3TLVA

The glic pentameric ligand-gated ion channel loop2-22' oxidized mutant in a locally-closed conformation (lc3 subtype)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 94
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tlvA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tlvA01
5J5GA 2C9TA 4ZZCA 4TWHA 1OEDE 2W8GA 4HFCA 3UQ4A 2BYSA 4Z91A 5CO5A 2XZ5A 5TVCA 3WIPA 3TLUA 2BG9C 3UUBA 4DBMA 3RHWA 3GUAA 5L47A 4ZK1A 3EHZA 2XNVA 3UU6A 1UV6A 3WTKA 5HCMA 5HEGA 3RQUA 3WTMA 4HFIA 5AFKA 2BG9A 4IL4A 2QC1B 1OEDB 4UM3A 3WTHA 5AFMA 5J5FA 4ZZBA 2XQ4A 2YMDA 5L4HA 3U8KA 3WTJA 2BG9E 4X5TA 4IREA 2LM2A 2XYSA 3ZKRA 3SQ6A 3SIOA 2MAWA 3RQWA 5HEOA 2XYTA 3ZDHA 4ZRUA 3U8NA 3SH1A 2UZ6A 4AFGA 4BFQA 5AFNA 2Y7YA 2XQ3A 4D01A 2M6BA 3JAFA 4UM3P 2LKGA 2XQ9A 5HCJA 2WNJA 5AFMB 4ZJSA 1I9BA 2YOEA 3UQ7A 2PGZA 3RI5A 2W8FA 3U8LA 5AFLA 5J5HA 3RIAA 4UM1A 2Y58A 3WTIA 2LKHA 3TLTA 2XQ7A 3PEOA 2PH9A 3C84A 3UU5A 5J0ZA 4XHEA 4QH4A 2X00D 1UW6A 4B5DA 4TNVA 2BR8A 2ZJUA 3IGQA 5BP0A 5CFBA 4HQPA 2KSRA 5BRXA 4QABA 3TLVA 5LG3A 4ZJTA 2XQ6A 3T4MA 2BJ0A 3UU3A 4NPPA 4HFDA 2XZ6A 4UY2A 5AFJA 5KE4A 5IUXA 3RIFA 5HEUA 4TWFA 4WV9A 2BG9B 2XNTA 4ILAA 4F8HA 2BYRA 2BYQA 2XQ8A 3EI0A 4TNWA 4NZBA 3P4WA 4ZR6A 4HFBA 3C79A 2BR7A 4XK9A 5AFHA 4HFEA 4QACA 3WTNA 4FRRA 2Y57A 4PIRA 3JADA 2XQAA 2YN6A 4BQTA 5FJVA 3P50A 4IL9A 2M6IA 5HEJA 4ILBA 3TLWA 2WN9A 3PMZA 2BYNA 4UM3S 3WTLA 5KZUA 4EZ1A 2WNLA 5LXBA 2X00A 2XQ5A 4AFTA 2WZYA 4UXUA 4QAAA 5AINA 3JAEA 2YKSA 3U8JA 4COFA 2Y56A 2VL0A 3TLSA 5HEHA 4A98A 5L4EA 3EAMA 3UU4A 2ZJVA 3SQ9A 2LLYA 3UU8A 2Y54A 5SYOA 4AFHA 1OEDC 2BYPA 4HFHA 4LMLA 4LMKA 4A97A 4ZK4A 3U8MA 4QH5A 3ZDGA 3LSVA 4ILCA 1OEDA 4TWDA 2XNUA 5JMEA 4LMJA 4QH1A 2WNCA 3WTOA 4ALXA 5J5IA 2YMEA 5BW2A 4Z90A 1UX2A
chains in the Genus database with same CATH superfamily
5KXJA 1OWAA 5JR9B 2VKJA 4QKNA 3RPUA 3UU6A 2X66A 4UIGA 2K3WA 2MPKA 1YXRA 3N9LA 3AE4A 3SFEA 3FZMB 5AFMA 3W15B 4NIQA 4U31A 2BKNA 2YEVC 4X5TA 4U72A 3N9QA 4BJMA 3SQ6A 5HEOA 5LHHB 2ZLYA 2H7OA 2LSKA 1T8BA 3R84B 2XASB 3PU8A 4O4LE 5LB7B 4UELA 4YHJA 4X20E 1KNZA 2PGZA 2CLYC 5JDQA 2DHRA 5FNVE 2PH9A 1O3XA 3FXDB 3IF8B 3X1DA 5ETWA 2VASA 3PV0F 3KVBA 1D0XA 5LHGB 2JQQA 4XZCA 1CHUA 4L9IA 3P4WA 5FMNA 4IE0A 2K48A 1V9DA 2BVMA 3ZLIA 4JEUB 1HG5A 3O1HA 1UX4A 5C2TA 3RKOA 3ESLA 2F4VT 5JR9A 4IDNA 5L4EA 3MA9A 1VCSA 2XSAA 4P1NA 1IJ5A 3ONJA 5LMNT 4LMKA 2VL8A 3JCFA 2JQ9A 1HTJF 1B7TA 4QH1A 5EK3A 1KEYA 3P4RA 4AKHA 4TZ4C 5BW2A 5JDFA 2CM0A 4HFCA 2IIUA 3QK6A 4H9SE 2V7LA 3P7IA 3RGLA 2CBJA 5CGMA 2CRBA 2WAUA 5FXXA 3PUYF 4YHHT 5DJQC 2UZ6A 4B3RT 4GYSA 5AFNA 4ZI7E 1QSDA 5HCJA 2WNJA 4EZHA 4BA9A 2FBWA 3P8CD 2Y6XA 5AFLA 2WSSV 2BVLA 4UV9B 2KZ7B 4KP3C 4XHEA 1OXZA 5EK2A 1NAFA 2LT3A 3Q5XA 5IWAT 2LSYA 2KWIB 5F8PA 4TWFA 4BAYB 2BR7A 5JDMA 3FHNA 2M6IA 2J4GA 1NWMX 2WU5A 3ZYMA 1Z8UA 3CPZA 1LVFA 2WNLA 2X0YA 4P09A 3JAEA 5EZYE 4K0KT 3KDSE 2EHOD 3EUHA 5SYOA 2CLYB 4QH5A 2H7VC 3RYCE 3LSVA 4TWDA 5J2TE 2WNCA 3KBUA 2VURA 1E1HB 5JRCB 2D0TA 3DP7A 4HWHA 2DCFA 5LYJE 3UULA 2VKOA 1NENA 3C51A 5HCMA 2WDRA 3WAKA 2XAQB 4PFOA 3CQGB 1MNDA 2AE9A 3CK6A 2PJQA 2CXDA 1E7PA 2XYTA 4X66T 4X1KE 4TUYE 3F57A 4PAGA 1YQ4A 2L9QA 4DUYT 5FXWA 2JMKA 3TLTA 1KNRA 1H7CA 5DQVA 3NBXX 3C84A 2ZJUA 5BRXA 3MKDA 2LHRA 3LK3B 4AIUA 4NXNT 2J62A 2BBJA 5GONE 2XNTA 3JC6D 4ILAA 3EI0A 3OJAA 4JI7T 4UVAB 5L2LA 4WZXA 2X51A 4BQTA 3L39A 2BYNA 1HCIA 1NEKA 2DI4A 5JDHA 3CWZB 2B1EA 2M67A 4UXUA 3PE0A 1D0ZA 1YKEB 3C64A 5AQOB 5JRCA 3A8YC 2RP4A 4Z8XA 2W67A 5H6QB 1OEDC 4YTNA 2LRLA 2CPTA 3ETUA 2WWVA 2A3DA 4U74A 2YDRA 4UV8B 4ZZCA 2UUAT 2W8GA 3UQ4A 3K1SA 3TLUA 3T1HT 3PUGA 1UV6A 4B6XA 3OTOT 3RQUA 2H89A 5FVKA 4DV7T 4IREA 4DV1T 3RYHE 3U78A 2WY2A 4IE6A 3H37A 4IDQA 3F2EA 2PFVA 3EABA 3ZMTB 2FUPA 4O4IE 4ERRA 4LF5T 4UVBB 3VKGA 5LG4A 2IDOB 3AE2A 3NZPA 3CQCB 4JI1T 2XM2A 5AQFB 3WTIA 5HXCA 3Q5WA 1S94A 1HFAA 2IW5B 2J47A 3CMLA 3AVSA 3KFWX 3L09A 4UF0A 5HWYA 5IUXA 4AQYT 3OBVE 4DR3T 2WS3A 1YKHB 2BS2A 1MIVA 2LOSA 3O1JA 4PIRA 3O4XE 3P4QA 1ZHCA 2YU2A 3SS1A 5L3DB 4BJNA 4MBQA 4V1Av 3V5SA 4I50E 1G73A 4UEMA 4KHPT 1ZKEA 2V6YB 3RH3A 3AAIA 2BYPA 4JLEA 4CZZB 3SWHA 3Q5DA 4KBMB 4DV2T 2BDEA 2XAHB 1LRZA 2SPCA 1T98A 2YMEA 3ZMVB 4Z90A 1MMAA 4FI5A 1OEDE 3CX8B 3RRCA 4DIDB 5TVCA 5ABFB 5JREA 2IUBA 2E8IA 4HEAA 4GK5E 4CQIA 3B13A 3MJXA 2K5BB 2Q9QD 3Q5EA 2XYSA 2X68A 1G8XA 4PJLA 4IDOA 2IHR1 4ZJSA 3I0OA 2YOEA 4DV5T 3RYFE 3FBLA 4IE5A 2NOXA 3AE3A 4DV6T 4QWNB 2HN1A 4G63A 5JDGA 3MACA 4PNIA 4U2YA 2WZHA 2Z6EA 1E2AA 4MFRA 4HFBA 3RKGA 4DBQA 4PJNA 2E5VA 2V6YA 5HXSA 5L3FB 5FJVA 3P50A 2N2NA 3LK42 2KT9A 2LE8A 2CBIA 3AA0B 4N78D 1UGOA 2ZM8A 3NVOA 1BR4A 4DR6T 1T72A 3PJAA 3OVUA 1SHZC 2B76A 2NW7A 5J1GA 2LLYA 4EXTA 4YJ2E 4X65T 3ZYLA 1KNPA 2WMOA 4CN6A 2DL1A 2C9TA 2WB5A 2XZEA 1SUMB 3WIPA 4ISSA 2EHOC 3EDVA 5HEGA 3WTMA 3H3MA 5LCYA 2JPFA 3QOFA 5L4HA 3ZC0A 4I55E 2QYWA 2DNXA 2XAGB 3ABVA 3ZDHA 1U4QA 2KMFA 4AKGA 2W00A 2LKGA 3Q9DA 3FBZA 1XZYA 2JQHA 4UM1A 4H9OC 3RRWA 4ZS2A 3IGQA 3HA4A 1JNZA 3GMIA 5LOVE 3E08A 4UY2A 3RC8A 2LJLA 3AE7A 1KK7A 2D2SA 2YINA 2XQ8A 4LFCT 4OHFA 2X0HA 2N1GA 3CKDA 2MBGA 4WBNE 1EZ3A 1YQ3A 5L3BB 4DV0T 4X64T 2W4XA 4QXHB 2NR4A 2VL0A 3JC6C 3FXEB 1AJ3A 3UU4A 3ZMZB 3LDQB 3GWHA 4IIJE 4I0UA 4ZK4A 5CA1E 4IDPA 4ILCA 2XNUA 4NXMT 5HXHA 3PUZF 1XDPA 4HFVA 1SA0E 4CN4A 4X1YE 4YSYA 3ANWB 1MMGA 3C50A 4O2BE 2E9XC 3HKEE 2VVNA 3K3QC 3WTKA 2W62A 4UM3A 4FJOA 2LM9A 3AXJA 2DWGA 3CX7B 3CQXC 2ACXA 3UUXB 4H9PC 3ZKRA 4AKRB 2UXDT 3RLFF 3H3AA 3TKLB 2BS3A 3U8LA 2OLTA 3CIRA 4JYAT 2XQ7A 4PK5A 3MK7C 4KX6A 4PK4A 1YW0A 4AQFC 3C4XA 3P4PA 2XJ7A 2LRKA 5IHYA 2XZ6A 5KE4A 4QXCB 2EHOB 4DNDA 5HXRA 4JEHB 4HE8A 5AQJB 1WRDA 4EYUA 3Q2MA 3TLWA 2WN9A 3VHLA 3LBXB 2WZYA 2CHNA 5JQGE 5DABA 2Y56A 3AA1B 4EEDA 4CXXA 5F5WA 3KV6A 3ANWA 3C4WA 2YK0A 4HFHA 2WZIA 4EZ4A 1D1CA 5ABGA 1IAPA 2NWBA 4JI5T 2VQFT 5AQHB 3T8OA 4TN7B 2XQ4A 4DV4T 3KBTA 4ANJA 2XPKA 2NTYA 3EHZA 3F31A 4OFZA 3K8PC 2CA5A 2X9HA 3AE6A 2W66A 3BQKA 3SOLA 1KF6A 4ILUA 2G0UA 1FMVA 4H63V 3M3ZB 3AVRA 5C3JA 4GKJT 2EHOA 1L0VA 4EB6E 1Y01A 5JTGA 2XM1A 3RIAA 4IGUA 2RPAA 4H63H 2H3RA 3FZHB 1WR0A 2Q9QC 1UX5A 5AQLB 2WCAA 2KSRA 1ZV4X 4ZJTA 4KHZF 3AE9A 3LBXA 3PTRB 2D5UA 2E9XB 2WBLA 2RA1A 4NZBA 5CB4E 3C79A 3QNUA 3BK9A 4QACA 3WTNA 3HKDE 2V7JA 2Y57A 4O2AE 2YN6A 4NUVA 3UT5E 4HWFA 3N5LA 3ZT5A 2P9BA 4EZ1A 2XQ5A 4JI3T 3AB3B 5EK4A 3G06A 2QGSA 2ACZA 2JRKA 4YSZA 4A98A 1HNWT 1HS7A 3N9OA 2I6HA 1JNRA 3ZDGA 2FJAA 4K0UA 4ALXA 1XMQT 4UF0B 2LSJA 4HGAA 3ETVA 5ABHA 5AQGB 3RHWA 2LHNA 2E9XD 2W2UA 3U8KA 2UXNB 3AE8A 4IHJE 4ISTA 4DR7T 3A5XA 4YXDA 2XY8B 4DMVA 4ZI3C 2XQ9A 2WDQA 4MHCA 1MMDA 2E9XA 5H6RB 5HWXA 4UXNB 5LBMA 4DR5T 2ZM0A 2HPJA 2KWHA 1IJ6A 5AQRB 4LFBT 3ZJ1A 4HFEA 2VVSA 5ADXL 3HKBE 4YY3T 4YTPA 2GK9A 3D0TA 4KI0F 3ZN1B 5HXEA 3WTLA 1W0BA 2HHHT 1X9BA 4AFTA 4CI2B 5HAXA 3RYIE 5FL1A 1GQEA 2WWUA 4AQFA 3U8JA 4PK6A 3LJCA 1D1BA 3K3OA 2IAKA 4DBRA 3EAMA 1FEWA 3SQ9A 4GKKT 2NP9A 2CCQA 3N9PA 1VOMA 2YDQA 2K9AA 1FJGT 3U8MA 4ZHQE 2PG8A 2Q9QB 5J5IA 2V7IA 2A9UA 1XNQT 5LP6E 1UX2A 4U33A 2LSIA 3AEFA 4GYRA 5AQSB 2VQET 3AA6B 1WYCA 1IZNB 3GUAA 4ZK1A 1LKXA 2VKHA 4U7IA 2BG9A 4J2CA 4EGWA 1US7B 3ZN0B 2FJEA 5LXTE 3HI2A 5AQPB 2A2FX 2VB6A 4XAXB 3PUVF 3ONLC 3ZCIA 4ZRUA 2R6GF 4YFSA 4OK0A 2LEHA 5FL0A 2XQ3A 2M6BA 4MLKA 3UQ7A 3T1YT 4Q25A 2Y58A 2CWOA 1DU2A 2WM9A 3UU5A 5J0ZA 3AAAB 5JDNA 5BP0A 4HQPA 1WR6A 4LF7T 2E2AA 5AQQB 5KX5E 4HKAA 2XQYA 4CXYA 3ZJ2A 3SRZA 4YTMA 1Z0PA 3OPCA 4ZR6A 4XK9A 1D0YA 2XHEB 2X9XA 4ILBA 4AKIA 4OX9T 2V6XA 3O1IA 4DR2T 3GN5A 2ES0A 1ZOYA 2V5CA 2Q9QA 3OKQA 5FKYA 4AQGA 2YKSA 4QX7B 5AQTB 3VRBA 1S35A 4C90A 2Y54A 5HYAA 3N2KE 2V1DB 4A97A 2CEAA 5F3JA 5FY0A 4L5GA 4HWIB 4JUYA 3UFEA 3PJAJ 1WLXA 1KFYA 1J5ET 5CO5A 1N33T 2JMHA 3VR9A 4DO0A 2IC6A 1T7SA 2QC1B 4YLHA 3FB2A 4XBFB 2CHOA 2YMDA 3VRAA 5FY1A 5LA6E 4PW8A 4ASKA 1MIWA 3SIOA 2MAWA 3EVYA 3CX6B 1BR1A 2Y7YA 2D9DA 5JVDE 4UM3P 1HX8A 4ZI3D 3IBPA 4QXBB 5FP3A 5J5HA 3EDUA 5AQIB 4ZI2D 3NRYA 3IA3A 5KDMC 3KV4A 2FJDA 5LBQB 4EOZB 4LF8T 3KV5A 4ZOLE 2WDVA 4WYVA 3PUSA 4DV3T 2ODVA 2BYQA 3AXJB 3RX6A 3UFGA 2HH7A 3B57A 2IMLA 4QHOA 3JADA 2XQAA 3AECA 3IHRA 3PMZA 3GA8A 4UM3S 3HL6A 4DR4T 5AINA 4COFA 3TLSA 2IC9A 1W9RA 3ZT6A 1I94T 5LGTB 3CVRA 3N9NA 3ZSSA 2VK9A 1XMOT 3PUQA 3O9XA 1J1JA 2C5KT 3PURA 4H9QC 3AEDA 3QB5K 3WI3A 3RIUC 5FY7A 2QA7A 1I6ZA 2CXLA 4HTEA 4PJMA 5J2UE 4ZZBA 3M65A 3KVAA 2J1DG 1HF8A 2LM2A 4TX5A 1HR0T 1VRBA 3SH1A 3NWIA 3MZKB 2BBHA 2YDSA 4KUMB 2ZM6T 1IBLT 2X9WA 1UK5A 5AQVB 3RI5A 5BMVE 1IBKT 4WW0A 4QH4A 3PUWF 4TNVA 4AI6A 5LMUT 4F6RC 2KLQA 3T4MA 2PTFA 2C5JA 2C0SA 3RIFA 2LSGA 4WV9A 4O4JE 2MYSA 2XAJB 5TAOA 4DUZT 5A1LA 1BR0A 4AXPA 2XTLA 3IEEA 4O4HE 2W63A 2DWKA 5LXBA 2VWAA 4UVCB 1CUNA 1X79A 3AEBA 2VKDA 5FVLA 4QX8B 5AFUL 3VU7H 1MNEA 4JI0T 1ZEEA 2HPLA 3I9YA 4LFAT 4KMCA 1VCTA 1HG2A 3VKHA 3RF1A 4I4TE 3FZFB 4JV5T 2WP9A 2XSBA 3HR0A 3E22E 3ZMUB 4G2AA 2BG9C 2QVAA 3AE1A 3FZKB 3NZQA 5AQKB 4GK0E 1XNRT 4U7YA 3WTHA 4H9NC 3ZSTA 4U3CA 2FJBA 2UUCT 2ZMAA 2V26A 2V8SV 4WBOA 3RQWA 3PDYA 4OYKA 4AKLA 4DR1T 3NKZA 2ZM2A 5JH7E 3ZC1A 3R6NA 3ZT7A 1I9BA 4JI6T 2W8FA 3I0QA 4MALA 5LNKA 3PEOA 4CI3B 1N32T 2X00D 2UXCT 3WAJA 2L3LA 1N36T 4ZEYA 2JJ9A 1YD8G 2V7KA 3J9X1 4M1PA 2I59A 2XQ6A 5AQUB 3UU3A 3BQLA 5AQNB 4I43B 4TNWA 4X1IE 4E7ZA 4P0BA 3C98B 3S4UA 1SE7A 2PBIA 1BR2A 5KZUA 4TV8E 3A7MA 2JQKA 3L3PA 2X00A 2WQYA 2CWYA 2A72A 1J5WA 1UCUA 5HEHA 3OYXA 1LVKA 5LJNA 1FMWA 3C4ZA 4JI2T 3I1AA 3WTOA 1XWMA 2L8KA 3V5UA 2H88A 3QUJA 3UTKA 2V7MA 2E5LT 2XZ5A 5FXZA 5L3GB 4ZS3A 4DBMA 4EYYR 5L47A 1D1AA 4YSXA 5KMGP 2BZBA 2AXDS 4IL4A 2C5IT 4IE4A 5M4YA 4IT4A 3MXZA 4GIWA 2BG9E 1R8IA 5ABEA 5IYZE 3QB5A 4EAHA 2KINB 2JIWA 1UURA 3JAFA 5E0OA 3RIUA 3AE5A 3AEAA 5L3CB 3HKCE 4EEBA 1ZP0A 2WMNA 4X62T 2BR8A 5CFBA 4WNKA 2Y48B 4NPPA 4U2ZA 2OV9A 5AFJA 4CXWA 2BG9B 4DVDA 2UU9T 2KXPB 4EV6A 2MOZA 4E7SA 5CA0E 5AFHA 2X0LB 4ZI2C 4YT0A 3N9MA 3AEEA 4IL9A 5HEJA 2XUEA 1QLBA 2BKPA 5DQWA 4EIWA 4B3MT 5FYMA 4JI4T 3KINB 4QAAA 2XAFB 3FZLB 3N2GE 1FIOA 2CXFA 2OA5A 4LMLA 1M62A 5JMEA 2HN2A 3PU3A 5AQMB 3ZEFB 2W61A 3LK2B 2UXXB 4LF6T 3K3NA 4LF9T 3P4SA 3UUBA 1IBMT 2XNVA 3UUNA 5AFKA 4YJ3E 1WCRA 4PFPA 3ZPOA 5J5FA 2DLRA 4CI1B 1WYBA 5BR8T 3WTJA 3GN5B 3OYZA 1QUUA 4UR9A 3J7Yq 2NW9A 4H9RC 4IDZA 4B3TT 3BQIA 4AFGA 4BFQA 1HNXT 4HN9A 3QC9A 4D01A 1W09A 3AEGA 3E0ZA 4GOUA 2ODUA 5LHIB 3PUAA 3KV9A 4P0AA 5LG3A 5JR9C 2BJ0A 5JDLA 4OYJA 1XDOA 4HFDA 1MMNA 2WU2A 5HEUA 4F8HA 1HNZT 2UXBT 3B5MA 2NTXA 3UUMA 4O8SA 3SFDA 3VR8A 5LJMA 1MIYA 3AAEB 2CE7A 3AA7B 4B3ST 5C8YE 2X67A 4ZXLA 2UUBT 1M7KA 2KNDA 2ZJVA 3UU8A 2W0GA 4AFHA 3ONXA 4A56A 3ZYKA 2D0UA 5LGNB 5FXVA 3DTOA 1UUSA 2CMRA 3LG7A 1HX1B 5J5GA 2X9YA 4TWHA 2BYSA 4Z91A 2Y8DA 3N2OA 3I9WA 4HFIA 1OEDB 1WFDA 2QRXA 4PJJA 4NUUA 2YU1A 4LF4T 2BS4A 3ZCJA 3U8NA 3DJBA 2LOPA 2N9DA 3RC3A 4JI8T 4C91A 5AFMB 1N34T 2K24A 2MTQA 2LKHA 4HWCA 5CJ5A 4TV9E 3ZMSB 4CN1A 4B5DA 1UW6A 3LFMA 4ADZA 4L0RA 3TLVA 4QABA 3L8RA 4HWDA 2I0MA 4A5XA 5ABFA 2BYRA 1U5PA 4FRRA 3U3IA 4DMWA 4AISA 5L3EB 4IE7A 2BKOA 1W0AA 2V5DA 4JBWF 5LGUB 2NW8A 3NRXA 1Y64B 1OEDA 3PUXF 4LMJA
chains in the Genus database with same CATH topology
5J5GA 2C9TA 4ZZCA 4TWHA 1OEDE 2W8GA 4HFCA 3UQ4A 2BYSA 4Z91A 5CO5A 2XZ5A 5TVCA 3WIPA 3TLUA 2BG9C 3UUBA 4DBMA 3RHWA 3GUAA 5L47A 4ZK1A 3EHZA 2XNVA 3UU6A 1UV6A 3WTKA 5HCMA 5HEGA 3RQUA 3WTMA 4HFIA 5AFKA 2BG9A 4IL4A 2QC1B 1OEDB 4UM3A 3WTHA 5AFMA 5J5FA 4ZZBA 2XQ4A 2YMDA 5L4HA 3U8KA 3WTJA 2BG9E 4X5TA 4IREA 2LM2A 2XYSA 3ZKRA 3SQ6A 3SIOA 2MAWA 3RQWA 5HEOA 2XYTA 3ZDHA 4ZRUA 3U8NA 3SH1A 2UZ6A 4AFGA 4BFQA 5AFNA 2Y7YA 2XQ3A 4D01A 2M6BA 3JAFA 4UM3P 2LKGA 2XQ9A 5HCJA 2WNJA 5AFMB 4ZJSA 1I9BA 2YOEA 3UQ7A 2PGZA 3RI5A 2W8FA 3U8LA 5AFLA 5J5HA 3RIAA 4UM1A 2Y58A 3WTIA 2LKHA 3TLTA 2XQ7A 3PEOA 2PH9A 3C84A 3UU5A 5J0ZA 4XHEA 4QH4A 2X00D 1UW6A 4B5DA 4TNVA 2BR8A 2ZJUA 3IGQA 5BP0A 5CFBA 4HQPA 2KSRA 5BRXA 4QABA 3TLVA 5LG3A 4ZJTA 2XQ6A 3T4MA 2BJ0A 3UU3A 4NPPA 4HFDA 2XZ6A 4UY2A 5AFJA 5KE4A 5IUXA 3RIFA 5HEUA 4TWFA 4WV9A 2BG9B 2XNTA 4ILAA 4F8HA 2BYRA 2BYQA 2XQ8A 3EI0A 4TNWA 4NZBA 3P4WA 4ZR6A 4HFBA 3C79A 2BR7A 4XK9A 5AFHA 4HFEA 4QACA 3WTNA 4FRRA 2Y57A 4PIRA 3JADA 2XQAA 2YN6A 4BQTA 5FJVA 3P50A 4IL9A 2M6IA 5HEJA 4ILBA 3TLWA 2WN9A 3PMZA 2BYNA 4UM3S 3WTLA 5KZUA 4EZ1A 2WNLA 5LXBA 2X00A 2XQ5A 4AFTA 2WZYA 4UXUA 4QAAA 5AINA 3JAEA 2YKSA 3U8JA 4COFA 2Y56A 2VL0A 3TLSA 5HEHA 4A98A 5L4EA 3EAMA 3UU4A 2ZJVA 3SQ9A 2LLYA 3UU8A 2Y54A 5SYOA 4AFHA 1OEDC 2BYPA 4HFHA 4LMLA 4LMKA 4A97A 4ZK4A 3U8MA 4QH5A 3ZDGA 3LSVA 4ILCA 1OEDA 4TWDA 2XNUA 5JMEA 4LMJA 4QH1A 2WNCA 3WTOA 4ALXA 5J5IA 2YMEA 5BW2A 4Z90A 1UX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J5G A;  2C9T A;  4ZZC A;  4TWH A;  1OED E;  2W8G A;  4HFC A;  3UQ4 A;  2BYS A;  4Z91 A;  5CO5 A;  2XZ5 A;  5TVC A;  3WIP A;  3TLU A;  2BG9 C;  3UUB A;  4DBM A;  3RHW A;  3GUA A;  5L47 A;  4ZK1 A;  3EHZ A;  2XNV A;  3UU6 A;  1UV6 A;  3WTK A;  5HCM A;  5HEG A;  3RQU A;  3WTM A;  4HFI A;  5AFK A;  2BG9 A;  4IL4 A;  2QC1 B;  1OED B;  4UM3 A;  3WTH A;  5AFM A;  5J5F A;  4ZZB A;  2XQ4 A;  2YMD A;  5L4H A;  3U8K A;  3WTJ A;  2BG9 E;  4X5T A;  4IRE A;  2LM2 A;  2XYS A;  3ZKR A;  3SQ6 A;  3SIO A;  2MAW A;  3RQW A;  5HEO A;  2XYT A;  3ZDH A;  4ZRU A;  3U8N A;  3SH1 A;  2UZ6 A;  4AFG A;  4BFQ A;  5AFN A;  2Y7Y A;  2XQ3 A;  4D01 A;  2M6B A;  3JAF A;  4UM3 P;  2LKG A;  2XQ9 A;  5HCJ A;  2WNJ A;  5AFM B;  4ZJS A;  1I9B A;  2YOE A;  3UQ7 A;  2PGZ A;  3RI5 A;  2W8F A;  3U8L A;  5AFL A;  5J5H A;  3RIA A;  4UM1 A;  2Y58 A;  3WTI A;  2LKH A;  3TLT A;  2XQ7 A;  3PEO A;  2PH9 A;  3C84 A;  3UU5 A;  5J0Z A;  4XHE A;  4QH4 A;  2X00 D;  1UW6 A;  4B5D A;  4TNV A;  2BR8 A;  2ZJU A;  3IGQ A;  5BP0 A;  5CFB A;  4HQP A;  2KSR A;  5BRX A;  4QAB A;  3TLV A;  5LG3 A;  4ZJT A;  2XQ6 A;  3T4M A;  2BJ0 A;  3UU3 A;  4NPP A;  4HFD A;  2XZ6 A;  4UY2 A;  5AFJ A;  5KE4 A;  5IUX A;  3RIF A;  5HEU A;  4TWF A;  4WV9 A;  2BG9 B;  2XNT A;  4ILA A;  4F8H A;  2BYR A;  2BYQ A;  2XQ8 A;  3EI0 A;  4TNW A;  4NZB A;  3P4W A;  4ZR6 A;  4HFB A;  3C79 A;  2BR7 A;  4XK9 A;  5AFH A;  4HFE A;  4QAC A;  3WTN A;  4FRR A;  2Y57 A;  4PIR A;  3JAD A;  2XQA A;  2YN6 A;  4BQT A;  5FJV A;  3P50 A;  4IL9 A;  2M6I A;  5HEJ A;  4ILB A;  3TLW A;  2WN9 A;  3PMZ A;  2BYN A;  4UM3 S;  3WTL A;  5KZU A;  4EZ1 A;  2WNL A;  5LXB A;  2X00 A;  2XQ5 A;  4AFT A;  2WZY A;  4UXU A;  4QAA A;  5AIN A;  3JAE A;  2YKS A;  3U8J A;  4COF A;  2Y56 A;  2VL0 A;  3TLS A;  5HEH A;  4A98 A;  5L4E A;  3EAM A;  3UU4 A;  2ZJV A;  3SQ9 A;  2LLY A;  3UU8 A;  2Y54 A;  5SYO A;  4AFH A;  1OED C;  2BYP A;  4HFH A;  4LML A;  4LMK A;  4A97 A;  4ZK4 A;  3U8M A;  4QH5 A;  3ZDG A;  3LSV A;  4ILC A;  1OED A;  4TWD A;  2XNU A;  5JME A;  4LMJ A;  4QH1 A;  2WNC A;  3WTO A;  4ALX A;  5J5I A;  2YME A;  5BW2 A;  4Z90 A;  1UX2 A; 
#chains in the Genus database with same CATH topology
 5KXJ A;  1OWA A;  5JR9 B;  2VKJ A;  4QKN A;  3RPU A;  3UU6 A;  2X66 A;  4UIG A;  2K3W A;  2MPK A;  1YXR A;  3N9L A;  3AE4 A;  3SFE A;  3FZM B;  5AFM A;  3W15 B;  4NIQ A;  4U31 A;  2BKN A;  2YEV C;  4X5T A;  4U72 A;  3N9Q A;  4BJM A;  3SQ6 A;  5HEO A;  5LHH B;  2ZLY A;  2H7O A;  2LSK A;  1T8B A;  3R84 B;  2XAS B;  3PU8 A;  4O4L E;  5LB7 B;  4UEL A;  4YHJ A;  4X20 E;  1KNZ A;  2PGZ A;  2CLY C;  5JDQ A;  2DHR A;  5FNV E;  2PH9 A;  1O3X A;  3FXD B;  3IF8 B;  3X1D A;  5ETW A;  2VAS A;  3PV0 F;  3KVB A;  1D0X A;  5LHG B;  2JQQ A;  4XZC A;  1CHU A;  4L9I A;  3P4W A;  5FMN A;  4IE0 A;  2K48 A;  1V9D A;  2BVM A;  3ZLI A;  4JEU B;  1HG5 A;  3O1H A;  1UX4 A;  5C2T A;  3RKO A;  3ESL A;  2F4V T;  5JR9 A;  4IDN A;  5L4E A;  3MA9 A;  1VCS A;  2XSA A;  4P1N A;  1IJ5 A;  3ONJ A;  5LMN T;  4LMK A;  2VL8 A;  3JCF A;  2JQ9 A;  1HTJ F;  1B7T A;  4QH1 A;  5EK3 A;  1KEY A;  3P4R A;  4AKH A;  4TZ4 C;  5BW2 A;  5JDF A;  2CM0 A;  4HFC A;  2IIU A;  3QK6 A;  4H9S E;  2V7L A;  3P7I A;  3RGL A;  2CBJ A;  5CGM A;  2CRB A;  2WAU A;  5FXX A;  3PUY F;  4YHH T;  5DJQ C;  2UZ6 A;  4B3R T;  4GYS A;  5AFN A;  4ZI7 E;  1QSD A;  5HCJ A;  2WNJ A;  4EZH A;  4BA9 A;  2FBW A;  3P8C D;  2Y6X A;  5AFL A;  2WSS V;  2BVL A;  4UV9 B;  2KZ7 B;  4KP3 C;  4XHE A;  1OXZ A;  5EK2 A;  1NAF A;  2LT3 A;  3Q5X A;  5IWA T;  2LSY A;  2KWI B;  5F8P A;  4TWF A;  4BAY B;  2BR7 A;  5JDM A;  3FHN A;  2M6I A;  2J4G A;  1NWM X;  2WU5 A;  3ZYM A;  1Z8U A;  3CPZ A;  1LVF A;  2WNL A;  2X0Y A;  4P09 A;  3JAE A;  5EZY E;  4K0K T;  3KDS E;  2EHO D;  3EUH A;  5SYO A;  2CLY B;  4QH5 A;  2H7V C;  3RYC E;  3LSV A;  4TWD A;  5J2T E;  2WNC A;  3KBU A;  2VUR A;  1E1H B;  5JRC B;  2D0T A;  3DP7 A;  4HWH A;  2DCF A;  5LYJ E;  3UUL A;  2VKO A;  1NEN A;  3C51 A;  5HCM A;  2WDR A;  3WAK A;  2XAQ B;  4PFO A;  3CQG B;  1MND A;  2AE9 A;  3CK6 A;  2PJQ A;  2CXD A;  1E7P A;  2XYT A;  4X66 T;  4X1K E;  4TUY E;  3F57 A;  4PAG A;  1YQ4 A;  2L9Q A;  4DUY T;  5FXW A;  2JMK A;  3TLT A;  1KNR A;  1H7C A;  5DQV A;  3NBX X;  3C84 A;  2ZJU A;  5BRX A;  3MKD A;  2LHR A;  3LK3 B;  4AIU A;  4NXN T;  2J62 A;  2BBJ A;  5GON E;  2XNT A;  3JC6 D;  4ILA A;  3EI0 A;  3OJA A;  4JI7 T;  4UVA B;  5L2L A;  4WZX A;  2X51 A;  4BQT A;  3L39 A;  2BYN A;  1HCI A;  1NEK A;  2DI4 A;  5JDH A;  3CWZ B;  2B1E A;  2M67 A;  4UXU A;  3PE0 A;  1D0Z A;  1YKE B;  3C64 A;  5AQO B;  5JRC A;  3A8Y C;  2RP4 A;  4Z8X A;  2W67 A;  5H6Q B;  1OED C;  4YTN A;  2LRL A;  2CPT A;  3ETU A;  2WWV A;  2A3D A;  4U74 A;  2YDR A;  4UV8 B;  4ZZC A;  2UUA T;  2W8G A;  3UQ4 A;  3K1S A;  3TLU A;  3T1H T;  3PUG A;  1UV6 A;  4B6X A;  3OTO T;  3RQU A;  2H89 A;  5FVK A;  4DV7 T;  4IRE A;  4DV1 T;  3RYH E;  3U78 A;  2WY2 A;  4IE6 A;  3H37 A;  4IDQ A;  3F2E A;  2PFV A;  3EAB A;  3ZMT B;  2FUP A;  4O4I E;  4ERR A;  4LF5 T;  4UVB B;  3VKG A;  5LG4 A;  2IDO B;  3AE2 A;  3NZP A;  3CQC B;  4JI1 T;  2XM2 A;  5AQF B;  3WTI A;  5HXC A;  3Q5W A;  1S94 A;  1HFA A;  2IW5 B;  2J47 A;  3CML A;  3AVS A;  3KFW X;  3L09 A;  4UF0 A;  5HWY A;  5IUX A;  4AQY T;  3OBV E;  4DR3 T;  2WS3 A;  1YKH B;  2BS2 A;  1MIV A;  2LOS A;  3O1J A;  4PIR A;  3O4X E;  3P4Q A;  1ZHC A;  2YU2 A;  3SS1 A;  5L3D B;  4BJN A;  4MBQ A;  4V1A v;  3V5S A;  4I50 E;  1G73 A;  4UEM A;  4KHP T;  1ZKE A;  2V6Y B;  3RH3 A;  3AAI A;  2BYP A;  4JLE A;  4CZZ B;  3SWH A;  3Q5D A;  4KBM B;  4DV2 T;  2BDE A;  2XAH B;  1LRZ A;  2SPC A;  1T98 A;  2YME A;  3ZMV B;  4Z90 A;  1MMA A;  4FI5 A;  1OED E;  3CX8 B;  3RRC A;  4DID B;  5TVC A;  5ABF B;  5JRE A;  2IUB A;  2E8I A;  4HEA A;  4GK5 E;  4CQI A;  3B13 A;  3MJX A;  2K5B B;  2Q9Q D;  3Q5E A;  2XYS A;  2X68 A;  1G8X A;  4PJL A;  4IDO A;  2IHR 1;  4ZJS A;  3I0O A;  2YOE A;  4DV5 T;  3RYF E;  3FBL A;  4IE5 A;  2NOX A;  3AE3 A;  4DV6 T;  4QWN B;  2HN1 A;  4G63 A;  5JDG A;  3MAC A;  4PNI A;  4U2Y A;  2WZH A;  2Z6E A;  1E2A A;  4MFR A;  4HFB A;  3RKG A;  4DBQ A;  4PJN A;  2E5V A;  2V6Y A;  5HXS A;  5L3F B;  5FJV A;  3P50 A;  2N2N A;  3LK4 2;  2KT9 A;  2LE8 A;  2CBI A;  3AA0 B;  4N78 D;  1UGO A;  2ZM8 A;  3NVO A;  1BR4 A;  4DR6 T;  1T72 A;  3PJA A;  3OVU A;  1SHZ C;  2B76 A;  2NW7 A;  5J1G A;  2LLY A;  4EXT A;  4YJ2 E;  4X65 T;  3ZYL A;  1KNP A;  2WMO A;  4CN6 A;  2DL1 A;  2C9T A;  2WB5 A;  2XZE A;  1SUM B;  3WIP A;  4ISS A;  2EHO C;  3EDV A;  5HEG A;  3WTM A;  3H3M A;  5LCY A;  2JPF A;  3QOF A;  5L4H A;  3ZC0 A;  4I55 E;  2QYW A;  2DNX A;  2XAG B;  3ABV A;  3ZDH A;  1U4Q A;  2KMF A;  4AKG A;  2W00 A;  2LKG A;  3Q9D A;  3FBZ A;  1XZY A;  2JQH A;  4UM1 A;  4H9O C;  3RRW A;  4ZS2 A;  3IGQ A;  3HA4 A;  1JNZ A;  3GMI A;  5LOV E;  3E08 A;  4UY2 A;  3RC8 A;  2LJL A;  3AE7 A;  1KK7 A;  2D2S A;  2YIN A;  2XQ8 A;  4LFC T;  4OHF A;  2X0H A;  2N1G A;  3CKD A;  2MBG A;  4WBN E;  1EZ3 A;  1YQ3 A;  5L3B B;  4DV0 T;  4X64 T;  2W4X A;  4QXH B;  2NR4 A;  2VL0 A;  3JC6 C;  3FXE B;  1AJ3 A;  3UU4 A;  3ZMZ B;  3LDQ B;  3GWH A;  4IIJ E;  4I0U A;  4ZK4 A;  5CA1 E;  4IDP A;  4ILC A;  2XNU A;  4NXM T;  5HXH A;  3PUZ F;  1XDP A;  4HFV A;  1SA0 E;  4CN4 A;  4X1Y E;  4YSY A;  3ANW B;  1MMG A;  3C50 A;  4O2B E;  2E9X C;  3HKE E;  2VVN A;  3K3Q C;  3WTK A;  2W62 A;  4UM3 A;  4FJO A;  2LM9 A;  3AXJ A;  2DWG A;  3CX7 B;  3CQX C;  2ACX A;  3UUX B;  4H9P C;  3ZKR A;  4AKR B;  2UXD T;  3RLF F;  3H3A A;  3TKL B;  2BS3 A;  3U8L A;  2OLT A;  3CIR A;  4JYA T;  2XQ7 A;  4PK5 A;  3MK7 C;  4KX6 A;  4PK4 A;  1YW0 A;  4AQF C;  3C4X A;  3P4P A;  2XJ7 A;  2LRK A;  5IHY A;  2XZ6 A;  5KE4 A;  4QXC B;  2EHO B;  4DND A;  5HXR A;  4JEH B;  4HE8 A;  5AQJ B;  1WRD A;  4EYU A;  3Q2M A;  3TLW A;  2WN9 A;  3VHL A;  3LBX B;  2WZY A;  2CHN A;  5JQG E;  5DAB A;  2Y56 A;  3AA1 B;  4EED A;  4CXX A;  5F5W A;  3KV6 A;  3ANW A;  3C4W A;  2YK0 A;  4HFH A;  2WZI A;  4EZ4 A;  1D1C A;  5ABG A;  1IAP A;  2NWB A;  4JI5 T;  2VQF T;  5AQH B;  3T8O A;  4TN7 B;  2XQ4 A;  4DV4 T;  3KBT A;  4ANJ A;  2XPK A;  2NTY A;  3EHZ A;  3F31 A;  4OFZ A;  3K8P C;  2CA5 A;  2X9H A;  3AE6 A;  2W66 A;  3BQK A;  3SOL A;  1KF6 A;  4ILU A;  2G0U A;  1FMV A;  4H63 V;  3M3Z B;  3AVR A;  5C3J A;  4GKJ T;  2EHO A;  1L0V A;  4EB6 E;  1Y01 A;  5JTG A;  2XM1 A;  3RIA A;  4IGU A;  2RPA A;  4H63 H;  2H3R A;  3FZH B;  1WR0 A;  2Q9Q C;  1UX5 A;  5AQL B;  2WCA A;  2KSR A;  1ZV4 X;  4ZJT A;  4KHZ F;  3AE9 A;  3LBX A;  3PTR B;  2D5U A;  2E9X B;  2WBL A;  2RA1 A;  4NZB A;  5CB4 E;  3C79 A;  3QNU A;  3BK9 A;  4QAC A;  3WTN A;  3HKD E;  2V7J A;  2Y57 A;  4O2A E;  2YN6 A;  4NUV A;  3UT5 E;  4HWF A;  3N5L A;  3ZT5 A;  2P9B A;  4EZ1 A;  2XQ5 A;  4JI3 T;  3AB3 B;  5EK4 A;  3G06 A;  2QGS A;  2ACZ A;  2JRK A;  4YSZ A;  4A98 A;  1HNW T;  1HS7 A;  3N9O A;  2I6H A;  1JNR A;  3ZDG A;  2FJA A;  4K0U A;  4ALX A;  1XMQ T;  4UF0 B;  2LSJ A;  4HGA A;  3ETV A;  5ABH A;  5AQG B;  3RHW A;  2LHN A;  2E9X D;  2W2U A;  3U8K A;  2UXN B;  3AE8 A;  4IHJ E;  4IST A;  4DR7 T;  3A5X A;  4YXD A;  2XY8 B;  4DMV A;  4ZI3 C;  2XQ9 A;  2WDQ A;  4MHC A;  1MMD A;  2E9X A;  5H6R B;  5HWX A;  4UXN B;  5LBM A;  4DR5 T;  2ZM0 A;  2HPJ A;  2KWH A;  1IJ6 A;  5AQR B;  4LFB T;  3ZJ1 A;  4HFE A;  2VVS A;  5ADX L;  3HKB E;  4YY3 T;  4YTP A;  2GK9 A;  3D0T A;  4KI0 F;  3ZN1 B;  5HXE A;  3WTL A;  1W0B A;  2HHH T;  1X9B A;  4AFT A;  4CI2 B;  5HAX A;  3RYI E;  5FL1 A;  1GQE A;  2WWU A;  4AQF A;  3U8J A;  4PK6 A;  3LJC A;  1D1B A;  3K3O A;  2IAK A;  4DBR A;  3EAM A;  1FEW A;  3SQ9 A;  4GKK T;  2NP9 A;  2CCQ A;  3N9P A;  1VOM A;  2YDQ A;  2K9A A;  1FJG T;  3U8M A;  4ZHQ E;  2PG8 A;  2Q9Q B;  5J5I A;  2V7I A;  2A9U A;  1XNQ T;  5LP6 E;  1UX2 A;  4U33 A;  2LSI A;  3AEF A;  4GYR A;  5AQS B;  2VQE T;  3AA6 B;  1WYC A;  1IZN B;  3GUA A;  4ZK1 A;  1LKX A;  2VKH A;  4U7I A;  2BG9 A;  4J2C A;  4EGW A;  1US7 B;  3ZN0 B;  2FJE A;  5LXT E;  3HI2 A;  5AQP B;  2A2F X;  2VB6 A;  4XAX B;  3PUV F;  3ONL C;  3ZCI A;  4ZRU A;  2R6G F;  4YFS A;  4OK0 A;  2LEH A;  5FL0 A;  2XQ3 A;  2M6B A;  4MLK A;  3UQ7 A;  3T1Y T;  4Q25 A;  2Y58 A;  2CWO A;  1DU2 A;  2WM9 A;  3UU5 A;  5J0Z A;  3AAA B;  5JDN A;  5BP0 A;  4HQP A;  1WR6 A;  4LF7 T;  2E2A A;  5AQQ B;  5KX5 E;  4HKA A;  2XQY A;  4CXY A;  3ZJ2 A;  3SRZ A;  4YTM A;  1Z0P A;  3OPC A;  4ZR6 A;  4XK9 A;  1D0Y A;  2XHE B;  2X9X A;  4ILB A;  4AKI A;  4OX9 T;  2V6X A;  3O1I A;  4DR2 T;  3GN5 A;  2ES0 A;  1ZOY A;  2V5C A;  2Q9Q A;  3OKQ A;  5FKY A;  4AQG A;  2YKS A;  4QX7 B;  5AQT B;  3VRB A;  1S35 A;  4C90 A;  2Y54 A;  5HYA A;  3N2K E;  2V1D B;  4A97 A;  2CEA A;  5F3J A;  5FY0 A;  4L5G A;  4HWI B;  4JUY A;  3UFE A;  3PJA J;  1WLX A;  1KFY A;  1J5E T;  5CO5 A;  1N33 T;  2JMH A;  3VR9 A;  4DO0 A;  2IC6 A;  1T7S A;  2QC1 B;  4YLH A;  3FB2 A;  4XBF B;  2CHO A;  2YMD A;  3VRA A;  5FY1 A;  5LA6 E;  4PW8 A;  4ASK A;  1MIW A;  3SIO A;  2MAW A;  3EVY A;  3CX6 B;  1BR1 A;  2Y7Y A;  2D9D A;  5JVD E;  4UM3 P;  1HX8 A;  4ZI3 D;  3IBP A;  4QXB B;  5FP3 A;  5J5H A;  3EDU A;  5AQI B;  4ZI2 D;  3NRY A;  3IA3 A;  5KDM C;  3KV4 A;  2FJD A;  5LBQ B;  4EOZ B;  4LF8 T;  3KV5 A;  4ZOL E;  2WDV A;  4WYV A;  3PUS A;  4DV3 T;  2ODV A;  2BYQ A;  3AXJ B;  3RX6 A;  3UFG A;  2HH7 A;  3B57 A;  2IML A;  4QHO A;  3JAD A;  2XQA A;  3AEC A;  3IHR A;  3PMZ A;  3GA8 A;  4UM3 S;  3HL6 A;  4DR4 T;  5AIN A;  4COF A;  3TLS A;  2IC9 A;  1W9R A;  3ZT6 A;  1I94 T;  5LGT B;  3CVR A;  3N9N A;  3ZSS A;  2VK9 A;  1XMO T;  3PUQ A;  3O9X A;  1J1J A;  2C5K T;  3PUR A;  4H9Q C;  3AED A;  3QB5 K;  3WI3 A;  3RIU C;  5FY7 A;  2QA7 A;  1I6Z A;  2CXL A;  4HTE A;  4PJM A;  5J2U E;  4ZZB A;  3M65 A;  3KVA A;  2J1D G;  1HF8 A;  2LM2 A;  4TX5 A;  1HR0 T;  1VRB A;  3SH1 A;  3NWI A;  3MZK B;  2BBH A;  2YDS A;  4KUM B;  2ZM6 T;  1IBL T;  2X9W A;  1UK5 A;  5AQV B;  3RI5 A;  5BMV E;  1IBK T;  4WW0 A;  4QH4 A;  3PUW F;  4TNV A;  4AI6 A;  5LMU T;  4F6R C;  2KLQ A;  3T4M A;  2PTF A;  2C5J A;  2C0S A;  3RIF A;  2LSG A;  4WV9 A;  4O4J E;  2MYS A;  2XAJ B;  5TAO A;  4DUZ T;  5A1L A;  1BR0 A;  4AXP A;  2XTL A;  3IEE A;  4O4H E;  2W63 A;  2DWK A;  5LXB A;  2VWA A;  4UVC B;  1CUN A;  1X79 A;  3AEB A;  2VKD A;  5FVL A;  4QX8 B;  5AFU L;  3VU7 H;  1MNE A;  4JI0 T;  1ZEE A;  2HPL A;  3I9Y A;  4LFA T;  4KMC A;  1VCT A;  1HG2 A;  3VKH A;  3RF1 A;  4I4T E;  3FZF B;  4JV5 T;  2WP9 A;  2XSB A;  3HR0 A;  3E22 E;  3ZMU B;  4G2A A;  2BG9 C;  2QVA A;  3AE1 A;  3FZK B;  3NZQ A;  5AQK B;  4GK0 E;  1XNR T;  4U7Y A;  3WTH A;  4H9N C;  3ZST A;  4U3C A;  2FJB A;  2UUC T;  2ZMA A;  2V26 A;  2V8S V;  4WBO A;  3RQW A;  3PDY A;  4OYK A;  4AKL A;  4DR1 T;  3NKZ A;  2ZM2 A;  5JH7 E;  3ZC1 A;  3R6N A;  3ZT7 A;  1I9B A;  4JI6 T;  2W8F A;  3I0Q A;  4MAL A;  5LNK A;  3PEO A;  4CI3 B;  1N32 T;  2X00 D;  2UXC T;  3WAJ A;  2L3L A;  1N36 T;  4ZEY A;  2JJ9 A;  1YD8 G;  2V7K A;  3J9X 1;  4M1P A;  2I59 A;  2XQ6 A;  5AQU B;  3UU3 A;  3BQL A;  5AQN B;  4I43 B;  4TNW A;  4X1I E;  4E7Z A;  4P0B A;  3C98 B;  3S4U A;  1SE7 A;  2PBI A;  1BR2 A;  5KZU A;  4TV8 E;  3A7M A;  2JQK A;  3L3P A;  2X00 A;  2WQY A;  2CWY A;  2A72 A;  1J5W A;  1UCU A;  5HEH A;  3OYX A;  1LVK A;  5LJN A;  1FMW A;  3C4Z A;  4JI2 T;  3I1A A;  3WTO A;  1XWM A;  2L8K A;  3V5U A;  2H88 A;  3QUJ A;  3UTK A;  2V7M A;  2E5L T;  2XZ5 A;  5FXZ A;  5L3G B;  4ZS3 A;  4DBM A;  4EYY R;  5L47 A;  1D1A A;  4YSX A;  5KMG P;  2BZB A;  2AXD S;  4IL4 A;  2C5I T;  4IE4 A;  5M4Y A;  4IT4 A;  3MXZ A;  4GIW A;  2BG9 E;  1R8I A;  5ABE A;  5IYZ E;  3QB5 A;  4EAH A;  2KIN B;  2JIW A;  1UUR A;  3JAF A;  5E0O A;  3RIU A;  3AE5 A;  3AEA A;  5L3C B;  3HKC E;  4EEB A;  1ZP0 A;  2WMN A;  4X62 T;  2BR8 A;  5CFB A;  4WNK A;  2Y48 B;  4NPP A;  4U2Z A;  2OV9 A;  5AFJ A;  4CXW A;  2BG9 B;  4DVD A;  2UU9 T;  2KXP B;  4EV6 A;  2MOZ A;  4E7S A;  5CA0 E;  5AFH A;  2X0L B;  4ZI2 C;  4YT0 A;  3N9M A;  3AEE A;  4IL9 A;  5HEJ A;  2XUE A;  1QLB A;  2BKP A;  5DQW A;  4EIW A;  4B3M T;  5FYM A;  4JI4 T;  3KIN B;  4QAA A;  2XAF B;  3FZL B;  3N2G E;  1FIO A;  2CXF A;  2OA5 A;  4LML A;  1M62 A;  5JME A;  2HN2 A;  3PU3 A;  5AQM B;  3ZEF B;  2W61 A;  3LK2 B;  2UXX B;  4LF6 T;  3K3N A;  4LF9 T;  3P4S A;  3UUB A;  1IBM T;  2XNV A;  3UUN A;  5AFK A;  4YJ3 E;  1WCR A;  4PFP A;  3ZPO A;  5J5F A;  2DLR A;  4CI1 B;  1WYB A;  5BR8 T;  3WTJ A;  3GN5 B;  3OYZ A;  1QUU A;  4UR9 A;  3J7Y q;  2NW9 A;  4H9R C;  4IDZ A;  4B3T T;  3BQI A;  4AFG A;  4BFQ A;  1HNX T;  4HN9 A;  3QC9 A;  4D01 A;  1W09 A;  3AEG A;  3E0Z A;  4GOU A;  2ODU A;  5LHI B;  3PUA A;  3KV9 A;  4P0A A;  5LG3 A;  5JR9 C;  2BJ0 A;  5JDL A;  4OYJ A;  1XDO A;  4HFD A;  1MMN A;  2WU2 A;  5HEU A;  4F8H A;  1HNZ T;  2UXB T;  3B5M A;  2NTX A;  3UUM A;  4O8S A;  3SFD A;  3VR8 A;  5LJM A;  1MIY A;  3AAE B;  2CE7 A;  3AA7 B;  4B3S T;  5C8Y E;  2X67 A;  4ZXL A;  2UUB T;  1M7K A;  2KND A;  2ZJV A;  3UU8 A;  2W0G A;  4AFH A;  3ONX A;  4A56 A;  3ZYK A;  2D0U A;  5LGN B;  5FXV A;  3DTO A;  1UUS A;  2CMR A;  3LG7 A;  1HX1 B;  5J5G A;  2X9Y A;  4TWH A;  2BYS A;  4Z91 A;  2Y8D A;  3N2O A;  3I9W A;  4HFI A;  1OED B;  1WFD A;  2QRX A;  4PJJ A;  4NUU A;  2YU1 A;  4LF4 T;  2BS4 A;  3ZCJ A;  3U8N A;  3DJB A;  2LOP A;  2N9D A;  3RC3 A;  4JI8 T;  4C91 A;  5AFM B;  1N34 T;  2K24 A;  2MTQ A;  2LKH A;  4HWC A;  5CJ5 A;  4TV9 E;  3ZMS B;  4CN1 A;  4B5D A;  1UW6 A;  3LFM A;  4ADZ A;  4L0R A;  3TLV A;  4QAB A;  3L8R A;  4HWD A;  2I0M A;  4A5X A;  5ABF A;  2BYR A;  1U5P A;  4FRR A;  3U3I A;  4DMW A;  4AIS A;  5L3E B;  4IE7 A;  2BKO A;  1W0A A;  2V5D A;  4JBW F;  5LGU B;  2NW8 A;  3NRX A;  1Y64 B;  1OED A;  3PUX F;  4LMJ A; 
#chains in the Genus database with same CATH homology
 5J5G A;  2C9T A;  4ZZC A;  4TWH A;  1OED E;  2W8G A;  4HFC A;  3UQ4 A;  2BYS A;  4Z91 A;  5CO5 A;  2XZ5 A;  5TVC A;  3WIP A;  3TLU A;  2BG9 C;  3UUB A;  4DBM A;  3RHW A;  3GUA A;  5L47 A;  4ZK1 A;  3EHZ A;  2XNV A;  3UU6 A;  1UV6 A;  3WTK A;  5HCM A;  5HEG A;  3RQU A;  3WTM A;  4HFI A;  5AFK A;  2BG9 A;  4IL4 A;  2QC1 B;  1OED B;  4UM3 A;  3WTH A;  5AFM A;  5J5F A;  4ZZB A;  2XQ4 A;  2YMD A;  5L4H A;  3U8K A;  3WTJ A;  2BG9 E;  4X5T A;  4IRE A;  2LM2 A;  2XYS A;  3ZKR A;  3SQ6 A;  3SIO A;  2MAW A;  3RQW A;  5HEO A;  2XYT A;  3ZDH A;  4ZRU A;  3U8N A;  3SH1 A;  2UZ6 A;  4AFG A;  4BFQ A;  5AFN A;  2Y7Y A;  2XQ3 A;  4D01 A;  2M6B A;  3JAF A;  4UM3 P;  2LKG A;  2XQ9 A;  5HCJ A;  2WNJ A;  5AFM B;  4ZJS A;  1I9B A;  2YOE A;  3UQ7 A;  2PGZ A;  3RI5 A;  2W8F A;  3U8L A;  5AFL A;  5J5H A;  3RIA A;  4UM1 A;  2Y58 A;  3WTI A;  2LKH A;  3TLT A;  2XQ7 A;  3PEO A;  2PH9 A;  3C84 A;  3UU5 A;  5J0Z A;  4XHE A;  4QH4 A;  2X00 D;  1UW6 A;  4B5D A;  4TNV A;  2BR8 A;  2ZJU A;  3IGQ A;  5BP0 A;  5CFB A;  4HQP A;  2KSR A;  5BRX A;  4QAB A;  3TLV A;  5LG3 A;  4ZJT A;  2XQ6 A;  3T4M A;  2BJ0 A;  3UU3 A;  4NPP A;  4HFD A;  2XZ6 A;  4UY2 A;  5AFJ A;  5KE4 A;  5IUX A;  3RIF A;  5HEU A;  4TWF A;  4WV9 A;  2BG9 B;  2XNT A;  4ILA A;  4F8H A;  2BYR A;  2BYQ A;  2XQ8 A;  3EI0 A;  4TNW A;  4NZB A;  3P4W A;  4ZR6 A;  4HFB A;  3C79 A;  2BR7 A;  4XK9 A;  5AFH A;  4HFE A;  4QAC A;  3WTN A;  4FRR A;  2Y57 A;  4PIR A;  3JAD A;  2XQA A;  2YN6 A;  4BQT A;  5FJV A;  3P50 A;  4IL9 A;  2M6I A;  5HEJ A;  4ILB A;  3TLW A;  2WN9 A;  3PMZ A;  2BYN A;  4UM3 S;  3WTL A;  5KZU A;  4EZ1 A;  2WNL A;  5LXB A;  2X00 A;  2XQ5 A;  4AFT A;  2WZY A;  4UXU A;  4QAA A;  5AIN A;  3JAE A;  2YKS A;  3U8J A;  4COF A;  2Y56 A;  2VL0 A;  3TLS A;  5HEH A;  4A98 A;  5L4E A;  3EAM A;  3UU4 A;  2ZJV A;  3SQ9 A;  2LLY A;  3UU8 A;  2Y54 A;  5SYO A;  4AFH A;  1OED C;  2BYP A;  4HFH A;  4LML A;  4LMK A;  4A97 A;  4ZK4 A;  3U8M A;  4QH5 A;  3ZDG A;  3LSV A;  4ILC A;  1OED A;  4TWD A;  2XNU A;  5JME A;  4LMJ A;  4QH1 A;  2WNC A;  3WTO A;  4ALX A;  5J5I A;  2YME A;  5BW2 A;  4Z90 A;  1UX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...