2X00A

Crystal structure of a-achbp in complex with gymnodimine a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
216
structure length
216
Chain Sequence
YKDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural Determinants in Phycotoxins and Achbp Conferring High Affinity Binding and Nicotinic Achr Antagonism.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 50
structure length 216
sequence length 216
chains with identical sequence B, C, E
ec nomenclature
pdb deposition date 2009-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2x00A00
3EI0A 4TNWA 2YMEA 2XQAA 5FJVA 5HCMA 2XQ4A 3U8NA 5CFBA 5BP0A 5J5HA 2W8GA 4QAAA 3UU4A 5J5GA 3RI5A 3GUAA 3TLTA 4IREA 3JADA 2Y58A 2XYSA 3TLVA 3UQ4A 5HCJA 2XNTA 4ILBA 4UM3P 2WN9A 5L4HA 4ZK4A 3WTLA 3ZDHA 4IL9A 4UM3A 5AFKA 2BJ0A 3RQUA 4ILCA 4HFCA 3U8LA 4NPPA 2ZJUA 3TLSA 4COFA 2Y57A 3P4WA 4B5DA 2PH9A 4DBMA 3PEOA 3PMZA 4A97A 1UV6A 3WTOA 4EZ1A 5L47A 2BR8A 2VL0A 3U8MA 3UQ7A 2XNVA 5HEUA 2ZJVA 4QH4A 5KZUA 2YOEA 4HQPA 4ZRUA 2BYPA 5AFMB 3SIOA 2XQ5A 3TLUA 2Y54A 2XZ5A 2WNJA 5BRXA 2BG9A 5CO5A 4TWHA 4HFEA 3RQWA 4QH5A 5AFNA 5LXBA 2BG9C 5TVCA 4TWDA 2BG9B 3WTIA 2Y7YA 4LMLA 3WTMA 5SYOA 2X00D 2YN6A 3WTHA 3JAFA 4D01A 3RIAA 5L4EA 5KE4A 3C79A 4ZK1A 4HFHA 3SQ6A 4QACA 2XNUA 4UM1A 4PIRA 5AINA 4ZZCA 2XZ6A 3T4MA 5LG3A 5J5FA 2XQ9A 4BFQA 4XK9A 5IUXA 5J5IA 4Z90A 3UU3A 4TWFA 3WTKA 2BYSA 4ALXA 3ZDGA 5HEOA 4HFBA 2BG9E 2YMDA 3U8KA 2WNLA 5J0ZA 4X5TA 4WV9A 3SH1A 2PGZA 3UU8A 2X00A 2XYTA 2XQ7A 5HEGA 3RHWA 2W8FA 4ZR6A 4NZBA 3UU6A 2BYNA 3EHZA 4LMJA 4AFGA 4AFHA 3C84A 3WIPA 5AFLA 2BYRA 4A98A 4UY2A 4ZJSA 3EAMA 4ZZBA 2WZYA 4QABA 4HFDA 4BQTA 2BR7A 2XQ8A 3U8JA 4TNVA 1UW6A 3WTJA 3IGQA 4F8HA 1UX2A 4HFIA 4AFTA 5AFHA 4XHEA 5HEHA 4Z91A 4QH1A 3RIFA 1I9BA 3LSVA 5AFJA 3SQ9A 2XQ3A 3ZKRA 2UZ6A 5JMEA 2BYQA 2WNCA 5HEJA 2C9TA 2QC1B 3UUBA 3WTNA 2YKSA 2XQ6A 4ZJTA 4LMKA 3UU5A 3JAEA 3TLWA 3P50A 4FRRA 4IL4A 4ILAA 5AFMA 5BW2A 4UXUA 4UM3S 2Y56A
chains in the Genus database with same CATH superfamily
3EI0A 4TNWA 2YMEA 2XQAA 5FJVA 5HCMA 2XQ4A 3U8NA 5CFBA 5BP0A 5J5HA 2W8GA 4QAAA 3UU4A 5J5GA 3RI5A 3GUAA 3TLTA 4IREA 3JADA 2Y58A 2XYSA 3TLVA 3UQ4A 5HCJA 2XNTA 4ILBA 4UM3P 2WN9A 5L4HA 4ZK4A 3WTLA 3ZDHA 4IL9A 4UM3A 5AFKA 2BJ0A 3RQUA 4ILCA 4HFCA 3U8LA 4NPPA 2ZJUA 3TLSA 4COFA 2Y57A 3P4WA 4B5DA 2PH9A 4DBMA 3PEOA 3PMZA 4A97A 1UV6A 3WTOA 4EZ1A 5L47A 2BR8A 2VL0A 3U8MA 3UQ7A 2XNVA 5HEUA 2ZJVA 4QH4A 5KZUA 2YOEA 4HQPA 4ZRUA 2BYPA 5AFMB 3SIOA 2XQ5A 3TLUA 2Y54A 2XZ5A 2WNJA 5BRXA 2BG9A 5CO5A 4TWHA 4HFEA 3RQWA 4QH5A 5AFNA 5LXBA 2BG9C 5TVCA 4TWDA 2BG9B 3WTIA 2Y7YA 4LMLA 3WTMA 5SYOA 2X00D 2YN6A 3WTHA 3JAFA 4D01A 3RIAA 5L4EA 5KE4A 3C79A 4ZK1A 4HFHA 3SQ6A 4QACA 2XNUA 4UM1A 4PIRA 5AINA 4ZZCA 2XZ6A 3T4MA 5LG3A 5J5FA 2XQ9A 4BFQA 4XK9A 5IUXA 5J5IA 4Z90A 3UU3A 4TWFA 3WTKA 2BYSA 4ALXA 3ZDGA 5HEOA 4HFBA 2BG9E 2YMDA 3U8KA 2WNLA 5J0ZA 4X5TA 4WV9A 3SH1A 2PGZA 3UU8A 2X00A 2XYTA 2XQ7A 5HEGA 3RHWA 2W8FA 4ZR6A 4NZBA 3UU6A 2BYNA 3EHZA 4LMJA 4AFGA 4AFHA 3C84A 3WIPA 5AFLA 2BYRA 4A98A 4UY2A 4ZJSA 3EAMA 4ZZBA 2WZYA 4QABA 4HFDA 4BQTA 2BR7A 2XQ8A 3U8JA 4TNVA 1UW6A 3WTJA 3IGQA 4F8HA 1UX2A 4HFIA 4AFTA 5AFHA 4XHEA 5HEHA 4Z91A 4QH1A 3RIFA 1I9BA 3LSVA 5AFJA 3SQ9A 2XQ3A 3ZKRA 2UZ6A 5JMEA 2BYQA 2WNCA 5HEJA 2C9TA 2QC1B 3UUBA 3WTNA 2YKSA 2XQ6A 4ZJTA 4LMKA 3UU5A 3JAEA 3TLWA 3P50A 4FRRA 4IL4A 4ILAA 5AFMA 5BW2A 4UXUA 4UM3S 2Y56A
chains in the Genus database with same CATH topology
3EI0A 4TNWA 2YMEA 2XQAA 5FJVA 5HCMA 2XQ4A 3U8NA 5CFBA 5BP0A 5J5HA 2W8GA 4QAAA 3UU4A 5J5GA 3RI5A 3GUAA 3TLTA 4IREA 3JADA 2Y58A 2XYSA 3TLVA 3UQ4A 5HCJA 2XNTA 4ILBA 4UM3P 2WN9A 5L4HA 4ZK4A 3WTLA 3ZDHA 4IL9A 4UM3A 5AFKA 2BJ0A 3RQUA 4ILCA 4HFCA 3U8LA 4NPPA 2ZJUA 3TLSA 4COFA 2Y57A 3P4WA 4B5DA 2PH9A 4DBMA 3PEOA 3PMZA 4A97A 1UV6A 3WTOA 4EZ1A 5L47A 2BR8A 2VL0A 3U8MA 3UQ7A 2XNVA 5HEUA 2ZJVA 4QH4A 5KZUA 2YOEA 4HQPA 4ZRUA 2BYPA 5AFMB 3SIOA 2XQ5A 3TLUA 2Y54A 2XZ5A 2WNJA 5BRXA 2BG9A 5CO5A 4TWHA 4HFEA 3RQWA 4QH5A 5AFNA 5LXBA 2BG9C 5TVCA 4TWDA 2BG9B 3WTIA 2Y7YA 4LMLA 3WTMA 5SYOA 2X00D 2YN6A 3WTHA 3JAFA 4D01A 3RIAA 5L4EA 5KE4A 3C79A 4ZK1A 4HFHA 3SQ6A 4QACA 2XNUA 4UM1A 4PIRA 5AINA 4ZZCA 2XZ6A 3T4MA 5LG3A 5J5FA 2XQ9A 4BFQA 4XK9A 5IUXA 5J5IA 4Z90A 3UU3A 4TWFA 3WTKA 2BYSA 4ALXA 3ZDGA 5HEOA 4HFBA 2BG9E 2YMDA 3U8KA 2WNLA 5J0ZA 4X5TA 4WV9A 3SH1A 2PGZA 3UU8A 2X00A 2XYTA 2XQ7A 5HEGA 3RHWA 2W8FA 4ZR6A 4NZBA 3UU6A 2BYNA 3EHZA 4LMJA 4AFGA 4AFHA 3C84A 3WIPA 5AFLA 2BYRA 4A98A 4UY2A 4ZJSA 3EAMA 4ZZBA 2WZYA 4QABA 4HFDA 4BQTA 2BR7A 2XQ8A 3U8JA 4TNVA 1UW6A 3WTJA 3IGQA 4F8HA 1UX2A 4HFIA 4AFTA 5AFHA 4XHEA 5HEHA 4Z91A 4QH1A 3RIFA 1I9BA 3LSVA 5AFJA 3SQ9A 2XQ3A 3ZKRA 2UZ6A 5JMEA 2BYQA 2WNCA 5HEJA 2C9TA 2QC1B 3UUBA 3WTNA 2YKSA 2XQ6A 4ZJTA 4LMKA 3UU5A 3JAEA 3TLWA 3P50A 4FRRA 4IL4A 4ILAA 5AFMA 5BW2A 4UXUA 4UM3S 2Y56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI0 A;  4TNW A;  2YME A;  2XQA A;  5FJV A;  5HCM A;  2XQ4 A;  3U8N A;  5CFB A;  5BP0 A;  5J5H A;  2W8G A;  4QAA A;  3UU4 A;  5J5G A;  3RI5 A;  3GUA A;  3TLT A;  4IRE A;  3JAD A;  2Y58 A;  2XYS A;  3TLV A;  3UQ4 A;  5HCJ A;  2XNT A;  4ILB A;  4UM3 P;  2WN9 A;  5L4H A;  4ZK4 A;  3WTL A;  3ZDH A;  4IL9 A;  4UM3 A;  5AFK A;  2BJ0 A;  3RQU A;  4ILC A;  4HFC A;  3U8L A;  4NPP A;  2ZJU A;  3TLS A;  4COF A;  2Y57 A;  3P4W A;  4B5D A;  2PH9 A;  4DBM A;  3PEO A;  3PMZ A;  4A97 A;  1UV6 A;  3WTO A;  4EZ1 A;  5L47 A;  2BR8 A;  2VL0 A;  3U8M A;  3UQ7 A;  2XNV A;  5HEU A;  2ZJV A;  4QH4 A;  5KZU A;  2YOE A;  4HQP A;  4ZRU A;  2BYP A;  5AFM B;  3SIO A;  2XQ5 A;  3TLU A;  2Y54 A;  2XZ5 A;  2WNJ A;  5BRX A;  2BG9 A;  5CO5 A;  4TWH A;  4HFE A;  3RQW A;  4QH5 A;  5AFN A;  5LXB A;  2BG9 C;  5TVC A;  4TWD A;  2BG9 B;  3WTI A;  2Y7Y A;  4LML A;  3WTM A;  5SYO A;  2X00 D;  2YN6 A;  3WTH A;  3JAF A;  4D01 A;  3RIA A;  5L4E A;  5KE4 A;  3C79 A;  4ZK1 A;  4HFH A;  3SQ6 A;  4QAC A;  2XNU A;  4UM1 A;  4PIR A;  5AIN A;  4ZZC A;  2XZ6 A;  3T4M A;  5LG3 A;  5J5F A;  2XQ9 A;  4BFQ A;  4XK9 A;  5IUX A;  5J5I A;  4Z90 A;  3UU3 A;  4TWF A;  3WTK A;  2BYS A;  4ALX A;  3ZDG A;  5HEO A;  4HFB A;  2BG9 E;  2YMD A;  3U8K A;  2WNL A;  5J0Z A;  4X5T A;  4WV9 A;  3SH1 A;  2PGZ A;  3UU8 A;  2X00 A;  2XYT A;  2XQ7 A;  5HEG A;  3RHW A;  2W8F A;  4ZR6 A;  4NZB A;  3UU6 A;  2BYN A;  3EHZ A;  4LMJ A;  4AFG A;  4AFH A;  3C84 A;  3WIP A;  5AFL A;  2BYR A;  4A98 A;  4UY2 A;  4ZJS A;  3EAM A;  4ZZB A;  2WZY A;  4QAB A;  4HFD A;  4BQT A;  2BR7 A;  2XQ8 A;  3U8J A;  4TNV A;  1UW6 A;  3WTJ A;  3IGQ A;  4F8H A;  1UX2 A;  4HFI A;  4AFT A;  5AFH A;  4XHE A;  5HEH A;  4Z91 A;  4QH1 A;  3RIF A;  1I9B A;  3LSV A;  5AFJ A;  3SQ9 A;  2XQ3 A;  3ZKR A;  2UZ6 A;  5JME A;  2BYQ A;  2WNC A;  5HEJ A;  2C9T A;  2QC1 B;  3UUB A;  3WTN A;  2YKS A;  2XQ6 A;  4ZJT A;  4LMK A;  3UU5 A;  3JAE A;  3TLW A;  3P50 A;  4FRR A;  4IL4 A;  4ILA A;  5AFM A;  5BW2 A;  4UXU A;  4UM3 S;  2Y56 A; 
#chains in the Genus database with same CATH topology
 3EI0 A;  4TNW A;  2YME A;  2XQA A;  5FJV A;  5HCM A;  2XQ4 A;  3U8N A;  5CFB A;  5BP0 A;  5J5H A;  2W8G A;  4QAA A;  3UU4 A;  5J5G A;  3RI5 A;  3GUA A;  3TLT A;  4IRE A;  3JAD A;  2Y58 A;  2XYS A;  3TLV A;  3UQ4 A;  5HCJ A;  2XNT A;  4ILB A;  4UM3 P;  2WN9 A;  5L4H A;  4ZK4 A;  3WTL A;  3ZDH A;  4IL9 A;  4UM3 A;  5AFK A;  2BJ0 A;  3RQU A;  4ILC A;  4HFC A;  3U8L A;  4NPP A;  2ZJU A;  3TLS A;  4COF A;  2Y57 A;  3P4W A;  4B5D A;  2PH9 A;  4DBM A;  3PEO A;  3PMZ A;  4A97 A;  1UV6 A;  3WTO A;  4EZ1 A;  5L47 A;  2BR8 A;  2VL0 A;  3U8M A;  3UQ7 A;  2XNV A;  5HEU A;  2ZJV A;  4QH4 A;  5KZU A;  2YOE A;  4HQP A;  4ZRU A;  2BYP A;  5AFM B;  3SIO A;  2XQ5 A;  3TLU A;  2Y54 A;  2XZ5 A;  2WNJ A;  5BRX A;  2BG9 A;  5CO5 A;  4TWH A;  4HFE A;  3RQW A;  4QH5 A;  5AFN A;  5LXB A;  2BG9 C;  5TVC A;  4TWD A;  2BG9 B;  3WTI A;  2Y7Y A;  4LML A;  3WTM A;  5SYO A;  2X00 D;  2YN6 A;  3WTH A;  3JAF A;  4D01 A;  3RIA A;  5L4E A;  5KE4 A;  3C79 A;  4ZK1 A;  4HFH A;  3SQ6 A;  4QAC A;  2XNU A;  4UM1 A;  4PIR A;  5AIN A;  4ZZC A;  2XZ6 A;  3T4M A;  5LG3 A;  5J5F A;  2XQ9 A;  4BFQ A;  4XK9 A;  5IUX A;  5J5I A;  4Z90 A;  3UU3 A;  4TWF A;  3WTK A;  2BYS A;  4ALX A;  3ZDG A;  5HEO A;  4HFB A;  2BG9 E;  2YMD A;  3U8K A;  2WNL A;  5J0Z A;  4X5T A;  4WV9 A;  3SH1 A;  2PGZ A;  3UU8 A;  2X00 A;  2XYT A;  2XQ7 A;  5HEG A;  3RHW A;  2W8F A;  4ZR6 A;  4NZB A;  3UU6 A;  2BYN A;  3EHZ A;  4LMJ A;  4AFG A;  4AFH A;  3C84 A;  3WIP A;  5AFL A;  2BYR A;  4A98 A;  4UY2 A;  4ZJS A;  3EAM A;  4ZZB A;  2WZY A;  4QAB A;  4HFD A;  4BQT A;  2BR7 A;  2XQ8 A;  3U8J A;  4TNV A;  1UW6 A;  3WTJ A;  3IGQ A;  4F8H A;  1UX2 A;  4HFI A;  4AFT A;  5AFH A;  4XHE A;  5HEH A;  4Z91 A;  4QH1 A;  3RIF A;  1I9B A;  3LSV A;  5AFJ A;  3SQ9 A;  2XQ3 A;  3ZKR A;  2UZ6 A;  5JME A;  2BYQ A;  2WNC A;  5HEJ A;  2C9T A;  2QC1 B;  3UUB A;  3WTN A;  2YKS A;  2XQ6 A;  4ZJT A;  4LMK A;  3UU5 A;  3JAE A;  3TLW A;  3P50 A;  4FRR A;  4IL4 A;  4ILA A;  5AFM A;  5BW2 A;  4UXU A;  4UM3 S;  2Y56 A; 
#chains in the Genus database with same CATH homology
 3EI0 A;  4TNW A;  2YME A;  2XQA A;  5FJV A;  5HCM A;  2XQ4 A;  3U8N A;  5CFB A;  5BP0 A;  5J5H A;  2W8G A;  4QAA A;  3UU4 A;  5J5G A;  3RI5 A;  3GUA A;  3TLT A;  4IRE A;  3JAD A;  2Y58 A;  2XYS A;  3TLV A;  3UQ4 A;  5HCJ A;  2XNT A;  4ILB A;  4UM3 P;  2WN9 A;  5L4H A;  4ZK4 A;  3WTL A;  3ZDH A;  4IL9 A;  4UM3 A;  5AFK A;  2BJ0 A;  3RQU A;  4ILC A;  4HFC A;  3U8L A;  4NPP A;  2ZJU A;  3TLS A;  4COF A;  2Y57 A;  3P4W A;  4B5D A;  2PH9 A;  4DBM A;  3PEO A;  3PMZ A;  4A97 A;  1UV6 A;  3WTO A;  4EZ1 A;  5L47 A;  2BR8 A;  2VL0 A;  3U8M A;  3UQ7 A;  2XNV A;  5HEU A;  2ZJV A;  4QH4 A;  5KZU A;  2YOE A;  4HQP A;  4ZRU A;  2BYP A;  5AFM B;  3SIO A;  2XQ5 A;  3TLU A;  2Y54 A;  2XZ5 A;  2WNJ A;  5BRX A;  2BG9 A;  5CO5 A;  4TWH A;  4HFE A;  3RQW A;  4QH5 A;  5AFN A;  5LXB A;  2BG9 C;  5TVC A;  4TWD A;  2BG9 B;  3WTI A;  2Y7Y A;  4LML A;  3WTM A;  5SYO A;  2X00 D;  2YN6 A;  3WTH A;  3JAF A;  4D01 A;  3RIA A;  5L4E A;  5KE4 A;  3C79 A;  4ZK1 A;  4HFH A;  3SQ6 A;  4QAC A;  2XNU A;  4UM1 A;  4PIR A;  5AIN A;  4ZZC A;  2XZ6 A;  3T4M A;  5LG3 A;  5J5F A;  2XQ9 A;  4BFQ A;  4XK9 A;  5IUX A;  5J5I A;  4Z90 A;  3UU3 A;  4TWF A;  3WTK A;  2BYS A;  4ALX A;  3ZDG A;  5HEO A;  4HFB A;  2BG9 E;  2YMD A;  3U8K A;  2WNL A;  5J0Z A;  4X5T A;  4WV9 A;  3SH1 A;  2PGZ A;  3UU8 A;  2X00 A;  2XYT A;  2XQ7 A;  5HEG A;  3RHW A;  2W8F A;  4ZR6 A;  4NZB A;  3UU6 A;  2BYN A;  3EHZ A;  4LMJ A;  4AFG A;  4AFH A;  3C84 A;  3WIP A;  5AFL A;  2BYR A;  4A98 A;  4UY2 A;  4ZJS A;  3EAM A;  4ZZB A;  2WZY A;  4QAB A;  4HFD A;  4BQT A;  2BR7 A;  2XQ8 A;  3U8J A;  4TNV A;  1UW6 A;  3WTJ A;  3IGQ A;  4F8H A;  1UX2 A;  4HFI A;  4AFT A;  5AFH A;  4XHE A;  5HEH A;  4Z91 A;  4QH1 A;  3RIF A;  1I9B A;  3LSV A;  5AFJ A;  3SQ9 A;  2XQ3 A;  3ZKR A;  2UZ6 A;  5JME A;  2BYQ A;  2WNC A;  5HEJ A;  2C9T A;  2QC1 B;  3UUB A;  3WTN A;  2YKS A;  2XQ6 A;  4ZJT A;  4LMK A;  3UU5 A;  3JAE A;  3TLW A;  3P50 A;  4FRR A;  4IL4 A;  4ILA A;  5AFM A;  5BW2 A;  4UXU A;  4UM3 S;  2Y56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...