3TLVA

The glic pentameric ligand-gated ion channel loop2-22' oxidized mutant in a locally-closed conformation (lc3 subtype)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 94
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tlvA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tlvA01
4PIRA 2XQ5A 3U8LA 3U8NA 2BYNA 2LKGA 5KE4A 4F8HA 3ZKRA 2ZJVA 4HFIA 1OEDE 4HFEA 5FJVA 2W8GA 3C84A 3TLTA 4XK9A 3U8KA 3TLWA 4HFBA 4UXUA 5BP0A 4X5TA 5AFLA 5AFNA 4DBMA 3C79A 2PGZA 2ZJUA 3WTMA 3SH1A 2XZ6A 4D01A 3UU6A 4ILCA 3WTLA 4QH5A 2YN6A 3EI0A 4Z91A 4A97A 2XQ9A 4NPPA 1UX2A 2BYQA 5BW2A 4IREA 5J5IA 3P50A 4COFA 3ZDGA 4AFHA 3RQUA 2Y56A 2XQ3A 5SYOA 4AFGA 2BJ0A 2BR8A 2BR7A 3TLUA 4TWDA 4UY2A 3WTNA 3UU5A 4ZK1A 2Y58A 2BG9A 3P4WA 2XQAA 2YKSA 2M6IA 3RHWA 5HEOA 2W8FA 5HEUA 4QABA 2BG9C 2Y57A 3ZDHA 2LM2A 2XQ6A 2XNTA 3U8MA 2VL0A 5CO5A 4EZ1A 4WV9A 5AFMA 2XQ4A 3UU3A 4LMLA 5J0ZA 1OEDA 4ILAA 4TWFA 2WNLA 3WIPA 3WTIA 4ZK4A 3LSVA 2BYSA 5AINA 3TLSA 3UUBA 3SQ6A 5CFBA 4Z90A 5J5FA 5HEJA 2WNCA 4QH4A 1OEDC 2XQ7A 3UQ7A 5J5GA 2QC1B 4HQPA 2UZ6A 2C9TA 3WTHA 4ALXA 2XYTA 3RIAA 4UM3P 2Y54A 3UU4A 2XNUA 3GUAA 3WTJA 1UW6A 3EAMA 5AFHA 3UU8A 3EHZA 5BRXA 5JMEA 4IL4A 2BYRA 3U8JA 3WTOA 5AFKA 2LKHA 5HCJA 2MAWA 3PMZA 4UM3S 1I9BA 2BYPA 2YMDA 3RIFA 2XZ5A 3RI5A 5KZUA 5L47A 3JADA 4A98A 2PH9A 4NZBA 4QH1A 4LMKA 2X00A 2WNJA 4UM3A 2M6BA 4XHEA 2WN9A 3JAFA 5LG3A 2Y7YA 5HEHA 4AFTA 5LXBA 5J5HA 2YOEA 5HEGA 3TLVA 4ZR6A 3RQWA 5AFJA 3T4MA 2WZYA 2BG9B 5IUXA 4FRRA 4TNWA 5TVCA 2KSRA 4HFCA 2XNVA 4IL9A 4ZZBA 2XQ8A 4HFDA 5L4HA 2YMEA 4BFQA 4UM1A 2X00D 4B5DA 4QACA 5AFMB 3SQ9A 2XYSA 4ZZCA 4ZJTA 4ILBA 4TNVA 3IGQA 4ZRUA 2BG9E 5HCMA 4TWHA 3JAEA 2LLYA 4BQTA 1OEDB 3WTKA 3UQ4A 3PEOA 5L4EA 1UV6A 4LMJA 4QAAA 4HFHA 3SIOA 4ZJSA
chains in the Genus database with same CATH superfamily
4U33A 4QX8B 4U2ZA 2PG8A 3U8NA 2VWAA 3KFWX 4UXNB 4HFIA 4O4HE 5J1GA 4U2YA 4IE5A 3KV9A 4DBMA 3IEEA 4H9OC 4D01A 3PUWF 4AI6A 3IHRA 5HXSA 2HH7A 2LM9A 4HWCA 5LG4A 3NRYA 2W4XA 1WR6A 4YY3T 1MMNA 5LB7B 3C4ZA 2BG9A 2M67A 2W8FA 2V7JA 4QXHB 3AB3B 2BG9C 4EZHA 4H63V 2LSYA 3OPCA 5FXZA 2A3DA 3RLFF 3G06A 2HHHT 2W0GA 4DV0T 4CXWA 3AAIA 3DP7A 4Z90A 3N9LA 5IYZE 3CK6A 3M65A 5FXVA 3N2KE 2J4GA 2CPTA 3AEGA 4N78D 3UU8A 3BQLA 1BR2A 4ZS2A 2CM0A 2YDQA 3Q5EA 3SS1A 3ZYKA 3FXEB 5KZUA 3Q9DA 4UM3A 3AE4A 2IW5B 5J5HA 5AFJA 2RA1A 4TN7B 4UIGA 1M62A 2CXLA 5AFMB 2UXXB 2XYSA 3LK42 3UQ4A 5JDGA 4QAAA 4YSYA 1HFAA 1UCUA 3L39A 1HNXT 5KX5E 1HCIA 1Y01A 4CI2B 4HFEA 4EOZB 2WZHA 4IDQA 3TLWA 4QKNA 3U78A 3CMLA 5AQMB 3O1JA 2NR4A 2XQ9A 1J5WA 3P50A 4B3ST 4X1KE 2BJ0A 1YKHB 2VVSA 4JI2T 1R8IA 4LFCT 3VR8A 2XAHB 4LF6T 4LF5T 3K3NA 2WQYA 3ZSSA 4H9RC 3EABA 2W62A 3LSVA 4EB6E 5M4YA 1MMAA 3FZFB 3UTKA 1N36T 2QA7A 3K3OA 5AFKA 3PUGA 1HS7A 3PMZA 1I9BA 5L47A 2WM9A 4A98A 3O4XE 2BKPA 2NW9A 5JDHA 1VCSA 1ZOYA 3K3QC 4KX6A 3ZT5A 3T4MA 3JC6C 2XQYA 4AKIA 4BA9A 1MMDA 3EVYA 2W66A 4ZJTA 2BG9E 2YEVC 2WDQA 2V6XA 2WDRA 1WCRA 5JH7E 4CZZB 5DJQC 3AE7A 1KEYA 3N2GE 1ZEEA 3PJAA 4GKJT 4I4TE 1KNZA 2VKHA 2W63A 3JC6D 3AEBA 3N9OA 2XASB 4IREA 4AKGA 5L3CB 2ES0A 4LF8T 2UUCT 2BR7A 2LT3A 2DNXA 3VKGA 3V5SA 2UXDT 4QX7B 3C64A 2YDRA 2IDOB 1CHUA 2C5IT 3ZYMA 1NAFA 5AFMA 5L2LA 4FJOA 5HAXA 1UX4A 1HF8A 2FBWA 2E5VA 2JQ9A 4IGUA 5C3JA 2QC1B 4AQYT 3N9MA 2C9TA 1HTJF 2D2SA 1DU2A 2X0HA 4JUYA 3U8JA 2BYRA 1UK5A 3F31A 4WZXA 5HCJA 5C8YE 4V1Av 2JMKA 3AA1B 3LBXB 3RI5A 4DR5T 4GYRA 5LNKA 2LSJA 4DR3T 2VQET 4AQGA 4ZR6A 2BBJA 5IUXA 1MMGA 5DQVA 4DBRA 3MJXA 4UM1A 5KMGP 2FUPA 5AQUB 3IGQA 3RC8A 4ZRUA 2K48A 1WFDA 3ZEFB 2I6HA 5FKYA 1IBKT 2KNDA 5C2TA 5AQFB 3BQKA 1IBLT 3FBZA 5JRCB 5JDNA 5IWAT 3E0ZA 2ZJUA 2LHRA 3PUSA 3E08A 3N9PA 1IAPA 2CXFA 5JR9C 1T7SA 1UUSA 4CN6A 1SUMB 4TWDA 5HXHA 2N9DA 4X64T 2ACZA 2UU9T 3OKQA 2V1DB 4DVDA 4CXXA 4EZ1A 5FVLA 2J47A 1S35A 4F6RC 1HX8A 5JQGE 3WAKA 3P8CD 4PJNA 2XHEB 5JMEA 3RYIE 3HR0A 5LHGB 4K0KT 3KBTA 2D0TA 2Q9QC 4QH1A 4HWIB 4ZHQE 1ZHCA 3ONXA 4OYKA 2YU1A 4DR1T 3H3MA 4ANJA 4IL9A 4ZZBA 4HFDA 5LOVE 4I0UA 1ZKEA 1AJ3A 2CBIA 3ZYLA 3I9WA 4LF9T 5EK3A 4OX9T 2H7OA 3U8LA 1IJ5A 1IZNB 2BBHA 4IDOA 4ILUA 1ZV4X 3R6NA 2P9BA 2Q9QD 1BR0A 5AFNA 4X65T 2FJBA 4C90A 3SH1A 2FJDA 2CWOA 2F4VT 4MALA 4AKHA 3ZDGA 5LYJE 4HN9A 4O4JE 3MXZA 3MA9A 2H89A 5ADXL 1O3XA 4B3MT 3TKLB 3K8PC 3HKEE 2LRLA 1XMOT 1V9DA 2XQAA 2E9XC 5J2UE 5E0OA 3RKOA 2I59A 3ZDHA 4L9IA 4LFBT 2QYWA 5FXWA 3UFGA 4U74A 4JI8T 5FL0A 3ZT7A 4HQPA 4MFRA 1HX1B 4PJJA 4CXYA 4HWDA 1BR1A 2YK0A 3GMIA 3AECA 5BMVE 4EXTA 2XAFB 2CA5A 3LFMA 1FJGT 4IE0A 2E9XD 4ZI7E 2C5JA 5JDMA 4DMWA 3ZMVB 4ZXLA 5LXBA 4H9SE 3JCFA 2WZYA 2KSRA 3KV5A 1XNRT 2XQ8A 3F2EA 5AQIB 2X00D 2KMFA 2FJAA 3A8YC 4LF4T 3HKBE 3QOFA 1KNRA 3L8RA 3D0TA 2YU2A 3ONJA 3SIOA 1S94A 4DV7T 2JRKA 2XQ5A 3P4SA 4JI4T 1XWMA 4GIWA 4EGWA 4UVBB 5DQWA 2IIUA 1E1HB 3UUMA 3FZLB 2KWHA 4G63A 5AFLA 3I1AA 2V6YB 3C79A 3B57A 4QXCB 1UURA 1X79A 4OHFA 4EV6A 2XQ3A 4U3CA 5SYOA 4IIJE 2LRKA 1KFYA 3N2OA 3CPZA 2ZMAA 2ZM6T 3S4UA 1KNPA 4DR4T 2WU5A 2LOPA 2UXBT 2V7IA 4EYUA 2PFVA 1IJ6A 3SFEA 3N9NA 2WNLA 2ZLYA 3WTIA 5AINA 3TLSA 1T8BA 3ZMSB 1MIVA 3WTHA 3N5LA 2XYTA 3RIAA 2NWBA 3ZMUB 5LGTB 3A7MA 3EAMA 5LBQB 5AQQB 3CIRA 4U31A 5A1LA 4LF7T 3CX8B 5HWYA 2CMRA 3ZC1A 1YXRA 4OK0A 2PH9A 3LDQB 2CWYA 3AEFA 2H7VC 3QUJA 4I50E 1KK7A 2R6GF 4EEBA 3PU3A 4O2AE 5LCYA 2CHNA 2BKNA 3Q5XA 4ISTA 3VRAA 5F3JA 3FZHB 4DO0A 4AKRB 4B5DA 3SQ9A 2OV9A 4ILBA 3JAEA 4ZS3A 4LMJA 5ABHA 4KMCA 1WRDA 4JEUB 5CA0E 4PIRA 3O1IA 3DJBA 2KZ7B 4F8HA 4O8SA 3O9XA 2L3LA 1NEKA 3C84A 2E2AA 4YJ3E 5AFUL 5L3BB 2XZ6A 4YSZA 4PW8A 2PBIA 4UVAB 3Q2MA 2YN6A 3EI0A 3EDUA 3B5MA 2Y6XA 3P4PA 3AAEB 2LHNA 2XPKA 3TLUA 3RYHE 3P4WA 4UVCB 1CUNA 1EZ3A 3BQIA 3KVAA 2BS2A 4LMLA 2MPKA 2Y8DA 4ILAA 3F57A 3UUBA 2WMNA 5CFBA 5J5FA 2WNCA 2WWUA 4UV9B 2BKOA 2WS3A 2UXCT 3AE2A 3FZKB 4ALXA 4O4LE 4O4IE 3RYCE 1W0BA 2LOSA 4HWFA 4QXBB 3NZQA 2DWGA 2V6YA 4H9NC 4NZBA 2DCFA 1FMVA 3RF1A 3PURA 5AQHB 5FMNA 2X0YA 3KVBA 4WNKA 1YD8G 4EZ4A 2A2FX 4JI0T 5FL1A 5LBMA 3IBPA 4DV5T 1OEDB 1M7KA 5JR9B 3AEEA 3UUNA 1XMQT 5AQOB 3ETVA 5LHHB 2BYNA 2WWVA 3LJCA 5FY7A 2WAUA 4KI0F 1I6ZA 5JREA 3LK3B 3RIUC 4DR7T 2BYQA 4ZI2D 2BDEA 5FYMA 3SRZA 4DBQA 2VURA 1G73A 3L3PA 2Y58A 3C98B 5HEUA 3FBLA 5AQPB 2XQ6A 2VL0A 2X9YA 4L5GA 3VU7H 2Q9QB 2XTLA 3J9X1 3SWHA 2L8KA 4TUYE 2D0UA 2W00A 3Q5WA 1LKXA 4ZK4A 2UUBT 1N32T 2RP4A 2WZIA 4CN1A 3AE3A 5FY0A 3ZMTB 2UZ6A 2IAKA 4U72A 2ACXA 3WTOA 3RH3A 4DMVA 3N9QA 4Z8XA 1J1JA 1UX5A 1VCTA 2WSSV 1D0ZA 4IE7A 4QHOA 2W2UA 5HYAA 5HEHA 3OTOT 2PTFA 3TLVA 5AQRB 2V7MA 4HFCA 4JI1T 4PK4A 5AQGB 4WYVA 3VHLA 2ZM8A 1MNDA 3ONLC 3ZSTA 4IDPA 3CQXC 3PUQA 2XM1A 3WTKA 4DV4T 2VKJA 1SA0E 3AE6A 5AQLB 2CCQA 2E9XB 2ZJVA 3O1HA 3ZMZB 2W67A 5KDMC 3ESLA 2CLYC 4UXUA 4EIWA 2VKOA 3WAJA 4GK0E 4MLKA 3WTLA 3KINB 4QH5A 4HE8A 4NIQA 4A97A 2VK9A 3V5UA 1UX2A 2H88A 3NVOA 5LGUB 3AA7B 5AQVB 2WCAA 2YKSA 3RHWA 3VRBA 5TAOA 2I0MA 2W61A 5CO5A 2JMHA 3UU3A 3I9YA 4WW0A 1OEDA 4TWFA 5JR9A 3SQ6A 2VVNA 4QH4A 1OEDC 1W09A 4YFSA 3ZJ1A 2OLTA 2UUAT 4UM3P 4A5XA 4JI5T 3RYFE 4X1YE 4HEAA 3SOLA 2MAWA 4UM3S 4YSXA 2BYPA 1W0AA 4MHCA 3W15B 5AQSB 1FMWA 5F8PA 3AXJB 3RQWA 5TVCA 4TNWA 3H37A 1HG5A 1Z8UA 4P1NA 4KBMB 3AAAB 5L4HA 2K9AA 4KHZF 2AE9A 2Q9QA 2WMOA 1YKEB 4C91A 1OWAA 1VRBA 1L0VA 4P0AA 1SHZC 5DABA 3PV0F 5AQNB 2VL8A 3U8KA 3PDYA 5BP0A 1BR4A 4X5TA 4PFOA 2LSIA 3M3ZB 4BAYB 3PUXF 5CJ5A 4X66T 4YT0A 5HXCA 4DR6T 3BK9A 2VB6A 1FIOA 5LMUT 2LM2A 3U8MA 2K3WA 3RPUA 4YJ2E 2KT9A 2X9XA 4JI7T 2BYSA 2BVMA 3UQ7A 2DWKA 3MACA 2WDVA 2E9XA 5F5WA 2ODUA 1HR0T 3PJAJ 3ETUA 4IE4A 2IMLA 4HKAA 3MK7C 2AXDS 2J62A 4H63H 2YMDA 2XZ5A 3MZKB 3J7Yq 5L3DB 3JADA 4LMKA 4HFVA 4PK6A 2WNJA 2X00A 4A56A 4P09A 4PK5A 4AFTA 1SE7A 4NXMT 4AQFA 4UEMA 1OXZA 2XNVA 1E2AA 4DUYT 4JI3T 4AQFC 2LEHA 1FEWA 4BFQA 3KBUA 4ZZCA 4TNVA 5AQTB 2LLYA 5L4EA 2XUEA 3QB5A 4EAHA 2XSAA 2A9UA 1OEDE 4BJMA 2JQHA 2E8IA 1XZYA 3R84B 5CGMA 4UELA 2UXNB 1WLXA 3NKZA 3RX6A 3GN5B 3X1DA 4IHJE 3OJAA 5AQKB 2Y56A 3GWHA 3EDVA 5FXXA 3AXJA 1YQ4A 2HN2A 1KF6A 2IUBA 1WYCA 4QABA 3C4XA 3HKCE 4WV9A 4PAGA 3GA8A 3LK2B 1HG2A 2EHOC 3A5XA 2HN1A 4CQIA 4TV8E 3ANWB 5FY1A 4XZCA 3C4WA 3GUAA 4OFZA 5H6QB 5IHYA 5LA6E 5AFHA 2WB5A 3EHZA 3AE1A 3KV4A 4KP3C 3HA4A 2LSKA 5ETWA 3PUAA 4XHEA 1B7TA 2B1EA 2Y7YA 4U7YA 4JI6T 2EHOD 3NZPA 4IDZA 4KUMB 3CQCB 2XAJB 2V5DA 1N33T 2X66A 4DV2T 2KINB 2JQQA 3RGLA 4YTPA 3VR9A 4DNDA 2DLRA 4H9QC 2MOZA 5EZYE 4NUVA 2BS3A 3CWZB 2X51A 4Q25A 5KXJA 4XBFB 3I0OA 2V26A 3FB2A 3AVSA 2W8GA 3HL6A 4L0RA 3Q5DA 2QRXA 2PJQA 4J2CA 4PFPA 2IC9A 3AE9A 1NENA 3NRXA 2NTXA 2X9WA 1LVKA 4TV9E 2M6IA 2G0UA 2V7LA 5HEOA 4ZEYA 2D5UA 2LE8A 2RPAA 2MTQA 2ZM2A 4NUUA 1D1BA 3CX7B 3UFEA 2N2NA 3ZJ2A 5CA1E 2XZEA 4PJMA 3FHNA 1XDOA 5LGNB 2LSGA 5CB4E 2QGSA 3ZN0B 3GN5A 3IF8B 5LHIB 3JAFA 3L09A 4UV8B 5HEGA 2CLYB 3U3IA 4GKKT 2XY8B 1ZP0A 2SPCA 2YMEA 2LJLA 2N1GA 1U4QA 3NWIA 5HXRA 4BQTA 1UV6A 3P4QA 2BS4A 2IHR1 1T72A 2CE7A 3C51A 3ANWA 4XK9A 4ZI3C 4ZI2C 5L3GB 4I43B 2NW8A 4X62T 2KXPB 4EYYR 1WYBA 4H9PC 4Z91A 5J5IA 4HGAA 4COFA 3AEAA 3ZN1B 1H7CA 2DHRA 2V7KA 2YDSA 4DV3T 4UY2A 5ABEA 4ZK1A 2V5CA 3QB5K 3ABVA 2XNTA 4B3TT 3RIUA 3HKDE 5JDLA 2JIWA 3CQGB 4HTEA 5AQJB 4EEDA 4ZI3D 5HEJA 5J5GA 2BVLA 4TX5A 4YTNA 3PUYF 3AE8A 2DI4A 3UULA 3WTJA 2XNUA 3HI2A 2K5BB 5L3FB 2NOXA 5LJMA 4ISSA 5L3EB 2XSBA 5FVKA 3KDSE 4YLHA 5HXEA 1E7PA 3B13A 3PUZF 3ZPOA 3T1YT 5JDQA 1XDPA 4UF0B 4ERRA 2Y48B 4FRRA 4CN4A 4KHPT 1X9BA 3OYZA 3KV6A 4DR2T 1QUUA 4P0BA 3RRCA 2C5KT 4HFHA 2WBLA 4ZJSA 4MBQA 2HPLA 2LKGA 2MYSA 3ZLIA 3OVUA 5FJVA 1MIYA 3E22E 4YTMA 3CX6B 1GQEA 3WTMA 1XNQT 3UU6A 4ILCA 4IT4A 2KLQA 1N34T 4AFHA 4JLEA 1U5PA 4AFGA 1MNEA 3FZMB 3WTNA 4TZ4C 4E7SA 4JEHB 3T1HT 4LFAT 2Y57A 5H6RB 5J0ZA 4DIDB 2XAQB 4YHHT 4O2BE 1HNZT 3CKDA 2XAGB 2NTYA 4AXPA 1D0YA 2WU2A 2H3RA 3UU4A 3LG7A 4IL4A 2KWIB 2JJ9A 5LP6E 5FNVE 4DV6T 1W9RA 3RIFA 3C50A 3VKHA 2XJ7A 2CEAA 5GONE 5LJNA 4OYJA 4PNIA 2WN9A 5LG3A 2HPJA 3OYXA 2ZM0A 3K1SA 4IDNA 4XAXB 2VASA 4QACA 2MBGA 2VQFT 3MKDA 1I94T 1IBMT 4B6XA 3PEOA 1D1CA 3NBXX 4HWHA 3ZKRA 2J1DG 5JDFA 4GOUA 2CRBA 3QK6A 3AE5A 3TLTA 4HFBA 2EHOB 4JYAT 3P4RA 2OA5A 4DV1T 2PGZA 5BW2A 4NPPA 2YINA 2B76A 5ABFB 2V8SV 4UF0A 4DUZT 2XM2A 1D0XA 4UR9A 4B3RT 2GK9A 1QSDA 3T8OA 2XQ4A 1YQ3A 1LVFA 3RC3A 1D1AA 2FJEA 3WI3A 3RKGA 2CBJA 3P7IA 1VOMA 2XQ7A 1UGOA 2C0SA 2IC6A 3SFDA 2A72A 4NXNT 1US7B 2Y54A 1UW6A 5FP3A 3AA0B 4I55E 5EK4A 1LRZA 2M6BA 3DTOA 5BR8T 4U7IA 5JVDE 2BG9B 2K24A 4G2AA 3ZCJA 2NP9A 4TWHA 1JNRA 3LBXA 4JV5T 1YW0A 2CHOA 4WBNE 5J2TE 5KE4A 3ZC0A 5HWXA 1G8XA 4ZOLE 4AISA 3UUXB 3I0QA 3FXDB 2Z6EA 4CI1B 4FI5A 3ZCIA 3CVRA 3RQUA 5ABGA 3ZT6A 2BR8A 1WR0A 1Y64B 4K0UA 4CI3B 4YXDA 4E7ZA 3UU5A 3IA3A 2E5LT 2X0LB 2QVAA 4GYSA 5JRCA 2WY2A 1J5ET 3PU8A 1NWMX 2X68A 2CXDA 4AIUA 2DL1A 3WIPA 3PTRB 4YHJA 3PUVF 4AKLA 2ODVA 2BZBA 2WP9A 1Z0PA 1MIWA 3RRWA 5LMNT 4PJLA 2JQKA 3UT5E 4JBWF 1HNWT 5BRXA 2JPFA 2VKDA 5EK2A 2X9HA 4WBOA 2LKHA 3EUHA 2X67A 4BJNA 2L9QA 2EHOA 5LXTE 3AVRA 2D9DA 1QLBA 3OBVE 4IE6A 3AA6B 5ABFA 1T98A 2YOEA 3PE0A 1JNZA 3AEDA 3QNUA 4ADZA 2NW7A 4M1PA 3H3AA 4X20E 4GK5E 5JTGA 5HCMA 4ASKA 4QWNB 4X1IE 3QC9A
chains in the Genus database with same CATH topology
4PIRA 2XQ5A 3U8LA 3U8NA 2BYNA 2LKGA 5KE4A 4F8HA 3ZKRA 2ZJVA 4HFIA 1OEDE 4HFEA 5FJVA 2W8GA 3C84A 3TLTA 4XK9A 3U8KA 3TLWA 4HFBA 4UXUA 5BP0A 4X5TA 5AFLA 5AFNA 4DBMA 3C79A 2PGZA 2ZJUA 3WTMA 3SH1A 2XZ6A 4D01A 3UU6A 4ILCA 3WTLA 4QH5A 2YN6A 3EI0A 4Z91A 4A97A 2XQ9A 4NPPA 1UX2A 2BYQA 5BW2A 4IREA 5J5IA 3P50A 4COFA 3ZDGA 4AFHA 3RQUA 2Y56A 2XQ3A 5SYOA 4AFGA 2BJ0A 2BR8A 2BR7A 3TLUA 4TWDA 4UY2A 3WTNA 3UU5A 4ZK1A 2Y58A 2BG9A 3P4WA 2XQAA 2YKSA 2M6IA 3RHWA 5HEOA 2W8FA 5HEUA 4QABA 2BG9C 2Y57A 3ZDHA 2LM2A 2XQ6A 2XNTA 3U8MA 2VL0A 5CO5A 4EZ1A 4WV9A 5AFMA 2XQ4A 3UU3A 4LMLA 5J0ZA 1OEDA 4ILAA 4TWFA 2WNLA 3WIPA 3WTIA 4ZK4A 3LSVA 2BYSA 5AINA 3TLSA 3UUBA 3SQ6A 5CFBA 4Z90A 5J5FA 5HEJA 2WNCA 4QH4A 1OEDC 2XQ7A 3UQ7A 5J5GA 2QC1B 4HQPA 2UZ6A 2C9TA 3WTHA 4ALXA 2XYTA 3RIAA 4UM3P 2Y54A 3UU4A 2XNUA 3GUAA 3WTJA 1UW6A 3EAMA 5AFHA 3UU8A 3EHZA 5BRXA 5JMEA 4IL4A 2BYRA 3U8JA 3WTOA 5AFKA 2LKHA 5HCJA 2MAWA 3PMZA 4UM3S 1I9BA 2BYPA 2YMDA 3RIFA 2XZ5A 3RI5A 5KZUA 5L47A 3JADA 4A98A 2PH9A 4NZBA 4QH1A 4LMKA 2X00A 2WNJA 4UM3A 2M6BA 4XHEA 2WN9A 3JAFA 5LG3A 2Y7YA 5HEHA 4AFTA 5LXBA 5J5HA 2YOEA 5HEGA 3TLVA 4ZR6A 3RQWA 5AFJA 3T4MA 2WZYA 2BG9B 5IUXA 4FRRA 4TNWA 5TVCA 2KSRA 4HFCA 2XNVA 4IL9A 4ZZBA 2XQ8A 4HFDA 5L4HA 2YMEA 4BFQA 4UM1A 2X00D 4B5DA 4QACA 5AFMB 3SQ9A 2XYSA 4ZZCA 4ZJTA 4ILBA 4TNVA 3IGQA 4ZRUA 2BG9E 5HCMA 4TWHA 3JAEA 2LLYA 4BQTA 1OEDB 3WTKA 3UQ4A 3PEOA 5L4EA 1UV6A 4LMJA 4QAAA 4HFHA 3SIOA 4ZJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PIR A;  2XQ5 A;  3U8L A;  3U8N A;  2BYN A;  2LKG A;  5KE4 A;  4F8H A;  3ZKR A;  2ZJV A;  4HFI A;  1OED E;  4HFE A;  5FJV A;  2W8G A;  3C84 A;  3TLT A;  4XK9 A;  3U8K A;  3TLW A;  4HFB A;  4UXU A;  5BP0 A;  4X5T A;  5AFL A;  5AFN A;  4DBM A;  3C79 A;  2PGZ A;  2ZJU A;  3WTM A;  3SH1 A;  2XZ6 A;  4D01 A;  3UU6 A;  4ILC A;  3WTL A;  4QH5 A;  2YN6 A;  3EI0 A;  4Z91 A;  4A97 A;  2XQ9 A;  4NPP A;  1UX2 A;  2BYQ A;  5BW2 A;  4IRE A;  5J5I A;  3P50 A;  4COF A;  3ZDG A;  4AFH A;  3RQU A;  2Y56 A;  2XQ3 A;  5SYO A;  4AFG A;  2BJ0 A;  2BR8 A;  2BR7 A;  3TLU A;  4TWD A;  4UY2 A;  3WTN A;  3UU5 A;  4ZK1 A;  2Y58 A;  2BG9 A;  3P4W A;  2XQA A;  2YKS A;  2M6I A;  3RHW A;  5HEO A;  2W8F A;  5HEU A;  4QAB A;  2BG9 C;  2Y57 A;  3ZDH A;  2LM2 A;  2XQ6 A;  2XNT A;  3U8M A;  2VL0 A;  5CO5 A;  4EZ1 A;  4WV9 A;  5AFM A;  2XQ4 A;  3UU3 A;  4LML A;  5J0Z A;  1OED A;  4ILA A;  4TWF A;  2WNL A;  3WIP A;  3WTI A;  4ZK4 A;  3LSV A;  2BYS A;  5AIN A;  3TLS A;  3UUB A;  3SQ6 A;  5CFB A;  4Z90 A;  5J5F A;  5HEJ A;  2WNC A;  4QH4 A;  1OED C;  2XQ7 A;  3UQ7 A;  5J5G A;  2QC1 B;  4HQP A;  2UZ6 A;  2C9T A;  3WTH A;  4ALX A;  2XYT A;  3RIA A;  4UM3 P;  2Y54 A;  3UU4 A;  2XNU A;  3GUA A;  3WTJ A;  1UW6 A;  3EAM A;  5AFH A;  3UU8 A;  3EHZ A;  5BRX A;  5JME A;  4IL4 A;  2BYR A;  3U8J A;  3WTO A;  5AFK A;  2LKH A;  5HCJ A;  2MAW A;  3PMZ A;  4UM3 S;  1I9B A;  2BYP A;  2YMD A;  3RIF A;  2XZ5 A;  3RI5 A;  5KZU A;  5L47 A;  3JAD A;  4A98 A;  2PH9 A;  4NZB A;  4QH1 A;  4LMK A;  2X00 A;  2WNJ A;  4UM3 A;  2M6B A;  4XHE A;  2WN9 A;  3JAF A;  5LG3 A;  2Y7Y A;  5HEH A;  4AFT A;  5LXB A;  5J5H A;  2YOE A;  5HEG A;  3TLV A;  4ZR6 A;  3RQW A;  5AFJ A;  3T4M A;  2WZY A;  2BG9 B;  5IUX A;  4FRR A;  4TNW A;  5TVC A;  2KSR A;  4HFC A;  2XNV A;  4IL9 A;  4ZZB A;  2XQ8 A;  4HFD A;  5L4H A;  2YME A;  4BFQ A;  4UM1 A;  2X00 D;  4B5D A;  4QAC A;  5AFM B;  3SQ9 A;  2XYS A;  4ZZC A;  4ZJT A;  4ILB A;  4TNV A;  3IGQ A;  4ZRU A;  2BG9 E;  5HCM A;  4TWH A;  3JAE A;  2LLY A;  4BQT A;  1OED B;  3WTK A;  3UQ4 A;  3PEO A;  5L4E A;  1UV6 A;  4LMJ A;  4QAA A;  4HFH A;  3SIO A;  4ZJS A; 
#chains in the Genus database with same CATH topology
 4U33 A;  4QX8 B;  4U2Z A;  2PG8 A;  3U8N A;  2VWA A;  3KFW X;  4UXN B;  4HFI A;  4O4H E;  5J1G A;  4U2Y A;  4IE5 A;  3KV9 A;  4DBM A;  3IEE A;  4H9O C;  4D01 A;  3PUW F;  4AI6 A;  3IHR A;  5HXS A;  2HH7 A;  2LM9 A;  4HWC A;  5LG4 A;  3NRY A;  2W4X A;  1WR6 A;  4YY3 T;  1MMN A;  5LB7 B;  3C4Z A;  2BG9 A;  2M67 A;  2W8F A;  2V7J A;  4QXH B;  3AB3 B;  2BG9 C;  4EZH A;  4H63 V;  2LSY A;  3OPC A;  5FXZ A;  2A3D A;  3RLF F;  3G06 A;  2HHH T;  2W0G A;  4DV0 T;  4CXW A;  3AAI A;  3DP7 A;  4Z90 A;  3N9L A;  5IYZ E;  3CK6 A;  3M65 A;  5FXV A;  3N2K E;  2J4G A;  2CPT A;  3AEG A;  4N78 D;  3UU8 A;  3BQL A;  1BR2 A;  4ZS2 A;  2CM0 A;  2YDQ A;  3Q5E A;  3SS1 A;  3ZYK A;  3FXE B;  5KZU A;  3Q9D A;  4UM3 A;  3AE4 A;  2IW5 B;  5J5H A;  5AFJ A;  2RA1 A;  4TN7 B;  4UIG A;  1M62 A;  2CXL A;  5AFM B;  2UXX B;  2XYS A;  3LK4 2;  3UQ4 A;  5JDG A;  4QAA A;  4YSY A;  1HFA A;  1UCU A;  3L39 A;  1HNX T;  5KX5 E;  1HCI A;  1Y01 A;  4CI2 B;  4HFE A;  4EOZ B;  2WZH A;  4IDQ A;  3TLW A;  4QKN A;  3U78 A;  3CML A;  5AQM B;  3O1J A;  2NR4 A;  2XQ9 A;  1J5W A;  3P50 A;  4B3S T;  4X1K E;  2BJ0 A;  1YKH B;  2VVS A;  4JI2 T;  1R8I A;  4LFC T;  3VR8 A;  2XAH B;  4LF6 T;  4LF5 T;  3K3N A;  2WQY A;  3ZSS A;  4H9R C;  3EAB A;  2W62 A;  3LSV A;  4EB6 E;  5M4Y A;  1MMA A;  3FZF B;  3UTK A;  1N36 T;  2QA7 A;  3K3O A;  5AFK A;  3PUG A;  1HS7 A;  3PMZ A;  1I9B A;  5L47 A;  2WM9 A;  4A98 A;  3O4X E;  2BKP A;  2NW9 A;  5JDH A;  1VCS A;  1ZOY A;  3K3Q C;  4KX6 A;  3ZT5 A;  3T4M A;  3JC6 C;  2XQY A;  4AKI A;  4BA9 A;  1MMD A;  3EVY A;  2W66 A;  4ZJT A;  2BG9 E;  2YEV C;  2WDQ A;  2V6X A;  2WDR A;  1WCR A;  5JH7 E;  4CZZ B;  5DJQ C;  3AE7 A;  1KEY A;  3N2G E;  1ZEE A;  3PJA A;  4GKJ T;  4I4T E;  1KNZ A;  2VKH A;  2W63 A;  3JC6 D;  3AEB A;  3N9O A;  2XAS B;  4IRE A;  4AKG A;  5L3C B;  2ES0 A;  4LF8 T;  2UUC T;  2BR7 A;  2LT3 A;  2DNX A;  3VKG A;  3V5S A;  2UXD T;  4QX7 B;  3C64 A;  2YDR A;  2IDO B;  1CHU A;  2C5I T;  3ZYM A;  1NAF A;  5AFM A;  5L2L A;  4FJO A;  5HAX A;  1UX4 A;  1HF8 A;  2FBW A;  2E5V A;  2JQ9 A;  4IGU A;  5C3J A;  2QC1 B;  4AQY T;  3N9M A;  2C9T A;  1HTJ F;  2D2S A;  1DU2 A;  2X0H A;  4JUY A;  3U8J A;  2BYR A;  1UK5 A;  3F31 A;  4WZX A;  5HCJ A;  5C8Y E;  4V1A v;  2JMK A;  3AA1 B;  3LBX B;  3RI5 A;  4DR5 T;  4GYR A;  5LNK A;  2LSJ A;  4DR3 T;  2VQE T;  4AQG A;  4ZR6 A;  2BBJ A;  5IUX A;  1MMG A;  5DQV A;  4DBR A;  3MJX A;  4UM1 A;  5KMG P;  2FUP A;  5AQU B;  3IGQ A;  3RC8 A;  4ZRU A;  2K48 A;  1WFD A;  3ZEF B;  2I6H A;  5FKY A;  1IBK T;  2KND A;  5C2T A;  5AQF B;  3BQK A;  1IBL T;  3FBZ A;  5JRC B;  5JDN A;  5IWA T;  3E0Z A;  2ZJU A;  2LHR A;  3PUS A;  3E08 A;  3N9P A;  1IAP A;  2CXF A;  5JR9 C;  1T7S A;  1UUS A;  4CN6 A;  1SUM B;  4TWD A;  5HXH A;  2N9D A;  4X64 T;  2ACZ A;  2UU9 T;  3OKQ A;  2V1D B;  4DVD A;  4CXX A;  4EZ1 A;  5FVL A;  2J47 A;  1S35 A;  4F6R C;  1HX8 A;  5JQG E;  3WAK A;  3P8C D;  4PJN A;  2XHE B;  5JME A;  3RYI E;  3HR0 A;  5LHG B;  4K0K T;  3KBT A;  2D0T A;  2Q9Q C;  4QH1 A;  4HWI B;  4ZHQ E;  1ZHC A;  3ONX A;  4OYK A;  2YU1 A;  4DR1 T;  3H3M A;  4ANJ A;  4IL9 A;  4ZZB A;  4HFD A;  5LOV E;  4I0U A;  1ZKE A;  1AJ3 A;  2CBI A;  3ZYL A;  3I9W A;  4LF9 T;  5EK3 A;  4OX9 T;  2H7O A;  3U8L A;  1IJ5 A;  1IZN B;  2BBH A;  4IDO A;  4ILU A;  1ZV4 X;  3R6N A;  2P9B A;  2Q9Q D;  1BR0 A;  5AFN A;  4X65 T;  2FJB A;  4C90 A;  3SH1 A;  2FJD A;  2CWO A;  2F4V T;  4MAL A;  4AKH A;  3ZDG A;  5LYJ E;  4HN9 A;  4O4J E;  3MXZ A;  3MA9 A;  2H89 A;  5ADX L;  1O3X A;  4B3M T;  3TKL B;  3K8P C;  3HKE E;  2LRL A;  1XMO T;  1V9D A;  2XQA A;  2E9X C;  5J2U E;  5E0O A;  3RKO A;  2I59 A;  3ZDH A;  4L9I A;  4LFB T;  2QYW A;  5FXW A;  3UFG A;  4U74 A;  4JI8 T;  5FL0 A;  3ZT7 A;  4HQP A;  4MFR A;  1HX1 B;  4PJJ A;  4CXY A;  4HWD A;  1BR1 A;  2YK0 A;  3GMI A;  3AEC A;  5BMV E;  4EXT A;  2XAF B;  2CA5 A;  3LFM A;  1FJG T;  4IE0 A;  2E9X D;  4ZI7 E;  2C5J A;  5JDM A;  4DMW A;  3ZMV B;  4ZXL A;  5LXB A;  4H9S E;  3JCF A;  2WZY A;  2KSR A;  3KV5 A;  1XNR T;  2XQ8 A;  3F2E A;  5AQI B;  2X00 D;  2KMF A;  2FJA A;  3A8Y C;  4LF4 T;  3HKB E;  3QOF A;  1KNR A;  3L8R A;  3D0T A;  2YU2 A;  3ONJ A;  3SIO A;  1S94 A;  4DV7 T;  2JRK A;  2XQ5 A;  3P4S A;  4JI4 T;  1XWM A;  4GIW A;  4EGW A;  4UVB B;  5DQW A;  2IIU A;  1E1H B;  3UUM A;  3FZL B;  2KWH A;  4G63 A;  5AFL A;  3I1A A;  2V6Y B;  3C79 A;  3B57 A;  4QXC B;  1UUR A;  1X79 A;  4OHF A;  4EV6 A;  2XQ3 A;  4U3C A;  5SYO A;  4IIJ E;  2LRK A;  1KFY A;  3N2O A;  3CPZ A;  2ZMA A;  2ZM6 T;  3S4U A;  1KNP A;  4DR4 T;  2WU5 A;  2LOP A;  2UXB T;  2V7I A;  4EYU A;  2PFV A;  1IJ6 A;  3SFE A;  3N9N A;  2WNL A;  2ZLY A;  3WTI A;  5AIN A;  3TLS A;  1T8B A;  3ZMS B;  1MIV A;  3WTH A;  3N5L A;  2XYT A;  3RIA A;  2NWB A;  3ZMU B;  5LGT B;  3A7M A;  3EAM A;  5LBQ B;  5AQQ B;  3CIR A;  4U31 A;  5A1L A;  4LF7 T;  3CX8 B;  5HWY A;  2CMR A;  3ZC1 A;  1YXR A;  4OK0 A;  2PH9 A;  3LDQ B;  2CWY A;  3AEF A;  2H7V C;  3QUJ A;  4I50 E;  1KK7 A;  2R6G F;  4EEB A;  3PU3 A;  4O2A E;  5LCY A;  2CHN A;  2BKN A;  3Q5X A;  4IST A;  3VRA A;  5F3J A;  3FZH B;  4DO0 A;  4AKR B;  4B5D A;  3SQ9 A;  2OV9 A;  4ILB A;  3JAE A;  4ZS3 A;  4LMJ A;  5ABH A;  4KMC A;  1WRD A;  4JEU B;  5CA0 E;  4PIR A;  3O1I A;  3DJB A;  2KZ7 B;  4F8H A;  4O8S A;  3O9X A;  2L3L A;  1NEK A;  3C84 A;  2E2A A;  4YJ3 E;  5AFU L;  5L3B B;  2XZ6 A;  4YSZ A;  4PW8 A;  2PBI A;  4UVA B;  3Q2M A;  2YN6 A;  3EI0 A;  3EDU A;  3B5M A;  2Y6X A;  3P4P A;  3AAE B;  2LHN A;  2XPK A;  3TLU A;  3RYH E;  3P4W A;  4UVC B;  1CUN A;  1EZ3 A;  3BQI A;  3KVA A;  2BS2 A;  4LML A;  2MPK A;  2Y8D A;  4ILA A;  3F57 A;  3UUB A;  2WMN A;  5CFB A;  5J5F A;  2WNC A;  2WWU A;  4UV9 B;  2BKO A;  2WS3 A;  2UXC T;  3AE2 A;  3FZK B;  4ALX A;  4O4L E;  4O4I E;  3RYC E;  1W0B A;  2LOS A;  4HWF A;  4QXB B;  3NZQ A;  2DWG A;  2V6Y A;  4H9N C;  4NZB A;  2DCF A;  1FMV A;  3RF1 A;  3PUR A;  5AQH B;  5FMN A;  2X0Y A;  3KVB A;  4WNK A;  1YD8 G;  4EZ4 A;  2A2F X;  4JI0 T;  5FL1 A;  5LBM A;  3IBP A;  4DV5 T;  1OED B;  1M7K A;  5JR9 B;  3AEE A;  3UUN A;  1XMQ T;  5AQO B;  3ETV A;  5LHH B;  2BYN A;  2WWV A;  3LJC A;  5FY7 A;  2WAU A;  4KI0 F;  1I6Z A;  5JRE A;  3LK3 B;  3RIU C;  4DR7 T;  2BYQ A;  4ZI2 D;  2BDE A;  5FYM A;  3SRZ A;  4DBQ A;  2VUR A;  1G73 A;  3L3P A;  2Y58 A;  3C98 B;  5HEU A;  3FBL A;  5AQP B;  2XQ6 A;  2VL0 A;  2X9Y A;  4L5G A;  3VU7 H;  2Q9Q B;  2XTL A;  3J9X 1;  3SWH A;  2L8K A;  4TUY E;  2D0U A;  2W00 A;  3Q5W A;  1LKX A;  4ZK4 A;  2UUB T;  1N32 T;  2RP4 A;  2WZI A;  4CN1 A;  3AE3 A;  5FY0 A;  3ZMT B;  2UZ6 A;  2IAK A;  4U72 A;  2ACX A;  3WTO A;  3RH3 A;  4DMV A;  3N9Q A;  4Z8X A;  1J1J A;  1UX5 A;  1VCT A;  2WSS V;  1D0Z A;  4IE7 A;  4QHO A;  2W2U A;  5HYA A;  5HEH A;  3OTO T;  2PTF A;  3TLV A;  5AQR B;  2V7M A;  4HFC A;  4JI1 T;  4PK4 A;  5AQG B;  4WYV A;  3VHL A;  2ZM8 A;  1MND A;  3ONL C;  3ZST A;  4IDP A;  3CQX C;  3PUQ A;  2XM1 A;  3WTK A;  4DV4 T;  2VKJ A;  1SA0 E;  3AE6 A;  5AQL B;  2CCQ A;  2E9X B;  2ZJV A;  3O1H A;  3ZMZ B;  2W67 A;  5KDM C;  3ESL A;  2CLY C;  4UXU A;  4EIW A;  2VKO A;  3WAJ A;  4GK0 E;  4MLK A;  3WTL A;  3KIN B;  4QH5 A;  4HE8 A;  4NIQ A;  4A97 A;  2VK9 A;  3V5U A;  1UX2 A;  2H88 A;  3NVO A;  5LGU B;  3AA7 B;  5AQV B;  2WCA A;  2YKS A;  3RHW A;  3VRB A;  5TAO A;  2I0M A;  2W61 A;  5CO5 A;  2JMH A;  3UU3 A;  3I9Y A;  4WW0 A;  1OED A;  4TWF A;  5JR9 A;  3SQ6 A;  2VVN A;  4QH4 A;  1OED C;  1W09 A;  4YFS A;  3ZJ1 A;  2OLT A;  2UUA T;  4UM3 P;  4A5X A;  4JI5 T;  3RYF E;  4X1Y E;  4HEA A;  3SOL A;  2MAW A;  4UM3 S;  4YSX A;  2BYP A;  1W0A A;  4MHC A;  3W15 B;  5AQS B;  1FMW A;  5F8P A;  3AXJ B;  3RQW A;  5TVC A;  4TNW A;  3H37 A;  1HG5 A;  1Z8U A;  4P1N A;  4KBM B;  3AAA B;  5L4H A;  2K9A A;  4KHZ F;  2AE9 A;  2Q9Q A;  2WMO A;  1YKE B;  4C91 A;  1OWA A;  1VRB A;  1L0V A;  4P0A A;  1SHZ C;  5DAB A;  3PV0 F;  5AQN B;  2VL8 A;  3U8K A;  3PDY A;  5BP0 A;  1BR4 A;  4X5T A;  4PFO A;  2LSI A;  3M3Z B;  4BAY B;  3PUX F;  5CJ5 A;  4X66 T;  4YT0 A;  5HXC A;  4DR6 T;  3BK9 A;  2VB6 A;  1FIO A;  5LMU T;  2LM2 A;  3U8M A;  2K3W A;  3RPU A;  4YJ2 E;  2KT9 A;  2X9X A;  4JI7 T;  2BYS A;  2BVM A;  3UQ7 A;  2DWK A;  3MAC A;  2WDV A;  2E9X A;  5F5W A;  2ODU A;  1HR0 T;  3PJA J;  3ETU A;  4IE4 A;  2IML A;  4HKA A;  3MK7 C;  2AXD S;  2J62 A;  4H63 H;  2YMD A;  2XZ5 A;  3MZK B;  3J7Y q;  5L3D B;  3JAD A;  4LMK A;  4HFV A;  4PK6 A;  2WNJ A;  2X00 A;  4A56 A;  4P09 A;  4PK5 A;  4AFT A;  1SE7 A;  4NXM T;  4AQF A;  4UEM A;  1OXZ A;  2XNV A;  1E2A A;  4DUY T;  4JI3 T;  4AQF C;  2LEH A;  1FEW A;  4BFQ A;  3KBU A;  4ZZC A;  4TNV A;  5AQT B;  2LLY A;  5L4E A;  2XUE A;  3QB5 A;  4EAH A;  2XSA A;  2A9U A;  1OED E;  4BJM A;  2JQH A;  2E8I A;  1XZY A;  3R84 B;  5CGM A;  4UEL A;  2UXN B;  1WLX A;  3NKZ A;  3RX6 A;  3GN5 B;  3X1D A;  4IHJ E;  3OJA A;  5AQK B;  2Y56 A;  3GWH A;  3EDV A;  5FXX A;  3AXJ A;  1YQ4 A;  2HN2 A;  1KF6 A;  2IUB A;  1WYC A;  4QAB A;  3C4X A;  3HKC E;  4WV9 A;  4PAG A;  3GA8 A;  3LK2 B;  1HG2 A;  2EHO C;  3A5X A;  2HN1 A;  4CQI A;  4TV8 E;  3ANW B;  5FY1 A;  4XZC A;  3C4W A;  3GUA A;  4OFZ A;  5H6Q B;  5IHY A;  5LA6 E;  5AFH A;  2WB5 A;  3EHZ A;  3AE1 A;  3KV4 A;  4KP3 C;  3HA4 A;  2LSK A;  5ETW A;  3PUA A;  4XHE A;  1B7T A;  2B1E A;  2Y7Y A;  4U7Y A;  4JI6 T;  2EHO D;  3NZP A;  4IDZ A;  4KUM B;  3CQC B;  2XAJ B;  2V5D A;  1N33 T;  2X66 A;  4DV2 T;  2KIN B;  2JQQ A;  3RGL A;  4YTP A;  3VR9 A;  4DND A;  2DLR A;  4H9Q C;  2MOZ A;  5EZY E;  4NUV A;  2BS3 A;  3CWZ B;  2X51 A;  4Q25 A;  5KXJ A;  4XBF B;  3I0O A;  2V26 A;  3FB2 A;  3AVS A;  2W8G A;  3HL6 A;  4L0R A;  3Q5D A;  2QRX A;  2PJQ A;  4J2C A;  4PFP A;  2IC9 A;  3AE9 A;  1NEN A;  3NRX A;  2NTX A;  2X9W A;  1LVK A;  4TV9 E;  2M6I A;  2G0U A;  2V7L A;  5HEO A;  4ZEY A;  2D5U A;  2LE8 A;  2RPA A;  2MTQ A;  2ZM2 A;  4NUU A;  1D1B A;  3CX7 B;  3UFE A;  2N2N A;  3ZJ2 A;  5CA1 E;  2XZE A;  4PJM A;  3FHN A;  1XDO A;  5LGN B;  2LSG A;  5CB4 E;  2QGS A;  3ZN0 B;  3GN5 A;  3IF8 B;  5LHI B;  3JAF A;  3L09 A;  4UV8 B;  5HEG A;  2CLY B;  3U3I A;  4GKK T;  2XY8 B;  1ZP0 A;  2SPC A;  2YME A;  2LJL A;  2N1G A;  1U4Q A;  3NWI A;  5HXR A;  4BQT A;  1UV6 A;  3P4Q A;  2BS4 A;  2IHR 1;  1T72 A;  2CE7 A;  3C51 A;  3ANW A;  4XK9 A;  4ZI3 C;  4ZI2 C;  5L3G B;  4I43 B;  2NW8 A;  4X62 T;  2KXP B;  4EYY R;  1WYB A;  4H9P C;  4Z91 A;  5J5I A;  4HGA A;  4COF A;  3AEA A;  3ZN1 B;  1H7C A;  2DHR A;  2V7K A;  2YDS A;  4DV3 T;  4UY2 A;  5ABE A;  4ZK1 A;  2V5C A;  3QB5 K;  3ABV A;  2XNT A;  4B3T T;  3RIU A;  3HKD E;  5JDL A;  2JIW A;  3CQG B;  4HTE A;  5AQJ B;  4EED A;  4ZI3 D;  5HEJ A;  5J5G A;  2BVL A;  4TX5 A;  4YTN A;  3PUY F;  3AE8 A;  2DI4 A;  3UUL A;  3WTJ A;  2XNU A;  3HI2 A;  2K5B B;  5L3F B;  2NOX A;  5LJM A;  4ISS A;  5L3E B;  2XSB A;  5FVK A;  3KDS E;  4YLH A;  5HXE A;  1E7P A;  3B13 A;  3PUZ F;  3ZPO A;  3T1Y T;  5JDQ A;  1XDP A;  4UF0 B;  4ERR A;  2Y48 B;  4FRR A;  4CN4 A;  4KHP T;  1X9B A;  3OYZ A;  3KV6 A;  4DR2 T;  1QUU A;  4P0B A;  3RRC A;  2C5K T;  4HFH A;  2WBL A;  4ZJS A;  4MBQ A;  2HPL A;  2LKG A;  2MYS A;  3ZLI A;  3OVU A;  5FJV A;  1MIY A;  3E22 E;  4YTM A;  3CX6 B;  1GQE A;  3WTM A;  1XNQ T;  3UU6 A;  4ILC A;  4IT4 A;  2KLQ A;  1N34 T;  4AFH A;  4JLE A;  1U5P A;  4AFG A;  1MNE A;  3FZM B;  3WTN A;  4TZ4 C;  4E7S A;  4JEH B;  3T1H T;  4LFA T;  2Y57 A;  5H6R B;  5J0Z A;  4DID B;  2XAQ B;  4YHH T;  4O2B E;  1HNZ T;  3CKD A;  2XAG B;  2NTY A;  4AXP A;  1D0Y A;  2WU2 A;  2H3R A;  3UU4 A;  3LG7 A;  4IL4 A;  2KWI B;  2JJ9 A;  5LP6 E;  5FNV E;  4DV6 T;  1W9R A;  3RIF A;  3C50 A;  3VKH A;  2XJ7 A;  2CEA A;  5GON E;  5LJN A;  4OYJ A;  4PNI A;  2WN9 A;  5LG3 A;  2HPJ A;  3OYX A;  2ZM0 A;  3K1S A;  4IDN A;  4XAX B;  2VAS A;  4QAC A;  2MBG A;  2VQF T;  3MKD A;  1I94 T;  1IBM T;  4B6X A;  3PEO A;  1D1C A;  3NBX X;  4HWH A;  3ZKR A;  2J1D G;  5JDF A;  4GOU A;  2CRB A;  3QK6 A;  3AE5 A;  3TLT A;  4HFB A;  2EHO B;  4JYA T;  3P4R A;  2OA5 A;  4DV1 T;  2PGZ A;  5BW2 A;  4NPP A;  2YIN A;  2B76 A;  5ABF B;  2V8S V;  4UF0 A;  4DUZ T;  2XM2 A;  1D0X A;  4UR9 A;  4B3R T;  2GK9 A;  1QSD A;  3T8O A;  2XQ4 A;  1YQ3 A;  1LVF A;  3RC3 A;  1D1A A;  2FJE A;  3WI3 A;  3RKG A;  2CBJ A;  3P7I A;  1VOM A;  2XQ7 A;  1UGO A;  2C0S A;  2IC6 A;  3SFD A;  2A72 A;  4NXN T;  1US7 B;  2Y54 A;  1UW6 A;  5FP3 A;  3AA0 B;  4I55 E;  5EK4 A;  1LRZ A;  2M6B A;  3DTO A;  5BR8 T;  4U7I A;  5JVD E;  2BG9 B;  2K24 A;  4G2A A;  3ZCJ A;  2NP9 A;  4TWH A;  1JNR A;  3LBX A;  4JV5 T;  1YW0 A;  2CHO A;  4WBN E;  5J2T E;  5KE4 A;  3ZC0 A;  5HWX A;  1G8X A;  4ZOL E;  4AIS A;  3UUX B;  3I0Q A;  3FXD B;  2Z6E A;  4CI1 B;  4FI5 A;  3ZCI A;  3CVR A;  3RQU A;  5ABG A;  3ZT6 A;  2BR8 A;  1WR0 A;  1Y64 B;  4K0U A;  4CI3 B;  4YXD A;  4E7Z A;  3UU5 A;  3IA3 A;  2E5L T;  2X0L B;  2QVA A;  4GYS A;  5JRC A;  2WY2 A;  1J5E T;  3PU8 A;  1NWM X;  2X68 A;  2CXD A;  4AIU A;  2DL1 A;  3WIP A;  3PTR B;  4YHJ A;  3PUV F;  4AKL A;  2ODV A;  2BZB A;  2WP9 A;  1Z0P A;  1MIW A;  3RRW A;  5LMN T;  4PJL A;  2JQK A;  3UT5 E;  4JBW F;  1HNW T;  5BRX A;  2JPF A;  2VKD A;  5EK2 A;  2X9H A;  4WBO A;  2LKH A;  3EUH A;  2X67 A;  4BJN A;  2L9Q A;  2EHO A;  5LXT E;  3AVR A;  2D9D A;  1QLB A;  3OBV E;  4IE6 A;  3AA6 B;  5ABF A;  1T98 A;  2YOE A;  3PE0 A;  1JNZ A;  3AED A;  3QNU A;  4ADZ A;  2NW7 A;  4M1P A;  3H3A A;  4X20 E;  4GK5 E;  5JTG A;  5HCM A;  4ASK A;  4QWN B;  4X1I E;  3QC9 A; 
#chains in the Genus database with same CATH homology
 4PIR A;  2XQ5 A;  3U8L A;  3U8N A;  2BYN A;  2LKG A;  5KE4 A;  4F8H A;  3ZKR A;  2ZJV A;  4HFI A;  1OED E;  4HFE A;  5FJV A;  2W8G A;  3C84 A;  3TLT A;  4XK9 A;  3U8K A;  3TLW A;  4HFB A;  4UXU A;  5BP0 A;  4X5T A;  5AFL A;  5AFN A;  4DBM A;  3C79 A;  2PGZ A;  2ZJU A;  3WTM A;  3SH1 A;  2XZ6 A;  4D01 A;  3UU6 A;  4ILC A;  3WTL A;  4QH5 A;  2YN6 A;  3EI0 A;  4Z91 A;  4A97 A;  2XQ9 A;  4NPP A;  1UX2 A;  2BYQ A;  5BW2 A;  4IRE A;  5J5I A;  3P50 A;  4COF A;  3ZDG A;  4AFH A;  3RQU A;  2Y56 A;  2XQ3 A;  5SYO A;  4AFG A;  2BJ0 A;  2BR8 A;  2BR7 A;  3TLU A;  4TWD A;  4UY2 A;  3WTN A;  3UU5 A;  4ZK1 A;  2Y58 A;  2BG9 A;  3P4W A;  2XQA A;  2YKS A;  2M6I A;  3RHW A;  5HEO A;  2W8F A;  5HEU A;  4QAB A;  2BG9 C;  2Y57 A;  3ZDH A;  2LM2 A;  2XQ6 A;  2XNT A;  3U8M A;  2VL0 A;  5CO5 A;  4EZ1 A;  4WV9 A;  5AFM A;  2XQ4 A;  3UU3 A;  4LML A;  5J0Z A;  1OED A;  4ILA A;  4TWF A;  2WNL A;  3WIP A;  3WTI A;  4ZK4 A;  3LSV A;  2BYS A;  5AIN A;  3TLS A;  3UUB A;  3SQ6 A;  5CFB A;  4Z90 A;  5J5F A;  5HEJ A;  2WNC A;  4QH4 A;  1OED C;  2XQ7 A;  3UQ7 A;  5J5G A;  2QC1 B;  4HQP A;  2UZ6 A;  2C9T A;  3WTH A;  4ALX A;  2XYT A;  3RIA A;  4UM3 P;  2Y54 A;  3UU4 A;  2XNU A;  3GUA A;  3WTJ A;  1UW6 A;  3EAM A;  5AFH A;  3UU8 A;  3EHZ A;  5BRX A;  5JME A;  4IL4 A;  2BYR A;  3U8J A;  3WTO A;  5AFK A;  2LKH A;  5HCJ A;  2MAW A;  3PMZ A;  4UM3 S;  1I9B A;  2BYP A;  2YMD A;  3RIF A;  2XZ5 A;  3RI5 A;  5KZU A;  5L47 A;  3JAD A;  4A98 A;  2PH9 A;  4NZB A;  4QH1 A;  4LMK A;  2X00 A;  2WNJ A;  4UM3 A;  2M6B A;  4XHE A;  2WN9 A;  3JAF A;  5LG3 A;  2Y7Y A;  5HEH A;  4AFT A;  5LXB A;  5J5H A;  2YOE A;  5HEG A;  3TLV A;  4ZR6 A;  3RQW A;  5AFJ A;  3T4M A;  2WZY A;  2BG9 B;  5IUX A;  4FRR A;  4TNW A;  5TVC A;  2KSR A;  4HFC A;  2XNV A;  4IL9 A;  4ZZB A;  2XQ8 A;  4HFD A;  5L4H A;  2YME A;  4BFQ A;  4UM1 A;  2X00 D;  4B5D A;  4QAC A;  5AFM B;  3SQ9 A;  2XYS A;  4ZZC A;  4ZJT A;  4ILB A;  4TNV A;  3IGQ A;  4ZRU A;  2BG9 E;  5HCM A;  4TWH A;  3JAE A;  2LLY A;  4BQT A;  1OED B;  3WTK A;  3UQ4 A;  3PEO A;  5L4E A;  1UV6 A;  4LMJ A;  4QAA A;  4HFH A;  3SIO A;  4ZJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...