T;  4L5G A;  3LDQ B;  3K3N A;  4IE7 A;  4DBM A;  2CA5 A;  2JIW A;  4U72 A;  4O4I E;  4ILC A;  4DBR A;  2XJ7 A;  2G0U A;  1WLX A;  3AVR A;  2BG9 B;  5FJV A;  3RC3 A;  3ZT6 A;  1IJ6 A;  3O9X A;  3RYF E;  4CQI A;  4EYY R;  1IZN B;  1YKE B;  3AEF A;  4UM3 P;  4FJO A;  5HEO A;  2E9X B;  1MIY A;  2UU9 T;  1G73 A;  3AEA A;  3L8R A;  4HFV A;  2VWA A;  2V7J A;  2Y7Y A;  1YXR A;  3UU8 A;  3CPZ A;  2JQ9 A;  5LCY A;  1DU2 A;  3AAI A;  3PE0 A;  2V5C A;  2XQA A;  5FL0 A;  2UUB T;  2X00 D;  2VKH A;  2CBI A;  2LSI A;  4A97 A;  2W62 A;  3L39 A;  2DWG A;  4OFZ A;  3PMZ A;  3E22 E;  3E08 A;  4TNV A;  1S94 A;  3DP7 A;  4EGW A;  1M62 A;  4I4T E;  4LMK A;  2CE7 A;  4O2A E;  4MAL A;  1OWA A;  4KI0 F;  3K8P C;  3AE7 A;  4LF8 T;  5J5I A;  3KV9 A;  1MMD A;  3ZT5 A;  2VVN A;  2NWB A;  3M65 A;  3WTI A;  2AXD S;  2Q9Q A;  3UUB A;  5JH7 E;  2XZ6 A;  5FXW A;  2YK0 A;  1FMV A;  3U8K A;  4UVC B;  2NW8 A;  4X1K E;  2W00 A;  5CGM A;  2MPK A;  4PW8 A;  2H7O A;  1XZY A;  3HA4 A;  4JI7 T;  3Q9D A;  4I43 B;  5GON E;  3CIR A;  4DBQ A;  2C9T A;  2YKS A;  5BR8 T;  2I6H A;  4MFR A;  5JDL A;  2BYR A;  2V7K A;  5C3J A;  3CK6 A;  4IGU A;  2ZJU A;  3NZQ A;  4PFO A;  5JR9 A;  4A56 A;  3RPU A;  2VVS A;  5DJQ C;  5FKY A;  2WNC A;  3P7I A;  4O4L E;  4U2Z A;  2D9D A;  3IA3 A;  3RLF F;  2Y57 A;  4GKK T;  3ZDH A;  2Y48 B;  4X20 E;  1IBK T;  2D2S A;  2IC9 A;  3QUJ A;  5JDH A;  2BYN A;  2BYS A;  2DL1 A;  1YKH B;  1SUM B;  4U3C A;  3HL6 A;  3BQK A;  5LYJ E;  4NZB A;  4Z90 A;  3EAB A;  1IAP A;  1HX1 B;  4I55 E;  2FJD A;  4AKG A;  4COF A;  4UEM A;  1NEK A;  1BR2 A;  1W0A A;  5AIN A;  2V7I A;  5L3E B;  2V5D A;  5HYA A;  4EIW A;  4HN9 A;  2FJB A;  3D0T A;  5AQL B;  4ADZ A;  1R8I A;  4JEU B;  4YJ2 E;  3DJB A;  2V6X A;  3ANW A;  2ACZ A;  2BS2 A;  2YIN A;  4ZI2 D;  4IE4 A;  3LBX A;  2ZM0 A;  2KIN B;  3HKC E;  1V9D A;  3P50 A;  3PUW F;  3RRC A;  4PAG A;  5JRC B;  2H89 A;  5DAB A;  2BDE A;  2K9A A;  1D0X A;  1WFD A;  5LGT B;  4JI2 T;  2N9D A;  3VHL A;  2PFV A;  3C50 A;  3F57 A;  3LBX B;  3PUZ F;  1UW6 A;  2ZMA A;  3ZJ2 A;  1KEY A;  5AQV B;  2WDV A;  2YDS A;  3OTO T;  4DV5 T;  2IW5 B;  1T7S A;  3EDV A;  2L3L A;  3QC9 A;  3X1D A;  4QX8 B;  3RI5 A;  5AQM B;  3AVS A;  2WCA A;  2WQY A;  3PUY F;  5CA0 E;  4H9O C;  4UVB B;  4EXT A;  5L47 A;  5AQI B;  2ODU A;  3ZKR A;  5IUX A;  5ETW A;  1E2A A;  3ZSS A;  4LF9 T;  4TN7 B;  4H63 V;  5LBQ B;  1XNQ T;  4UM1 A;  2WZI A;  1UGO A;  4MBQ A;  2HN1 A;  2VQF T;  4YLH A;  3UU4 A;  3N9L A;  3AA0 B;  3B57 A;  3WTN A;  1OXZ A;  4NIQ A;  2X68 A;  5AQH B;  3ZMS B;  3ZJ1 A;  2RPA A;  2V26 A;  4EZ4 A;  2XNT A;  1OED C;  2JRK A;  4GK0 E;  4MHC A;  1UV6 A;  2DCF A;  3OKQ A;  1L0V A;  5AQQ B;  5LHI B;  4O4H E;  5HWX A;  4H9N C;  1D0Y A;  4IRE A;  1MNE A;  4BAY B;  4XHE A;  3LSV A;  2EHO B;  2UXC T;  2E9X D;  2FBW A;  2Y8D A;  3AXJ A;  5JDM A;  2X9X A;  3U78 A;  2Y58 A;  2ZM2 A;  4Q25 A;  1LVF A;  1XMQ T;  2X0H A;  3UUX B;  4CZZ B;  2NP9 A;  2WBL A;  3R6N A;  4YXD A;  1HG2 A;  4X5T A;  4YHJ A;  4K0K T;  2OV9 A;  3GA8 A;  4AQF C;  4UF0 A;  4HFE A;  2XQY A;  1Y01 A;  2BG9 A;  1X9B A;  4AKL A;  4ZZB A;  3EUH A;  4QHO A;  3SS1 A;  4PK4 A;  4EZH A;  4OHF A;  3VU7 H;  1XNR T;  5AFN A;  1HNW T;  5DQV A;  3VRA A;  5AQO B;  3Q5D A;  4WW0 A;  3SFD A;  4EB6 E;  2VKO A;  3KV5 A;  3CKD A;  2A9U A;  1MIV A;  3MK7 C;  3ZMV B;  2KT9 A;  1VCS A;  3FZM B;  3T4M A;  2M67 A;  1JNZ A;  2J1D G;  3LK3 B;  1HFA A;  3N5L A;  2YU1 A;  2D5U A;  3A7M A;  4U7Y A;  4QH1 A;  4AIU A;  5ABE A;  4CN6 A;  3PUS A;  1OED A;  4G63 A;  5KX5 E;  1Z0P A;  5LG3 A;  2CRB A;  2VK9 A;  3AXJ B;  4ZHQ E;  3C98 B;  4YY3 T;  3NKZ A;  2NW7 A;  4HWH A;  1MMN A;  3ZCJ A;  4BJN A;  2QA7 A;  2H88 A;  1OED E;  3EI0 A;  5FY1 A;  2WM9 A;  2XQ9 A;  5SYO A;  3RYH E;  2XAQ B;  3WI3 A;  4QAB A;  1N33 T;  3O1I A;  3PTR B;  5FY0 A;  4QAA A;  2ODV A;  4EYU A;  4X62 T;  4DR3 T;  2LHN A;  4DR2 T;  1XDO A;  3SRZ A;  1J5E T;  1UX5 A;  2Z6E A;  1NAF A;  2YN6 A;  3C4X A;  5BW2 A;  2W4X A;  1ZEE A;  5AQN B;  3FXE B;  3PU8 A;  4UR9 A;  2CWO A;  3WTH A;  2ES0 A;  2XTL A;  2K3W A;  2LSY A;  3WTO A;  4ZJT A;  1FIO A;  5CFB A;  2LEH A;  4L0R A;  5EK4 A;  4DUY T;  2WN9 A;  2NTY A;  4A5X A;  4P0B A;  2PTF A;  1US7 B;  2W61 A;  3IEE A;  4TV9 E;  4TWD A;  2HN2 A;  2MYS A;  4J2C A;  3AE8 A;  3PUA A;  3C84 A;  4ZR6 A;  3BQL A;  1HX8 A;  4DV0 T;  4AFG A;  2E9X A;  2LSJ A;  4XZC A;  4ISS A;  2CBJ A;  3P4R A;  2KXP B;  5J1G A;  3A5X A;  4WV9 A;  2E2A A;  3E0Z A;  3ZYM A;  2WDR A;  2XHE B;  4CXX A;  3VKG A;  1HNX T;  4YSY A;  4B3T T;  5CJ5 A;  5ADX L;  4QKN A;  1X79 A;  4QWN B;  3SH1 A;  4OK0 A;  5AQP B;  1D1A A;  4KP3 C;  3H37 A;  2W2U A;  4ZS3 A;  3HKE E;  4QH5 A;  2UUA T;  3QB5 A;  5KMG P;  2X51 A;  3UQ4 A;  4WYV A;  2CXD A;  3U8M A;  2EHO C;  3IF8 B;  3UU3 A;  1UCU A;  5JRE A;  3N9P A;  4JUY A;  2K5B B;  5JDQ A;  3RIA A;  5LGU B;  3KVA A;  4LFA T;  4B5D A;  4TZ4 C;  1NEN A;  3MA9 A;  4BQT A;  3H3M A;  2NR4 A;  4UF0 B;  2YOE A;  3AA6 B;  2WSS V;  5HXC A;  5HXS A;  2CPT A;  4B6X A;  2BS3 A;  3T1Y T;  2RA1 A;  4JI6 T;  1O3X A;  2NTX A;  5AQK B;  1QUU A;  2DI4 A;  4AKR B;  4C90 A;  1J1J A;  5LJM A;  4IST A;  4UEL A;  5A1L A;  5JQG E;  2VQE T;  3RIU C;  2WU2 A;  1E1H B;  3P4Q A;  2W63 A;  4WBO A;  3KV4 A;  1G8X A;  1HS7 A;  2V7M A;  3CQG B;  3ONJ A;  5AQG B;  2V8S V;  1QSD A;  2J47 A;  2AE9 A;  4HKA A;  5AFH A;  5JDG A;  2KSR A;  1MIW A;  4ALX A;  5LOV E;  3RHW A;  2Y54 A;  2J62 A;  3J9X 1;  3CVR A;  2OA5 A;  3AE4 A;  3T1H T;  3N2O A;  3C64 A;  5AFJ A;  2PGZ A;  2DNX A;  1D1B A;  4YT0 A;  4NPP A;  4ZEY A;  3WAJ A;  5AFU L;  4HWC A;  3AEE A;  4IDO A;  5L3F B;  1IJ5 A;  1HCI A;  4CI3 B;  4OX9 T;  1WCR A;  4IHJ E;  4DID B;  1UUS A;  4NUU A;  2WB5 A;  2YU2 A;  5HEG A;  2JPF A;  4PJL A;  3RIF A;  5FVK A;  2MTQ A;  3KBT A;  3P4S A;  5LMU T;  3AB3 B;  3Q5E A;  4WZX A;  1HG5 A;  4UY2 A;  3ZMZ B;  4KX6 A;  4HQP A;  2IDO B;  2A2F X;  3VKH A;  3FZF B;  2PJQ A;  4DV3 T;  3OJA A;  4P0A A;  3ZYL A;  4YTN A;  3TKL B;  4CI1 B;  3ABV A;  3VR8 A;  2BG9 C;  5FVL A;  1T98 A;  4UV9 B;  4ZRU A;  2LHR A;  4KUM B;  5JDF A;  5JME A;  4IT4 A;  4HGA A;  3AE2 A;  3JCF A;  3FXD B;  3UQ7 A;  1SE7 A;  4GKJ T;  3PJA J;  3FZH B;  5JR9 B;  3I9Y A;  4JEH B;  1T8B A;  4TX5 A;  3OPC A;  2XQ4 A;  3EVY A;  4A98 A;  2VKJ A;  4TUY E;  5EK2 A;  3EAM A;  2OLT A;  2Y56 A;  2ZLY A;  4HFD A;  4JI3 T;  4UIG A; 
#chains in the Genus database with same CATH homology
 3U8M A;  3JAD A;  4HFC A;  4QAA A;  2BR8 A;  5KE4 A;  3UU3 A;  4ZZC A;  4LMK A;  2BJ0 A;  2BG9 A;  4ZZB A;  3SQ6 A;  2LM2 A;  4IL9 A;  5L47 A;  3U8J A;  4UM3 A;  3ZKR A;  2BYP A;  5IUX A;  5J5I A;  3RIA A;  3JAF A;  2XQ7 A;  5J5F A;  5HEG A;  5AFM A;  5J5H A;  2XYS A;  4B5D A;  4UM1 A;  3RIF A;  3WTI A;  5AFN A;  2WNJ A;  2YN6 A;  3UUB A;  5BP0 A;  5J0Z A;  3TLS A;  5BW2 A;  2MAW A;  1OED B;  4HFI A;  2BYQ A;  2XZ6 A;  3TLW A;  5HEJ A;  4BQT A;  4F8H A;  3UU4 A;  2PH9 A;  3WTH A;  4PIR A;  2QC1 B;  3U8K A;  4UXU A;  3SIO A;  2YOE A;  3RQU A;  3WTJ A;  4LMJ A;  4DBM A;  3WTO A;  4ZJT A;  3P50 A;  4ZK4 A;  3TLU A;  3WTN A;  4ILC A;  5AFL A;  5CFB A;  4UY2 A;  2BG9 B;  5FJV A;  3T4M A;  4HQP A;  2C9T A;  4AFH A;  4ZJS A;  2BG9 E;  2WN9 A;  2YKS A;  3EHZ A;  5J5G A;  3PEO A;  3P4W A;  4QH1 A;  4QH4 A;  4FRR A;  3IGQ A;  3WIP A;  2BYR A;  2XNT A;  5AFM B;  1UX2 A;  2ZJU A;  3WTK A;  1OED C;  4UM3 P;  4TWD A;  5HEO A;  1OED A;  2BG9 C;  2XQ3 A;  2XQ6 A;  4XK9 A;  4TWH A;  3UU6 A;  2W8F A;  2XNV A;  5LG3 A;  1UV6 A;  2YME A;  4TWF A;  3C84 A;  3WTL A;  5LXB A;  3WTM A;  2Y7Y A;  4ZR6 A;  5AFK A;  5BRX A;  5KZU A;  4AFG A;  2XYT A;  5HEU A;  3TLT A;  1I9B A;  1UW6 A;  2WZY A;  2XNU A;  4ZRU A;  3TLV A;  4ILA A;  3UU8 A;  5HEH A;  2WNC A;  4QAC A;  4IRE A;  2XQ8 A;  5TVC A;  3U8L A;  2LLY A;  4XHE A;  4EZ1 A;  4WV9 A;  2M6B A;  3LSV A;  5JME A;  2YMD A;  2Y57 A;  4Z91 A;  3ZDH A;  4ZK1 A;  5HCM A;  2XQA A;  2XZ5 A;  2LKG A;  5AFH A;  2KSR A;  2Y58 A;  2M6I A;  2BYS A;  5L4H A;  2BYN A;  2X00 A;  4ILB A;  3UQ7 A;  4IL4 A;  2LKH A;  2X00 D;  4ALX A;  4BFQ A;  3RHW A;  2Y54 A;  2UZ6 A;  4A97 A;  4UM3 S;  3SH1 A;  3JAE A;  4HFB A;  4NZB A;  3U8N A;  4AFT A;  2VL0 A;  4Z90 A;  4HFH A;  3PMZ A;  4LML A;  1OED E;  3ZDG A;  5HCJ A;  3SQ9 A;  2XQ4 A;  2XQ5 A;  3EI0 A;  2XQ9 A;  4A98 A;  4TNV A;  4QH5 A;  5AFJ A;  5SYO A;  3UU5 A;  4X5T A;  2BR7 A;  3RQW A;  2WNL A;  3EAM A;  2PGZ A;  2Y56 A;  4COF A;  3GUA A;  2ZJV A;  4D01 A;  4HFD A;  4QAB A;  5CO5 A;  4NPP A;  3C79 A;  3RI5 A;  3UQ4 A;  4TNW A;  2W8G A;  4HFE A;  5AIN A;  5L4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...