3TLVA

The glic pentameric ligand-gated ion channel loop2-22' oxidized mutant in a locally-closed conformation (lc3 subtype)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 94
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tlvA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tlvA01
3WTLA 5FJVA 5JMEA 4B5DA 1OEDB 2BYQA 2BJ0A 3WTHA 3WTJA 3JAFA 5L4HA 4IL4A 3SQ6A 2Y7YA 5SYOA 5AFHA 3LSVA 3UU3A 4TNVA 4ALXA 5HEOA 4HFIA 5HCMA 4XK9A 3EAMA 1UW6A 2Y56A 3TLWA 3GUAA 3P50A 4IREA 5KZUA 4PIRA 5HCJA 2BG9A 3SQ9A 4ZK1A 4ILCA 2BYSA 3SH1A 3U8NA 4LMLA 4BFQA 2YMEA 4AFHA 4ZR6A 2PGZA 3EHZA 4AFGA 5HEUA 1I9BA 3UU6A 5CFBA 3WTOA 2XQ9A 3EI0A 2XQ6A 5KE4A 3TLVA 4TNWA 2BG9E 2BR7A 2QC1B 4ZZBA 4A97A 5AFMB 5J5FA 2Y58A 4DBMA 2XQ7A 2BR8A 2XQ8A 2YN6A 5HEHA 5J0ZA 3T4MA 2LKGA 2BG9B 3UUBA 4ZK4A 2XQ5A 3C79A 2MAWA 4HFEA 2XYSA 5HEGA 2LM2A 4QABA 3TLSA 5AFLA 3UU8A 4COFA 2WNCA 2PH9A 2XQ3A 4D01A 2XNVA 2KSRA 2BYNA 5IUXA 2UZ6A 2BG9C 4LMJA 3U8JA 3PMZA 4XHEA 5J5GA 3U8LA 4QH4A 2XZ6A 4A98A 4WV9A 4AFTA 5BP0A 3JAEA 3ZDHA 2ZJUA 3UQ4A 3JADA 2XNTA 3WIPA 4QH5A 2XQ4A 5BW2A 4QH1A 5AFJA 3UQ7A 4EZ1A 5AFNA 3RI5A 5J5HA 4UM3P 5J5IA 2X00A 1UX2A 4UM1A 2VL0A 2BYRA 4FRRA 5CO5A 5AFKA 5BRXA 4X5TA 4TWHA 4ILAA 2YOEA 2X00D 4ZZCA 4ILBA 4ZJTA 4UM3S 5LXBA 3WTMA 3RQUA 2W8GA 3RHWA 4IL9A 2Y54A 4NPPA 4F8HA 2LLYA 4QAAA 4UXUA 2WN9A 3PEOA 4HFBA 3RIFA 4LMKA 2WNJA 2LKHA 2M6IA 5AFMA 3C84A 2XZ5A 1UV6A 2BYPA 4UY2A 1OEDA 4QACA 2Y57A 4NZBA 3P4WA 2XQAA 3UU4A 3UU5A 2XNUA 2WZYA 2WNLA 1OEDC 5LG3A 4TWDA 5TVCA 3WTNA 5L4EA 2YKSA 5L47A 4Z91A 3RQWA 5AINA 4HFDA 4HFHA 3WTKA 3TLUA 3ZDGA 1OEDE 5HEJA 2M6BA 4BQTA 4ZRUA 4ZJSA 2YMDA 3SIOA 4UM3A 4HFCA 4Z90A 3IGQA 3U8KA 4TWFA 3WTIA 2XYTA 2ZJVA 3ZKRA 3TLTA 2C9TA 2W8FA 3U8MA 3RIAA 4HQPA
chains in the Genus database with same CATH superfamily
2Q9QC 4EAHA 4U3CA 1UW6A 2Y56A 2WAUA 3N9PA 5CB4E 4LF9T 2GK9A 3PUZF 2XQ9A 3A7MA 3CPZA 5LJNA 2BZBA 2X9HA 1MMAA 2IC9A 2EHOC 3LBXB 4O2AE 4A97A 4LF6T 3WAJA 2K48A 5LBQB 3AE7A 2XQ8A 1IZNB 4JI2T 1QLBA 3NRXA 2BG9B 3C79A 1IBLT 5HEGA 2WNCA 4CN6A 2X9XA 2UZ6A 5FNVE 1UX4A 3AEGA 1I94T 3AE2A 3P4SA 4EV6A 4WV9A 4H9QC 2KWHA 3ZSTA 5ABHA 2LRKA 1UX2A 4X5TA 2IC6A 2YOEA 2IDOB 4PJNA 2ZM8A 3EVYA 4ERRA 3RQUA 4UVAB 4UF0B 2LT3A 2LKHA 2MOZA 1OEDA 3VKGA 2XQAA 2WZYA 3RC3A 3I0OA 3F2EA 3C50A 4HFHA 3BQLA 3U78A 1J1JA 3SS1A 3Q5EA 2BJ0A 2W63A 3WTJA 5L4HA 3SQ6A 2MTQA 3UUNA 1YXRA 2WZHA 3TLWA 4IREA 3OJAA 4N78D 2WWVA 2M67A 2J1DG 3T1HT 3RKGA 5KE4A 3X1DA 3S4UA 2LSGA 1FEWA 2BKPA 2RA1A 5AQJB 2WZIA 2XQ7A 3ETVA 4HGAA 4JI0T 2XNVA 1CUNA 2WDRA 4O4JE 5LMUT 3DP7A 3UTKA 4YXDA 2WM9A 2UUBT 3UQ4A 3RPUA 3P7IA 2WU5A 5DQWA 2XZEA 4IIJE 1G73A 2DLRA 2W66A 5AQRB 2VL0A 2LRLA 5AFKA 2DL1A 1N32T 2BVLA 3MKDA 5KDMC 3NRYA 2DI4A 5HXCA 3F57A 3FZMB 2VK9A 2R6GF 3AXJA 2UU9T 3L3PA 3K1SA 2XPKA 5JDNA 5L4EA 3RH3A 3ZDGA 4HN9A 4PK4A 4KI0F 2I0MA 4JI4T 5AQIB 2XYTA 2CE7A 4MLKA 5JRCB 2W62A 3PUVF 3EDVA 4B5DA 3C4ZA 1IBMT 3ZMTB 2VQET 3LSVA 4G63A 4JEUB 5AFHA 2NR4A 4OHFA 4V1Av 1NEKA 3W15B 4BFQA 2VVSA 2VKHA 5LHGB 3EI0A 1YW0A 5JH7E 1BR1A 3CMLA 5AQUB 3RC8A 1Z0PA 5J0ZA 4HWCA 2LKGA 5J2UE 2WMNA 2VB6A 4HFEA 4HWFA 1KNRA 4AKIA 1QSDA 2LOPA 2VWAA 4O4HE 4ZS3A 4QH4A 4ZI7E 1KF6A 4NXMT 5IHYA 4P0BA 4XBFB 3JC6D 1MNDA 1HX1B 4P0AA 4NPPA 1HCIA 1Y01A 1I6ZA 2WN9A 5AFUL 3CX6B 4H9NC 4K0KT 2LSYA 2Q9QA 2Q9QD 2V6YA 3QB5A 4DR2T 2UXCT 3RYCE 5KMGP 1ZV4X 4PW8A 4GK5E 4DIDB 1OEDE 3PTRB 4E7SA 1WYBA 4X1IE 2ZM6T 1UGOA 3RIAA 4ZI2C 4JLEA 2LSIA 4ZI3C 2JQ9A 4DV7T 5FL0A 5SYOA 4CXYA 3B5MA 3PJAJ 4ZK1A 2BYSA 5ABEA 3WAKA 4DR4T 2LSKA 1SHZC 3ZYMA 4EZ4A 3UU6A 4DMVA 1WRDA 3KV4A 1D0YA 1G8XA 1YKEB 4TNWA 5ABFA 3FBZA 2X0YA 2KZ7B 5AFMB 1WCRA 2Y58A 2PFVA 3J7Yq 2UUCT 4DBMA 3R84B 2CM0A 2W61A 2XM2A 4LFCT 4QABA 4DV4T 2XQ3A 2AE9A 4ILUA 4U2ZA 2KWIB 4AQYT 3P8CD 4HWDA 4IDZA 3RYIE 2XM1A 4HEAA 5BMVE 4BAYB 2NOXA 5JDFA 2YEVC 1UX5A 5F5WA 4H9RC 1X9BA 4YFSA 5BRXA 4AKGA 4TZ4C 1SE7A 5L3BB 4F8HA 3PU8A 1E1HB 4MHCA 5L3EB 2KMFA 2N2NA 5LXTE 2XZ5A 1HTJF 5HWXA 2BYPA 2VKJA 2W4XA 3R6NA 2XUEA 5FXWA 4DV0T 1KNPA 4DV1T 5TVCA 3WTNA 4L5GA 5JTGA 4UR9A 2MPKA 5BR8T 4UELA 5JDGA 1S94A 3FZKB 2MYSA 3I1AA 5LGNB 3AEBA 2VQFT 3K8PC 5L3DB 4BJNA 4YSXA 4L9IA 2W8FA 1MNEA 3I9YA 2IMLA 4MBQA 2WS3A 1OEDB 5LP6E 2MBGA 2YDQA 5HCMA 2BDEA 4UIGA 3HKBE 4B3RT 3P50A 1T8BA 1VCTA 1W09A 3GN5A 2HPJA 3EHZA 2E9XC 2BKOA 5CFBA 3KBTA 2QYWA 5ABGA 5DJQC 3ZN1B 2QC1B 4G2AA 4C91A 3P4PA 1N36T 1ZKEA 4JI5T 3MK7C 5EK3A 2HN1A 4I0UA 2ES0A 2XYSA 3I9WA 2X67A 5EK4A 2WB5A 5FXXA 2A3DA 4O8SA 2ZJUA 2X68A 4ASKA 5J5IA 4UVCB 2IW5B 2X00A 4OFZA 1KK7A 4FRRA 1R8IA 3AEFA 2PG8A 2X00D 2XTLA 3AA1B 4UM3S 5AQPB 2WMOA 4U33A 4HE8A 1E7PA 4GOUA 2WQYA 2DHRA 3IHRA 4TN7B 2Y57A 1HNZT 2WNLA 2W00A 2KXPB 4DV2T 4YSZA 2YKSA 2X0LB 3RIUC 3SFDA 3IGQA 3LK3B 4BJMA 4EOZB 2OV9A 3BQIA 3AE4A 4ALXA 2YDSA 4ILCA 4E7ZA 1OWAA 2UXNB 2I6HA 5LMNT 4K0UA 1E2AA 3UFEA 1UURA 4CN1A 3Q2MA 2J47A 4AIUA 5LG4A 3PUAA 3QB5K 5JQGE 4CXXA 2D0UA 3T4MA 2V7LA 2Y6XA 1UK5A 2UUAT 4H9SE 1D1CA 3PE0A 5J1GA 3FZLB 3K3OA 4XHEA 3NVOA 4CI1B 5LJMA 5A1LA 3OBVE 4HTEA 4WW0A 3UQ7A 3QC9A 3LG7A 4UM3P 3AEDA 4ISSA 4IDPA 1ZP0A 2X9YA 3HR0A 5LCYA 4ZI2D 2C0SA 3UUXB 2BS3A 3RGLA 4DBQA 4EXTA 3AAEB 5JR9B 3PU3A 2QA7A 5LG3A 5E0OA 2JQKA 3ZMSB 4Z91A 3RF1A 1U4QA 2VURA 2XAQB 3ONJA 2WU2A 2Q9QB 3N5LA 1CHUA 3HI2A 3WTLA 2V6YB 5FJVA 5J2TE 1YQ4A 4LF7T 3N2OA 3TKLB 4OK0A 3OYXA 3QUJA 3PUQA 1XMQT 2JQQA 2WP9A 5AQKB 3EAMA 1XNQT 4AI6A 2A2FX 4NUVA 4U7YA 1US7B 4OYKA 4NXNT 2CCQA 2IIUA 5C2TA 2BS2A 3O4XE 5AQSB 2DWKA 3AAAB 1MIVA 4DV3T 4L0RA 2L8KA 2WSSV 4CN4A 3PV0F 4O4LE 5L2LA 2CLYB 4ADZA 2CBIA 4EZHA 5AFLA 3N9NA 4ZXLA 1MMNA 4QXBB 2CWYA 3U8JA 4IE0A 2RPAA 4B6XA 3U8LA 3EABA 5ABFB 3IEEA 5LGUB 3VRBA 3CQGB 4AQGA 3RI5A 2L3LA 1HG2A 2NW8A 3L8RA 4PJJA 5M4YA 4TWHA 4ILAA 4KBMB 2CXDA 4F6RC 2CHNA 4JI1T 1FMWA 5CA1E 3UFGA 2M6IA 1NENA 3O1HA 2H3RA 3RYFE 2JRKA 3P4WA 3VU7H 3CQCB 2WBLA 4EYYR 4XZCA 4JV5T 4ZRUA 4HKAA 2X9WA 4WNKA 4HFCA 3GA8A 5FP3A 3TLTA 2CA5A 4C90A 1IJ6A 3AECA 3JAFA 2XAGB 3O1IA 5AQLB 5AQOB 4WBOA 2HN2A 1HG5A 3Q5XA 2W67A 5IWAT 4H9OC 3VRAA 3AA6B 3SWHA 1UUSA 4JYAT 1WFDA 2G0UA 4I4TE 4YTMA 3FZFB 1KNZA 4D01A 2CXFA 2BBJA 3ONLC 3T1YT 4UV9B 1KEYA 4ISTA 5CJ5A 4QH1A 3AE3A 1OXZA 2FUPA 2FJBA 3J9X1 5ETWA 2PJQA 3U3IA 2H7VC 3N9MA 2VKOA 3ZT5A 3H37A 2X0HA 4IL9A 3ANWA 3K3NA 3ZMVB 2YU2A 4LMKA 2Y8DA 2XAHB 3AB3B 5IYZE 5JDLA 4DR3T 3LBXA 2RP4A 5CGMA 3KVAA 4NZBA 3UU4A 2X51A 2YINA 5JDHA 4KHZF 3AA7B 4FJOA 4EIWA 4X1YE 2W2UA 3U8KA 1U5PA 3AE5A 5AQNB 4IDNA 2BYQA 4U72A 3WTHA 2C5KT 3KV6A 5LYJE 1HNWT 2SPCA 4IL4A 4QXCB 3UU3A 4EB6E 2JPFA 4PIRA 4AFHA 4LF5T 2EHOA 4DUZT 1J5WA 3UULA 2EHOD 3FB2A 3ZT6A 3C4XA 3C98B 4NUUA 4DV6T 2BR8A 2Z6EA 4PFOA 4CI2B 1XWMA 3FXEB 4KP3C 5F3JA 3UU8A 4AISA 1WR6A 4WBNE 2KSRA 2H89A 4LF8T 2XZ6A 5L3CB 2BBHA 3SFEA 3WIPA 1KFYA 4QH5A 5BW2A 3VKHA 2VVNA 4H9PC 5JDQA 2YK0A 5GONE 4CZZB 2A72A 1BR4A 5JDMA 2I59A 4DMWA 5AQHB 4YY3T 1T7SA 3RRWA 2CBJA 2B1EA 2LLYA 4QAAA 4DNDA 2BKNA 3I0QA 3HKCE 3RIFA 2WNJA 3PURA 3UU5A 2LE8A 1UCUA 1OEDC 3ZLIA 1Z8UA 4H63V 5AINA 5AQQB 3MJXA 2V7MA 4ZJSA 5FY1A 3H3MA 3WTIA 2XY8B 3PEOA 5JREA 4HQPA 5FXZA 4PK5A 5HXHA 2Y7YA 4IE5A 1HFAA 3NBXX 3V5UA 3PUGA 2C5IT 5HCJA 1H7CA 1FJGT 2J4GA 3ETUA 3U8NA 4U7IA 4P09A 4QWNB 3ZT7A 4A56A 4X20E 3LK2B 4NIQA 1X79A 4HWHA 2ZMAA 5HEHA 3CWZB 1DU2A 2XAJB 3CX7B 4XAXB 4JEHB 2D9DA 5HYAA 4DR7T 4CI3B 1D1AA 2YDRA 5AQFB 2JMHA 2D2SA 2ZLYA 4ANJA 3HKDE 4U74A 4DV5T 2A9UA 4PJMA 3ZJ1A 3PUWF 5F8PA 2V7IA 3CIRA 3B13A 4QHOA 2W8GA 1HS7A 2Y54A 3KV9A 2BS4A 1N33T 4UXUA 3L39A 2IHR1 4FI5A 5HAXA 1GQEA 5TAOA 4JI3T 5CA0E 1UV6A 4Q25A 3MACA 4KMCA 2XNUA 2V7JA 3DTOA 2B76A 4AKLA 2FBWA 4LFAT 4HFDA 1FMVA 3AA0B 2IUBA 5HXSA 3HKEE 2ZJVA 3Q5DA 4CXWA 2C9TA 1HX8A 3MZKB 3JCFA 4QACA 2C5JA 1ZOYA 2KNDA 4J2CA 1M7KA 4MFRA 3N9OA 2XJ7A 3IBPA 3ZMUB 1LVFA 3QOFA 1LKXA 2JJ9A 5HEOA 3H3AA 3OKQA 1JNZA 4GIWA 3DJBA 5AQVB 3QNUA 4KHPT 5KZUA 2YMEA 2D5UA 1D0ZA 3ZC1A 4O4IE 3RRCA 5C3JA 3AXJB 2DWGA 4TUYE 2K24A 4X64T 3N9QA 5LGTB 2XQ5A 2MAWA 4UEMA 3AEEA 3CQXC 5IUXA 2BG9C 4IE7A 3UUMA 4LMJA 3E0ZA 2X66A 3AAIA 2V5DA 2XNTA 4MALA 2DCFA 3JC6C 5AFJA 5FKYA 2AXDS 3SRZA 5EK2A 4OYJA 2QVAA 5JR9C 5EZYE 4KUMB 1LVKA 4ZJTA 4DR5T 5AQGB 1MIYA 2CWOA 4UVBB 3KBUA 1HF8A 2UXBT 3AE9A 3AE6A 4TX5A 2LEHA 5AFMA 3C84A 5H6RB 4UY2A 4HFVA 4YJ3E 4WYVA 4X65T 2V7KA 3BK9A 1MMDA 3ANWB 4JBWF 1XNRT 2L9QA 1VCSA 1Y64B 2K9AA 4Z90A 3Q5WA 1HNXT 4X1KE 4ZI3D 1VRBA 3N2KE 3BQKA 4HFIA 3PDYA 3Q9DA 4ZR6A 2CLYC 2WWUA 4PFPA 5LHHB 5FMNA 3AVRA 2CXLA 3O1JA 4I50E 2N1GA 4JI7T 5FVLA 1IAPA 2BYNA 2EHOB 3T8OA 3K3QC 2JMKA 3ZCJA 5J5GA 4A98A 3ZSSA 3ZDHA 2BVMA 3EDUA 4A5XA 4TV8E 4PAGA 4ZHQE 2XSAA 3KFWX 4YJ2E 2BYRA 1WLXA 4UXNB 3AE8A 4ZOLE 4O2BE 3IA3A 3HA4A 2ODUA 4YTPA 1SUMB 3SOLA 4CQIA 4YHJA 3P4QA 3OYZA 4GKJT 4GYRA 4TWDA 5L47A 3RKOA 2NW9A 5HEJA 2KLQA 3C51A 5DABA 2K5BB 3N9LA 3LK42 1D0XA 2XASB 5JMEA 3A5XA 3VR9A 2HHHT 1AJ3A 5JVDE 3GUAA 2E9XA 3PUSA 4LMLA 2E9XD 5C8YE 4I55E 3C64A 3AE1A 3ZMZB 2KINB 2XQ6A 4AQFC 5FYMA 2FJDA 4YSYA 1W0AA 2BR7A 4ZZBA 2LHRA 2OA5A 2ZM0A 3F31A 3NZQA 2UXXB 4ZK4A 2CMRA 4QX7B 1NWMX 4PK6A 5FVKA 5FL1A 3IF8B 3GMIA 5LOVE 1BR0A 1B7TA 2Y48B 3NKZA 5LA6E 2XQ4A 1XDOA 4DR1T 5J5HA 2HPLA 2UXDT 2LOSA 4IHJE 4YTNA 4ZZCA 2E8IA 3CKDA 1W0BA 3GN5B 3D0TA 3M65A 3N2GE 4I43B 4H63H 3RYHE 2F4VT 2ZM2A 3PJAA 3ZJ2A 1YD8G 4GK0E 1LRZA 3RIUA 2PBIA 4AKHA 2VL8A 3RLFF 2NP9A 5DQVA 4BQTA 4GKKT 4X62T 4OX9T 1HR0T 3CK6A 3ZKRA 3FBLA 4ZEYA 2HH7A 2DNXA 4GYSA 4JUYA 5AQTB 4XK9A 2CHOA 2WDQA 4P1NA 2BG9A 1EZ3A 4ZS2A 2P9BA 5FXVA 2PGZA 5HWYA 4AFGA 5FY7A 2FJEA 2XHEB 3G06A 2WCAA 4DVDA 3MA9A 5H6QB 4DO0A 5J5FA 5JR9A 2LHNA 5L3GB 4WZXA 3TLSA 2D0TA 3OVUA 2PH9A 3NZPA 1BR2A 4IGUA 1S35A 2QRXA 3PUYF 4B3MT 3HL6A 4AFTA 3ZN0B 4IE6A 3FHNA 4UF0A 2H7OA 2K3WA 4EZ1A 5CO5A 2VASA 3ZEFB 3O9XA 1MIWA 2JIWA 5FY0A 3WTMA 1WYCA 2E5VA 3KV5A 5LBMA 2NW7A 2XQYA 3KVBA 5AQMB 5ADXL 4AKRB 4EEBA 1V9DA 4UM3A 2V6XA 1L0VA 3UT5E 4IDQA 1ZEEA 4PJLA 3ONXA 1YKHB 4DBRA 2NTYA 4DR6T 3KDSE 2WDVA 4TNVA 2YU1A 3PUXF 3SQ9A 1ZHCA 3SH1A 4U2YA 4B3TT 1XMOT 4QX8B 1I9BA 2N9DA 2NWBA 2ODVA 5LHIB 3AVSA 4JI6T 3E08A 2WY2A 4YLHA 3OPCA 2H88A 2YN6A 3L09A 2J62A 1XDPA 2CRBA 2XAFB 4COFA 4IDOA 1IJ5A 3PMZA 4YT0A 2JQHA 5BP0A 3JAEA 3JADA 3ZYLA 3CX8B 4X66T 1FIOA 1SA0E 1YQ3A 2ACXA 5LB7B 5LXBA 3KINB 4IT4A 5HXEA 4BA9A 3CVRA 4KX6A 4YHHT 3ESLA 2LJLA 3QK6A 1IBKT 2IAKA 4HFBA 2XSBA 5JRCA 3B57A 4IE4A 3VR8A 3WI3A 4Z8XA 4U31A 2E2AA 4AQFA 3RQWA 3V5SA 3WTKA 3OTOT 4LF4T 1T72A 1WR0A 4EGWA 2V5CA 4TWFA 2FJAA 1W9RA 4DUYT 3VHLA 3A8YC 1T98A 4HWIB 4B3ST 1D1BA 3ZYKA 4EEDA 1VOMA 3NWIA 4QXHB 5KX5E 5HEUA 1O3XA 3FXDB 3WTOA 5HXRA 4LFBT 4QKNA 3LDQB 4JI8T 3TLVA 4TV9E 2PTFA 2OLTA 2BG9E 4M1PA 3GWHA 3ZC0A 3LFMA 2E5LT 3ZPOA 3LJCA 2E9XB 2V8SV 3UUBA 1MMGA 2LM2A 3RX6A 2VKDA 3M3ZB 1QUUA 2W0GA 5LNKA 4AXPA 2ACZA 3ABVA 2CEAA 1N34T 5AFNA 2NTXA 3ZCIA 5L3FB 2LSJA 4UM1A 3EUHA 2QGSA 2V1DB 1NAFA 3E22E 4UV8B 4ILBA 1XZYA 3AEAA 4EYUA 1M62A 3RHWA 2V26A 2LM9A 3FZHB 2KT9A 3P4RA 3MXZA 5KXJA 2CPTA 1J5ET 3TLUA 3C4WA 2M6BA 2YMDA 3SIOA 1JNRA 4PNIA 3U8MA
chains in the Genus database with same CATH topology
3WTLA 5FJVA 5JMEA 4B5DA 1OEDB 2BYQA 2BJ0A 3WTHA 3WTJA 3JAFA 5L4HA 4IL4A 3SQ6A 2Y7YA 5SYOA 5AFHA 3LSVA 3UU3A 4TNVA 4ALXA 5HEOA 4HFIA 5HCMA 4XK9A 3EAMA 1UW6A 2Y56A 3TLWA 3GUAA 3P50A 4IREA 5KZUA 4PIRA 5HCJA 2BG9A 3SQ9A 4ZK1A 4ILCA 2BYSA 3SH1A 3U8NA 4LMLA 4BFQA 2YMEA 4AFHA 4ZR6A 2PGZA 3EHZA 4AFGA 5HEUA 1I9BA 3UU6A 5CFBA 3WTOA 2XQ9A 3EI0A 2XQ6A 5KE4A 3TLVA 4TNWA 2BG9E 2BR7A 2QC1B 4ZZBA 4A97A 5AFMB 5J5FA 2Y58A 4DBMA 2XQ7A 2BR8A 2XQ8A 2YN6A 5HEHA 5J0ZA 3T4MA 2LKGA 2BG9B 3UUBA 4ZK4A 2XQ5A 3C79A 2MAWA 4HFEA 2XYSA 5HEGA 2LM2A 4QABA 3TLSA 5AFLA 3UU8A 4COFA 2WNCA 2PH9A 2XQ3A 4D01A 2XNVA 2KSRA 2BYNA 5IUXA 2UZ6A 2BG9C 4LMJA 3U8JA 3PMZA 4XHEA 5J5GA 3U8LA 4QH4A 2XZ6A 4A98A 4WV9A 4AFTA 5BP0A 3JAEA 3ZDHA 2ZJUA 3UQ4A 3JADA 2XNTA 3WIPA 4QH5A 2XQ4A 5BW2A 4QH1A 5AFJA 3UQ7A 4EZ1A 5AFNA 3RI5A 5J5HA 4UM3P 5J5IA 2X00A 1UX2A 4UM1A 2VL0A 2BYRA 4FRRA 5CO5A 5AFKA 5BRXA 4X5TA 4TWHA 4ILAA 2YOEA 2X00D 4ZZCA 4ILBA 4ZJTA 4UM3S 5LXBA 3WTMA 3RQUA 2W8GA 3RHWA 4IL9A 2Y54A 4NPPA 4F8HA 2LLYA 4QAAA 4UXUA 2WN9A 3PEOA 4HFBA 3RIFA 4LMKA 2WNJA 2LKHA 2M6IA 5AFMA 3C84A 2XZ5A 1UV6A 2BYPA 4UY2A 1OEDA 4QACA 2Y57A 4NZBA 3P4WA 2XQAA 3UU4A 3UU5A 2XNUA 2WZYA 2WNLA 1OEDC 5LG3A 4TWDA 5TVCA 3WTNA 5L4EA 2YKSA 5L47A 4Z91A 3RQWA 5AINA 4HFDA 4HFHA 3WTKA 3TLUA 3ZDGA 1OEDE 5HEJA 2M6BA 4BQTA 4ZRUA 4ZJSA 2YMDA 3SIOA 4UM3A 4HFCA 4Z90A 3IGQA 3U8KA 4TWFA 3WTIA 2XYTA 2ZJVA 3ZKRA 3TLTA 2C9TA 2W8FA 3U8MA 3RIAA 4HQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTL A;  5FJV A;  5JME A;  4B5D A;  1OED B;  2BYQ A;  2BJ0 A;  3WTH A;  3WTJ A;  3JAF A;  5L4H A;  4IL4 A;  3SQ6 A;  2Y7Y A;  5SYO A;  5AFH A;  3LSV A;  3UU3 A;  4TNV A;  4ALX A;  5HEO A;  4HFI A;  5HCM A;  4XK9 A;  3EAM A;  1UW6 A;  2Y56 A;  3TLW A;  3GUA A;  3P50 A;  4IRE A;  5KZU A;  4PIR A;  5HCJ A;  2BG9 A;  3SQ9 A;  4ZK1 A;  4ILC A;  2BYS A;  3SH1 A;  3U8N A;  4LML A;  4BFQ A;  2YME A;  4AFH A;  4ZR6 A;  2PGZ A;  3EHZ A;  4AFG A;  5HEU A;  1I9B A;  3UU6 A;  5CFB A;  3WTO A;  2XQ9 A;  3EI0 A;  2XQ6 A;  5KE4 A;  3TLV A;  4TNW A;  2BG9 E;  2BR7 A;  2QC1 B;  4ZZB A;  4A97 A;  5AFM B;  5J5F A;  2Y58 A;  4DBM A;  2XQ7 A;  2BR8 A;  2XQ8 A;  2YN6 A;  5HEH A;  5J0Z A;  3T4M A;  2LKG A;  2BG9 B;  3UUB A;  4ZK4 A;  2XQ5 A;  3C79 A;  2MAW A;  4HFE A;  2XYS A;  5HEG A;  2LM2 A;  4QAB A;  3TLS A;  5AFL A;  3UU8 A;  4COF A;  2WNC A;  2PH9 A;  2XQ3 A;  4D01 A;  2XNV A;  2KSR A;  2BYN A;  5IUX A;  2UZ6 A;  2BG9 C;  4LMJ A;  3U8J A;  3PMZ A;  4XHE A;  5J5G A;  3U8L A;  4QH4 A;  2XZ6 A;  4A98 A;  4WV9 A;  4AFT A;  5BP0 A;  3JAE A;  3ZDH A;  2ZJU A;  3UQ4 A;  3JAD A;  2XNT A;  3WIP A;  4QH5 A;  2XQ4 A;  5BW2 A;  4QH1 A;  5AFJ A;  3UQ7 A;  4EZ1 A;  5AFN A;  3RI5 A;  5J5H A;  4UM3 P;  5J5I A;  2X00 A;  1UX2 A;  4UM1 A;  2VL0 A;  2BYR A;  4FRR A;  5CO5 A;  5AFK A;  5BRX A;  4X5T A;  4TWH A;  4ILA A;  2YOE A;  2X00 D;  4ZZC A;  4ILB A;  4ZJT A;  4UM3 S;  5LXB A;  3WTM A;  3RQU A;  2W8G A;  3RHW A;  4IL9 A;  2Y54 A;  4NPP A;  4F8H A;  2LLY A;  4QAA A;  4UXU A;  2WN9 A;  3PEO A;  4HFB A;  3RIF A;  4LMK A;  2WNJ A;  2LKH A;  2M6I A;  5AFM A;  3C84 A;  2XZ5 A;  1UV6 A;  2BYP A;  4UY2 A;  1OED A;  4QAC A;  2Y57 A;  4NZB A;  3P4W A;  2XQA A;  3UU4 A;  3UU5 A;  2XNU A;  2WZY A;  2WNL A;  1OED C;  5LG3 A;  4TWD A;  5TVC A;  3WTN A;  5L4E A;  2YKS A;  5L47 A;  4Z91 A;  3RQW A;  5AIN A;  4HFD A;  4HFH A;  3WTK A;  3TLU A;  3ZDG A;  1OED E;  5HEJ A;  2M6B A;  4BQT A;  4ZRU A;  4ZJS A;  2YMD A;  3SIO A;  4UM3 A;  4HFC A;  4Z90 A;  3IGQ A;  3U8K A;  4TWF A;  3WTI A;  2XYT A;  2ZJV A;  3ZKR A;  3TLT A;  2C9T A;  2W8F A;  3U8M A;  3RIA A;  4HQP A; 
#chains in the Genus database with same CATH topology
 2Q9Q C;  4EAH A;  4U3C A;  1UW6 A;  2Y56 A;  2WAU A;  3N9P A;  5CB4 E;  4LF9 T;  2GK9 A;  3PUZ F;  2XQ9 A;  3A7M A;  3CPZ A;  5LJN A;  2BZB A;  2X9H A;  1MMA A;  2IC9 A;  2EHO C;  3LBX B;  4O2A E;  4A97 A;  4LF6 T;  3WAJ A;  2K48 A;  5LBQ B;  3AE7 A;  2XQ8 A;  1IZN B;  4JI2 T;  1QLB A;  3NRX A;  2BG9 B;  3C79 A;  1IBL T;  5HEG A;  2WNC A;  4CN6 A;  2X9X A;  2UZ6 A;  5FNV E;  1UX4 A;  3AEG A;  1I94 T;  3AE2 A;  3P4S A;  4EV6 A;  4WV9 A;  4H9Q C;  2KWH A;  3ZST A;  5ABH A;  2LRK A;  1UX2 A;  4X5T A;  2IC6 A;  2YOE A;  2IDO B;  4PJN A;  2ZM8 A;  3EVY A;  4ERR A;  3RQU A;  4UVA B;  4UF0 B;  2LT3 A;  2LKH A;  2MOZ A;  1OED A;  3VKG A;  2XQA A;  2WZY A;  3RC3 A;  3I0O A;  3F2E A;  3C50 A;  4HFH A;  3BQL A;  3U78 A;  1J1J A;  3SS1 A;  3Q5E A;  2BJ0 A;  2W63 A;  3WTJ A;  5L4H A;  3SQ6 A;  2MTQ A;  3UUN A;  1YXR A;  2WZH A;  3TLW A;  4IRE A;  3OJA A;  4N78 D;  2WWV A;  2M67 A;  2J1D G;  3T1H T;  3RKG A;  5KE4 A;  3X1D A;  3S4U A;  2LSG A;  1FEW A;  2BKP A;  2RA1 A;  5AQJ B;  2WZI A;  2XQ7 A;  3ETV A;  4HGA A;  4JI0 T;  2XNV A;  1CUN A;  2WDR A;  4O4J E;  5LMU T;  3DP7 A;  3UTK A;  4YXD A;  2WM9 A;  2UUB T;  3UQ4 A;  3RPU A;  3P7I A;  2WU5 A;  5DQW A;  2XZE A;  4IIJ E;  1G73 A;  2DLR A;  2W66 A;  5AQR B;  2VL0 A;  2LRL A;  5AFK A;  2DL1 A;  1N32 T;  2BVL A;  3MKD A;  5KDM C;  3NRY A;  2DI4 A;  5HXC A;  3F57 A;  3FZM B;  2VK9 A;  2R6G F;  3AXJ A;  2UU9 T;  3L3P A;  3K1S A;  2XPK A;  5JDN A;  5L4E A;  3RH3 A;  3ZDG A;  4HN9 A;  4PK4 A;  4KI0 F;  2I0M A;  4JI4 T;  5AQI B;  2XYT A;  2CE7 A;  4MLK A;  5JRC B;  2W62 A;  3PUV F;  3EDV A;  4B5D A;  3C4Z A;  1IBM T;  3ZMT B;  2VQE T;  3LSV A;  4G63 A;  4JEU B;  5AFH A;  2NR4 A;  4OHF A;  4V1A v;  1NEK A;  3W15 B;  4BFQ A;  2VVS A;  2VKH A;  5LHG B;  3EI0 A;  1YW0 A;  5JH7 E;  1BR1 A;  3CML A;  5AQU B;  3RC8 A;  1Z0P A;  5J0Z A;  4HWC A;  2LKG A;  5J2U E;  2WMN A;  2VB6 A;  4HFE A;  4HWF A;  1KNR A;  4AKI A;  1QSD A;  2LOP A;  2VWA A;  4O4H E;  4ZS3 A;  4QH4 A;  4ZI7 E;  1KF6 A;  4NXM T;  5IHY A;  4P0B A;  4XBF B;  3JC6 D;  1MND A;  1HX1 B;  4P0A A;  4NPP A;  1HCI A;  1Y01 A;  1I6Z A;  2WN9 A;  5AFU L;  3CX6 B;  4H9N C;  4K0K T;  2LSY A;  2Q9Q A;  2Q9Q D;  2V6Y A;  3QB5 A;  4DR2 T;  2UXC T;  3RYC E;  5KMG P;  1ZV4 X;  4PW8 A;  4GK5 E;  4DID B;  1OED E;  3PTR B;  4E7S A;  1WYB A;  4X1I E;  2ZM6 T;  1UGO A;  3RIA A;  4ZI2 C;  4JLE A;  2LSI A;  4ZI3 C;  2JQ9 A;  4DV7 T;  5FL0 A;  5SYO A;  4CXY A;  3B5M A;  3PJA J;  4ZK1 A;  2BYS A;  5ABE A;  3WAK A;  4DR4 T;  2LSK A;  1SHZ C;  3ZYM A;  4EZ4 A;  3UU6 A;  4DMV A;  1WRD A;  3KV4 A;  1D0Y A;  1G8X A;  1YKE B;  4TNW A;  5ABF A;  3FBZ A;  2X0Y A;  2KZ7 B;  5AFM B;  1WCR A;  2Y58 A;  2PFV A;  3J7Y q;  2UUC T;  4DBM A;  3R84 B;  2CM0 A;  2W61 A;  2XM2 A;  4LFC T;  4QAB A;  4DV4 T;  2XQ3 A;  2AE9 A;  4ILU A;  4U2Z A;  2KWI B;  4AQY T;  3P8C D;  4HWD A;  4IDZ A;  3RYI E;  2XM1 A;  4HEA A;  5BMV E;  4BAY B;  2NOX A;  5JDF A;  2YEV C;  1UX5 A;  5F5W A;  4H9R C;  1X9B A;  4YFS A;  5BRX A;  4AKG A;  4TZ4 C;  1SE7 A;  5L3B B;  4F8H A;  3PU8 A;  1E1H B;  4MHC A;  5L3E B;  2KMF A;  2N2N A;  5LXT E;  2XZ5 A;  1HTJ F;  5HWX A;  2BYP A;  2VKJ A;  2W4X A;  3R6N A;  2XUE A;  5FXW A;  4DV0 T;  1KNP A;  4DV1 T;  5TVC A;  3WTN A;  4L5G A;  5JTG A;  4UR9 A;  2MPK A;  5BR8 T;  4UEL A;  5JDG A;  1S94 A;  3FZK B;  2MYS A;  3I1A A;  5LGN B;  3AEB A;  2VQF T;  3K8P C;  5L3D B;  4BJN A;  4YSX A;  4L9I A;  2W8F A;  1MNE A;  3I9Y A;  2IML A;  4MBQ A;  2WS3 A;  1OED B;  5LP6 E;  2MBG A;  2YDQ A;  5HCM A;  2BDE A;  4UIG A;  3HKB E;  4B3R T;  3P50 A;  1T8B A;  1VCT A;  1W09 A;  3GN5 A;  2HPJ A;  3EHZ A;  2E9X C;  2BKO A;  5CFB A;  3KBT A;  2QYW A;  5ABG A;  5DJQ C;  3ZN1 B;  2QC1 B;  4G2A A;  4C91 A;  3P4P A;  1N36 T;  1ZKE A;  4JI5 T;  3MK7 C;  5EK3 A;  2HN1 A;  4I0U A;  2ES0 A;  2XYS A;  3I9W A;  2X67 A;  5EK4 A;  2WB5 A;  5FXX A;  2A3D A;  4O8S A;  2ZJU A;  2X68 A;  4ASK A;  5J5I A;  4UVC B;  2IW5 B;  2X00 A;  4OFZ A;  1KK7 A;  4FRR A;  1R8I A;  3AEF A;  2PG8 A;  2X00 D;  2XTL A;  3AA1 B;  4UM3 S;  5AQP B;  2WMO A;  4U33 A;  4HE8 A;  1E7P A;  4GOU A;  2WQY A;  2DHR A;  3IHR A;  4TN7 B;  2Y57 A;  1HNZ T;  2WNL A;  2W00 A;  2KXP B;  4DV2 T;  4YSZ A;  2YKS A;  2X0L B;  3RIU C;  3SFD A;  3IGQ A;  3LK3 B;  4BJM A;  4EOZ B;  2OV9 A;  3BQI A;  3AE4 A;  4ALX A;  2YDS A;  4ILC A;  4E7Z A;  1OWA A;  2UXN B;  2I6H A;  5LMN T;  4K0U A;  1E2A A;  3UFE A;  1UUR A;  4CN1 A;  3Q2M A;  2J47 A;  4AIU A;  5LG4 A;  3PUA A;  3QB5 K;  5JQG E;  4CXX A;  2D0U A;  3T4M A;  2V7L A;  2Y6X A;  1UK5 A;  2UUA T;  4H9S E;  1D1C A;  3PE0 A;  5J1G A;  3FZL B;  3K3O A;  4XHE A;  3NVO A;  4CI1 B;  5LJM A;  5A1L A;  3OBV E;  4HTE A;  4WW0 A;  3UQ7 A;  3QC9 A;  3LG7 A;  4UM3 P;  3AED A;  4ISS A;  4IDP A;  1ZP0 A;  2X9Y A;  3HR0 A;  5LCY A;  4ZI2 D;  2C0S A;  3UUX B;  2BS3 A;  3RGL A;  4DBQ A;  4EXT A;  3AAE B;  5JR9 B;  3PU3 A;  2QA7 A;  5LG3 A;  5E0O A;  2JQK A;  3ZMS B;  4Z91 A;  3RF1 A;  1U4Q A;  2VUR A;  2XAQ B;  3ONJ A;  2WU2 A;  2Q9Q B;  3N5L A;  1CHU A;  3HI2 A;  3WTL A;  2V6Y B;  5FJV A;  5J2T E;  1YQ4 A;  4LF7 T;  3N2O A;  3TKL B;  4OK0 A;  3OYX A;  3QUJ A;  3PUQ A;  1XMQ T;  2JQQ A;  2WP9 A;  5AQK B;  3EAM A;  1XNQ T;  4AI6 A;  2A2F X;  4NUV A;  4U7Y A;  1US7 B;  4OYK A;  4NXN T;  2CCQ A;  2IIU A;  5C2T A;  2BS2 A;  3O4X E;  5AQS B;  2DWK A;  3AAA B;  1MIV A;  4DV3 T;  4L0R A;  2L8K A;  2WSS V;  4CN4 A;  3PV0 F;  4O4L E;  5L2L A;  2CLY B;  4ADZ A;  2CBI A;  4EZH A;  5AFL A;  3N9N A;  4ZXL A;  1MMN A;  4QXB B;  2CWY A;  3U8J A;  4IE0 A;  2RPA A;  4B6X A;  3U8L A;  3EAB A;  5ABF B;  3IEE A;  5LGU B;  3VRB A;  3CQG B;  4AQG A;  3RI5 A;  2L3L A;  1HG2 A;  2NW8 A;  3L8R A;  4PJJ A;  5M4Y A;  4TWH A;  4ILA A;  4KBM B;  2CXD A;  4F6R C;  2CHN A;  4JI1 T;  1FMW A;  5CA1 E;  3UFG A;  2M6I A;  1NEN A;  3O1H A;  2H3R A;  3RYF E;  2JRK A;  3P4W A;  3VU7 H;  3CQC B;  2WBL A;  4EYY R;  4XZC A;  4JV5 T;  4ZRU A;  4HKA A;  2X9W A;  4WNK A;  4HFC A;  3GA8 A;  5FP3 A;  3TLT A;  2CA5 A;  4C90 A;  1IJ6 A;  3AEC A;  3JAF A;  2XAG B;  3O1I A;  5AQL B;  5AQO B;  4WBO A;  2HN2 A;  1HG5 A;  3Q5X A;  2W67 A;  5IWA T;  4H9O C;  3VRA A;  3AA6 B;  3SWH A;  1UUS A;  4JYA T;  1WFD A;  2G0U A;  4I4T E;  4YTM A;  3FZF B;  1KNZ A;  4D01 A;  2CXF A;  2BBJ A;  3ONL C;  3T1Y T;  4UV9 B;  1KEY A;  4IST A;  5CJ5 A;  4QH1 A;  3AE3 A;  1OXZ A;  2FUP A;  2FJB A;  3J9X 1;  5ETW A;  2PJQ A;  3U3I A;  2H7V C;  3N9M A;  2VKO A;  3ZT5 A;  3H37 A;  2X0H A;  4IL9 A;  3ANW A;  3K3N A;  3ZMV B;  2YU2 A;  4LMK A;  2Y8D A;  2XAH B;  3AB3 B;  5IYZ E;  5JDL A;  4DR3 T;  3LBX A;  2RP4 A;  5CGM A;  3KVA A;  4NZB A;  3UU4 A;  2X51 A;  2YIN A;  5JDH A;  4KHZ F;  3AA7 B;  4FJO A;  4EIW A;  4X1Y E;  2W2U A;  3U8K A;  1U5P A;  3AE5 A;  5AQN B;  4IDN A;  2BYQ A;  4U72 A;  3WTH A;  2C5K T;  3KV6 A;  5LYJ E;  1HNW T;  2SPC A;  4IL4 A;  4QXC B;  3UU3 A;  4EB6 E;  2JPF A;  4PIR A;  4AFH A;  4LF5 T;  2EHO A;  4DUZ T;  1J5W A;  3UUL A;  2EHO D;  3FB2 A;  3ZT6 A;  3C4X A;  3C98 B;  4NUU A;  4DV6 T;  2BR8 A;  2Z6E A;  4PFO A;  4CI2 B;  1XWM A;  3FXE B;  4KP3 C;  5F3J A;  3UU8 A;  4AIS A;  1WR6 A;  4WBN E;  2KSR A;  2H89 A;  4LF8 T;  2XZ6 A;  5L3C B;  2BBH A;  3SFE A;  3WIP A;  1KFY A;  4QH5 A;  5BW2 A;  3VKH A;  2VVN A;  4H9P C;  5JDQ A;  2YK0 A;  5GON E;  4CZZ B;  2A72 A;  1BR4 A;  5JDM A;  2I59 A;  4DMW A;  5AQH B;  4YY3 T;  1T7S A;  3RRW A;  2CBJ A;  2B1E A;  2LLY A;  4QAA A;  4DND A;  2BKN A;  3I0Q A;  3HKC E;  3RIF A;  2WNJ A;  3PUR A;  3UU5 A;  2LE8 A;  1UCU A;  1OED C;  3ZLI A;  1Z8U A;  4H63 V;  5AIN A;  5AQQ B;  3MJX A;  2V7M A;  4ZJS A;  5FY1 A;  3H3M A;  3WTI A;  2XY8 B;  3PEO A;  5JRE A;  4HQP A;  5FXZ A;  4PK5 A;  5HXH A;  2Y7Y A;  4IE5 A;  1HFA A;  3NBX X;  3V5U A;  3PUG A;  2C5I T;  5HCJ A;  1H7C A;  1FJG T;  2J4G A;  3ETU A;  3U8N A;  4U7I A;  4P09 A;  4QWN B;  3ZT7 A;  4A56 A;  4X20 E;  3LK2 B;  4NIQ A;  1X79 A;  4HWH A;  2ZMA A;  5HEH A;  3CWZ B;  1DU2 A;  2XAJ B;  3CX7 B;  4XAX B;  4JEH B;  2D9D A;  5HYA A;  4DR7 T;  4CI3 B;  1D1A A;  2YDR A;  5AQF B;  2JMH A;  2D2S A;  2ZLY A;  4ANJ A;  3HKD E;  4U74 A;  4DV5 T;  2A9U A;  4PJM A;  3ZJ1 A;  3PUW F;  5F8P A;  2V7I A;  3CIR A;  3B13 A;  4QHO A;  2W8G A;  1HS7 A;  2Y54 A;  3KV9 A;  2BS4 A;  1N33 T;  4UXU A;  3L39 A;  2IHR 1;  4FI5 A;  5HAX A;  1GQE A;  5TAO A;  4JI3 T;  5CA0 E;  1UV6 A;  4Q25 A;  3MAC A;  4KMC A;  2XNU A;  2V7J A;  3DTO A;  2B76 A;  4AKL A;  2FBW A;  4LFA T;  4HFD A;  1FMV A;  3AA0 B;  2IUB A;  5HXS A;  3HKE E;  2ZJV A;  3Q5D A;  4CXW A;  2C9T A;  1HX8 A;  3MZK B;  3JCF A;  4QAC A;  2C5J A;  1ZOY A;  2KND A;  4J2C A;  1M7K A;  4MFR A;  3N9O A;  2XJ7 A;  3IBP A;  3ZMU B;  1LVF A;  3QOF A;  1LKX A;  2JJ9 A;  5HEO A;  3H3A A;  3OKQ A;  1JNZ A;  4GIW A;  3DJB A;  5AQV B;  3QNU A;  4KHP T;  5KZU A;  2YME A;  2D5U A;  1D0Z A;  3ZC1 A;  4O4I E;  3RRC A;  5C3J A;  3AXJ B;  2DWG A;  4TUY E;  2K24 A;  4X64 T;  3N9Q A;  5LGT B;  2XQ5 A;  2MAW A;  4UEM A;  3AEE A;  3CQX C;  5IUX A;  2BG9 C;  4IE7 A;  3UUM A;  4LMJ A;  3E0Z A;  2X66 A;  3AAI A;  2V5D A;  2XNT A;  4MAL A;  2DCF A;  3JC6 C;  5AFJ A;  5FKY A;  2AXD S;  3SRZ A;  5EK2 A;  4OYJ A;  2QVA A;  5JR9 C;  5EZY E;  4KUM B;  1LVK A;  4ZJT A;  4DR5 T;  5AQG B;  1MIY A;  2CWO A;  4UVB B;  3KBU A;  1HF8 A;  2UXB T;  3AE9 A;  3AE6 A;  4TX5 A;  2LEH A;  5AFM A;  3C84 A;  5H6R B;  4UY2 A;  4HFV A;  4YJ3 E;  4WYV A;  4X65 T;  2V7K A;  3BK9 A;  1MMD A;  3ANW B;  4JBW F;  1XNR T;  2L9Q A;  1VCS A;  1Y64 B;  2K9A A;  4Z90 A;  3Q5W A;  1HNX T;  4X1K E;  4ZI3 D;  1VRB A;  3N2K E;  3BQK A;  4HFI A;  3PDY A;  3Q9D A;  4ZR6 A;  2CLY C;  2WWU A;  4PFP A;  5LHH B;  5FMN A;  3AVR A;  2CXL A;  3O1J A;  4I50 E;  2N1G A;  4JI7 T;  5FVL A;  1IAP A;  2BYN A;  2EHO B;  3T8O A;  3K3Q C;  2JMK A;  3ZCJ A;  5J5G A;  4A98 A;  3ZSS A;  3ZDH A;  2BVM A;  3EDU A;  4A5X A;  4TV8 E;  4PAG A;  4ZHQ E;  2XSA A;  3KFW X;  4YJ2 E;  2BYR A;  1WLX A;  4UXN B;  3AE8 A;  4ZOL E;  4O2B E;  3IA3 A;  3HA4 A;  2ODU A;  4YTP A;  1SUM B;  3SOL A;  4CQI A;  4YHJ A;  3P4Q A;  3OYZ A;  4GKJ T;  4GYR A;  4TWD A;  5L47 A;  3RKO A;  2NW9 A;  5HEJ A;  2KLQ A;  3C51 A;  5DAB A;  2K5B B;  3N9L A;  3LK4 2;  1D0X A;  2XAS B;  5JME A;  3A5X A;  3VR9 A;  2HHH T;  1AJ3 A;  5JVD E;  3GUA A;  2E9X A;  3PUS A;  4LML A;  2E9X D;  5C8Y E;  4I55 E;  3C64 A;  3AE1 A;  3ZMZ B;  2KIN B;  2XQ6 A;  4AQF C;  5FYM A;  2FJD A;  4YSY A;  1W0A A;  2BR7 A;  4ZZB A;  2LHR A;  2OA5 A;  2ZM0 A;  3F31 A;  3NZQ A;  2UXX B;  4ZK4 A;  2CMR A;  4QX7 B;  1NWM X;  4PK6 A;  5FVK A;  5FL1 A;  3IF8 B;  3GMI A;  5LOV E;  1BR0 A;  1B7T A;  2Y48 B;  3NKZ A;  5LA6 E;  2XQ4 A;  1XDO A;  4DR1 T;  5J5H A;  2HPL A;  2UXD T;  2LOS A;  4IHJ E;  4YTN A;  4ZZC A;  2E8I A;  3CKD A;  1W0B A;  3GN5 B;  3D0T A;  3M65 A;  3N2G E;  4I43 B;  4H63 H;  3RYH E;  2F4V T;  2ZM2 A;  3PJA A;  3ZJ2 A;  1YD8 G;  4GK0 E;  1LRZ A;  3RIU A;  2PBI A;  4AKH A;  2VL8 A;  3RLF F;  2NP9 A;  5DQV A;  4BQT A;  4GKK T;  4X62 T;  4OX9 T;  1HR0 T;  3CK6 A;  3ZKR A;  3FBL A;  4ZEY A;  2HH7 A;  2DNX A;  4GYS A;  4JUY A;  5AQT B;  4XK9 A;  2CHO A;  2WDQ A;  4P1N A;  2BG9 A;  1EZ3 A;  4ZS2 A;  2P9B A;  5FXV A;  2PGZ A;  5HWY A;  4AFG A;  5FY7 A;  2FJE A;  2XHE B;  3G06 A;  2WCA A;  4DVD A;  3MA9 A;  5H6Q B;  4DO0 A;  5J5F A;  5JR9 A;  2LHN A;  5L3G B;  4WZX A;  3TLS A;  2D0T A;  3OVU A;  2PH9 A;  3NZP A;  1BR2 A;  4IGU A;  1S35 A;  2QRX A;  3PUY F;  4B3M T;  3HL6 A;  4AFT A;  3ZN0 B;  4IE6 A;  3FHN A;  4UF0 A;  2H7O A;  2K3W A;  4EZ1 A;  5CO5 A;  2VAS A;  3ZEF B;  3O9X A;  1MIW A;  2JIW A;  5FY0 A;  3WTM A;  1WYC A;  2E5V A;  3KV5 A;  5LBM A;  2NW7 A;  2XQY A;  3KVB A;  5AQM B;  5ADX L;  4AKR B;  4EEB A;  1V9D A;  4UM3 A;  2V6X A;  1L0V A;  3UT5 E;  4IDQ A;  1ZEE A;  4PJL A;  3ONX A;  1YKH B;  4DBR A;  2NTY A;  4DR6 T;  3KDS E;  2WDV A;  4TNV A;  2YU1 A;  3PUX F;  3SQ9 A;  1ZHC A;  3SH1 A;  4U2Y A;  4B3T T;  1XMO T;  4QX8 B;  1I9B A;  2N9D A;  2NWB A;  2ODV A;  5LHI B;  3AVS A;  4JI6 T;  3E08 A;  2WY2 A;  4YLH A;  3OPC A;  2H88 A;  2YN6 A;  3L09 A;  2J62 A;  1XDP A;  2CRB A;  2XAF B;  4COF A;  4IDO A;  1IJ5 A;  3PMZ A;  4YT0 A;  2JQH A;  5BP0 A;  3JAE A;  3JAD A;  3ZYL A;  3CX8 B;  4X66 T;  1FIO A;  1SA0 E;  1YQ3 A;  2ACX A;  5LB7 B;  5LXB A;  3KIN B;  4IT4 A;  5HXE A;  4BA9 A;  3CVR A;  4KX6 A;  4YHH T;  3ESL A;  2LJL A;  3QK6 A;  1IBK T;  2IAK A;  4HFB A;  2XSB A;  5JRC A;  3B57 A;  4IE4 A;  3VR8 A;  3WI3 A;  4Z8X A;  4U31 A;  2E2A A;  4AQF A;  3RQW A;  3V5S A;  3WTK A;  3OTO T;  4LF4 T;  1T72 A;  1WR0 A;  4EGW A;  2V5C A;  4TWF A;  2FJA A;  1W9R A;  4DUY T;  3VHL A;  3A8Y C;  1T98 A;  4HWI B;  4B3S T;  1D1B A;  3ZYK A;  4EED A;  1VOM A;  3NWI A;  4QXH B;  5KX5 E;  5HEU A;  1O3X A;  3FXD B;  3WTO A;  5HXR A;  4LFB T;  4QKN A;  3LDQ B;  4JI8 T;  3TLV A;  4TV9 E;  2PTF A;  2OLT A;  2BG9 E;  4M1P A;  3GWH A;  3ZC0 A;  3LFM A;  2E5L T;  3ZPO A;  3LJC A;  2E9X B;  2V8S V;  3UUB A;  1MMG A;  2LM2 A;  3RX6 A;  2VKD A;  3M3Z B;  1QUU A;  2W0G A;  5LNK A;  4AXP A;  2ACZ A;  3ABV A;  2CEA A;  1N34 T;  5AFN A;  2NTX A;  3ZCI A;  5L3F B;  2LSJ A;  4UM1 A;  3EUH A;  2QGS A;  2V1D B;  1NAF A;  3E22 E;  4UV8 B;  4ILB A;  1XZY A;  3AEA A;  4EYU A;  1M62 A;  3RHW A;  2V26 A;  2LM9 A;  3FZH B;  2KT9 A;  3P4R A;  3MXZ A;  5KXJ A;  2CPT A;  1J5E T;  3TLU A;  3C4W A;  2M6B A;  2YMD A;  3SIO A;  1JNR A;  4PNI A;  3U8M A; 
#chains in the Genus database with same CATH homology
 3WTL A;  5FJV A;  5JME A;  4B5D A;  1OED B;  2BYQ A;  2BJ0 A;  3WTH A;  3WTJ A;  3JAF A;  5L4H A;  4IL4 A;  3SQ6 A;  2Y7Y A;  5SYO A;  5AFH A;  3LSV A;  3UU3 A;  4TNV A;  4ALX A;  5HEO A;  4HFI A;  5HCM A;  4XK9 A;  3EAM A;  1UW6 A;  2Y56 A;  3TLW A;  3GUA A;  3P50 A;  4IRE A;  5KZU A;  4PIR A;  5HCJ A;  2BG9 A;  3SQ9 A;  4ZK1 A;  4ILC A;  2BYS A;  3SH1 A;  3U8N A;  4LML A;  4BFQ A;  2YME A;  4AFH A;  4ZR6 A;  2PGZ A;  3EHZ A;  4AFG A;  5HEU A;  1I9B A;  3UU6 A;  5CFB A;  3WTO A;  2XQ9 A;  3EI0 A;  2XQ6 A;  5KE4 A;  3TLV A;  4TNW A;  2BG9 E;  2BR7 A;  2QC1 B;  4ZZB A;  4A97 A;  5AFM B;  5J5F A;  2Y58 A;  4DBM A;  2XQ7 A;  2BR8 A;  2XQ8 A;  2YN6 A;  5HEH A;  5J0Z A;  3T4M A;  2LKG A;  2BG9 B;  3UUB A;  4ZK4 A;  2XQ5 A;  3C79 A;  2MAW A;  4HFE A;  2XYS A;  5HEG A;  2LM2 A;  4QAB A;  3TLS A;  5AFL A;  3UU8 A;  4COF A;  2WNC A;  2PH9 A;  2XQ3 A;  4D01 A;  2XNV A;  2KSR A;  2BYN A;  5IUX A;  2UZ6 A;  2BG9 C;  4LMJ A;  3U8J A;  3PMZ A;  4XHE A;  5J5G A;  3U8L A;  4QH4 A;  2XZ6 A;  4A98 A;  4WV9 A;  4AFT A;  5BP0 A;  3JAE A;  3ZDH A;  2ZJU A;  3UQ4 A;  3JAD A;  2XNT A;  3WIP A;  4QH5 A;  2XQ4 A;  5BW2 A;  4QH1 A;  5AFJ A;  3UQ7 A;  4EZ1 A;  5AFN A;  3RI5 A;  5J5H A;  4UM3 P;  5J5I A;  2X00 A;  1UX2 A;  4UM1 A;  2VL0 A;  2BYR A;  4FRR A;  5CO5 A;  5AFK A;  5BRX A;  4X5T A;  4TWH A;  4ILA A;  2YOE A;  2X00 D;  4ZZC A;  4ILB A;  4ZJT A;  4UM3 S;  5LXB A;  3WTM A;  3RQU A;  2W8G A;  3RHW A;  4IL9 A;  2Y54 A;  4NPP A;  4F8H A;  2LLY A;  4QAA A;  4UXU A;  2WN9 A;  3PEO A;  4HFB A;  3RIF A;  4LMK A;  2WNJ A;  2LKH A;  2M6I A;  5AFM A;  3C84 A;  2XZ5 A;  1UV6 A;  2BYP A;  4UY2 A;  1OED A;  4QAC A;  2Y57 A;  4NZB A;  3P4W A;  2XQA A;  3UU4 A;  3UU5 A;  2XNU A;  2WZY A;  2WNL A;  1OED C;  5LG3 A;  4TWD A;  5TVC A;  3WTN A;  5L4E A;  2YKS A;  5L47 A;  4Z91 A;  3RQW A;  5AIN A;  4HFD A;  4HFH A;  3WTK A;  3TLU A;  3ZDG A;  1OED E;  5HEJ A;  2M6B A;  4BQT A;  4ZRU A;  4ZJS A;  2YMD A;  3SIO A;  4UM3 A;  4HFC A;  4Z90 A;  3IGQ A;  3U8K A;  4TWF A;  3WTI A;  2XYT A;  2ZJV A;  3ZKR A;  3TLT A;  2C9T A;  2W8F A;  3U8M A;  3RIA A;  4HQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...