2ZJUA

Crystal structure of lymnaea stagnalis acetylcholine binding protein (ls-achbp) complexed with imidacloprid
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
207
structure length
207
Chain Sequence
AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Crystal structures of Lymnaea stagnalis AChBP in complex with neonicotinoid insecticides imidacloprid and clothianidin
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 48
structure length 207
sequence length 207
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2zjuA00
2UZ6A 4B5DA 5J5HA 2YN6A 4AFGA 4AFTA 3RQUA 4IL4A 2Y57A 3JADA 4ILAA 4IREA 4HFBA 3WTMA 3UU4A 2VL0A 4HFHA 5JMEA 2YMDA 3EI0A 4HFEA 3RI5A 4D01A 3WTKA 2XZ6A 3EAMA 4UM1A 4TNWA 4ILCA 2XQ7A 3WIPA 3TLTA 2WNJA 2BG9E 3TLVA 5AFJA 2C9TA 5AFMA 3WTIA 5J5FA 3UU3A 2WZYA 2BG9C 4QACA 4Z90A 5J5GA 1UX2A 3PMZA 3TLSA 4LMLA 5L47A 3RIFA 2WN9A 4EZ1A 4TWFA 2X00D 3JAEA 3U8JA 2XQAA 4DBMA 2XZ5A 3WTLA 2Y54A 4QH5A 3GUAA 5TVCA 2X00A 4TWDA 2BYRA 3C84A 3RQWA 2PH9A 4A97A 3UQ4A 3ZDGA 3TLWA 3ZKRA 2BR7A 4X5TA 2W8GA 3RHWA 3UQ7A 3C79A 4ILBA 3SH1A 5KE4A 2XQ9A 4HFCA 2QC1B 2BG9A 3RIAA 4TWHA 3U8KA 2BR8A 1UW6A 5CFBA 5J0ZA 2WNCA 4UM3P 5BW2A 2XYTA 4HFDA 2Y56A 4PIRA 4UXUA 3UU6A 5J5IA 5KZUA 2PGZA 4F8HA 5HCMA 4COFA 3TLUA 2XQ5A 5L4EA 3SQ9A 4QH4A 5BP0A 4WV9A 5SYOA 4QAAA 3UU5A 4UY2A 5HCJA 5AFNA 1UV6A 4ZJSA 4BFQA 3WTOA 4BQTA 5BRXA 2XNUA 5LXBA 5AFMB 3UU8A 4ALXA 3EHZA 4XHEA 3T4MA 3WTHA 3ZDHA 5CO5A 3WTNA 2XQ4A 4ZRUA 4LMJA 5L4HA 5AINA 4A98A 2XNTA 4TNVA 3SQ6A 2XQ8A 4ZJTA 4ZK1A 4ZZCA 3SIOA 2XQ6A 2Y58A 2YMEA 3PEOA 1I9BA 2ZJUA 3U8MA 3P4WA 4ZK4A 3IGQA 2Y7YA 3LSVA 3U8LA 5HEGA 2YKSA 4ZZBA 5HEJA 2BG9B 3UUBA 4UM3S 2BYQA 5HEUA 2BYNA 5IUXA 2ZJVA 2XYSA 4QH1A 3U8NA 3WTJA 2WNLA 4QABA 4UM3A 5HEOA 2BYPA 5AFLA 4FRRA 2XQ3A 3P50A 4HFIA 4Z91A 4ZR6A 5HEHA 2XNVA 5LG3A 4NZBA 2BYSA 4HQPA 4AFHA 4XK9A 2W8FA 4NPPA 5AFKA 4IL9A 4LMKA 5FJVA 5AFHA 2YOEA 2BJ0A 3JAFA
chains in the Genus database with same CATH superfamily
2UZ6A 4B5DA 5J5HA 2YN6A 4AFGA 4AFTA 3RQUA 4IL4A 2Y57A 3JADA 4ILAA 4IREA 4HFBA 3WTMA 3UU4A 2VL0A 4HFHA 5JMEA 2YMDA 3EI0A 4HFEA 3RI5A 4D01A 3WTKA 2XZ6A 3EAMA 4UM1A 4TNWA 4ILCA 2XQ7A 3WIPA 3TLTA 2WNJA 2BG9E 3TLVA 5AFJA 2C9TA 5AFMA 3WTIA 5J5FA 3UU3A 2WZYA 2BG9C 4QACA 4Z90A 5J5GA 1UX2A 3PMZA 3TLSA 4LMLA 5L47A 3RIFA 2WN9A 4EZ1A 4TWFA 2X00D 3JAEA 3U8JA 2XQAA 4DBMA 2XZ5A 3WTLA 2Y54A 4QH5A 3GUAA 5TVCA 2X00A 4TWDA 2BYRA 3C84A 3RQWA 2PH9A 4A97A 3UQ4A 3ZDGA 3TLWA 3ZKRA 2BR7A 4X5TA 2W8GA 3RHWA 3UQ7A 3C79A 4ILBA 3SH1A 5KE4A 2XQ9A 4HFCA 2QC1B 2BG9A 3RIAA 4TWHA 3U8KA 2BR8A 1UW6A 5CFBA 5J0ZA 2WNCA 4UM3P 5BW2A 2XYTA 4HFDA 2Y56A 4PIRA 4UXUA 3UU6A 5J5IA 5KZUA 2PGZA 4F8HA 5HCMA 4COFA 3TLUA 2XQ5A 5L4EA 3SQ9A 4QH4A 5BP0A 4WV9A 5SYOA 4QAAA 3UU5A 4UY2A 5HCJA 5AFNA 1UV6A 4ZJSA 4BFQA 3WTOA 4BQTA 5BRXA 2XNUA 5LXBA 5AFMB 3UU8A 4ALXA 3EHZA 4XHEA 3T4MA 3WTHA 3ZDHA 5CO5A 3WTNA 2XQ4A 4ZRUA 4LMJA 5L4HA 5AINA 4A98A 2XNTA 4TNVA 3SQ6A 2XQ8A 4ZJTA 4ZK1A 4ZZCA 3SIOA 2XQ6A 2Y58A 2YMEA 3PEOA 1I9BA 2ZJUA 3U8MA 3P4WA 4ZK4A 3IGQA 2Y7YA 3LSVA 3U8LA 5HEGA 2YKSA 4ZZBA 5HEJA 2BG9B 3UUBA 4UM3S 2BYQA 5HEUA 2BYNA 5IUXA 2ZJVA 2XYSA 4QH1A 3U8NA 3WTJA 2WNLA 4QABA 4UM3A 5HEOA 2BYPA 5AFLA 4FRRA 2XQ3A 3P50A 4HFIA 4Z91A 4ZR6A 5HEHA 2XNVA 5LG3A 4NZBA 2BYSA 4HQPA 4AFHA 4XK9A 2W8FA 4NPPA 5AFKA 4IL9A 4LMKA 5FJVA 5AFHA 2YOEA 2BJ0A 3JAFA
chains in the Genus database with same CATH topology
2UZ6A 4B5DA 5J5HA 2YN6A 4AFGA 4AFTA 3RQUA 4IL4A 2Y57A 3JADA 4ILAA 4IREA 4HFBA 3WTMA 3UU4A 2VL0A 4HFHA 5JMEA 2YMDA 3EI0A 4HFEA 3RI5A 4D01A 3WTKA 2XZ6A 3EAMA 4UM1A 4TNWA 4ILCA 2XQ7A 3WIPA 3TLTA 2WNJA 2BG9E 3TLVA 5AFJA 2C9TA 5AFMA 3WTIA 5J5FA 3UU3A 2WZYA 2BG9C 4QACA 4Z90A 5J5GA 1UX2A 3PMZA 3TLSA 4LMLA 5L47A 3RIFA 2WN9A 4EZ1A 4TWFA 2X00D 3JAEA 3U8JA 2XQAA 4DBMA 2XZ5A 3WTLA 2Y54A 4QH5A 3GUAA 5TVCA 2X00A 4TWDA 2BYRA 3C84A 3RQWA 2PH9A 4A97A 3UQ4A 3ZDGA 3TLWA 3ZKRA 2BR7A 4X5TA 2W8GA 3RHWA 3UQ7A 3C79A 4ILBA 3SH1A 5KE4A 2XQ9A 4HFCA 2QC1B 2BG9A 3RIAA 4TWHA 3U8KA 2BR8A 1UW6A 5CFBA 5J0ZA 2WNCA 4UM3P 5BW2A 2XYTA 4HFDA 2Y56A 4PIRA 4UXUA 3UU6A 5J5IA 5KZUA 2PGZA 4F8HA 5HCMA 4COFA 3TLUA 2XQ5A 5L4EA 3SQ9A 4QH4A 5BP0A 4WV9A 5SYOA 4QAAA 3UU5A 4UY2A 5HCJA 5AFNA 1UV6A 4ZJSA 4BFQA 3WTOA 4BQTA 5BRXA 2XNUA 5LXBA 5AFMB 3UU8A 4ALXA 3EHZA 4XHEA 3T4MA 3WTHA 3ZDHA 5CO5A 3WTNA 2XQ4A 4ZRUA 4LMJA 5L4HA 5AINA 4A98A 2XNTA 4TNVA 3SQ6A 2XQ8A 4ZJTA 4ZK1A 4ZZCA 3SIOA 2XQ6A 2Y58A 2YMEA 3PEOA 1I9BA 2ZJUA 3U8MA 3P4WA 4ZK4A 3IGQA 2Y7YA 3LSVA 3U8LA 5HEGA 2YKSA 4ZZBA 5HEJA 2BG9B 3UUBA 4UM3S 2BYQA 5HEUA 2BYNA 5IUXA 2ZJVA 2XYSA 4QH1A 3U8NA 3WTJA 2WNLA 4QABA 4UM3A 5HEOA 2BYPA 5AFLA 4FRRA 2XQ3A 3P50A 4HFIA 4Z91A 4ZR6A 5HEHA 2XNVA 5LG3A 4NZBA 2BYSA 4HQPA 4AFHA 4XK9A 2W8FA 4NPPA 5AFKA 4IL9A 4LMKA 5FJVA 5AFHA 2YOEA 2BJ0A 3JAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZ6 A;  4B5D A;  5J5H A;  2YN6 A;  4AFG A;  4AFT A;  3RQU A;  4IL4 A;  2Y57 A;  3JAD A;  4ILA A;  4IRE A;  4HFB A;  3WTM A;  3UU4 A;  2VL0 A;  4HFH A;  5JME A;  2YMD A;  3EI0 A;  4HFE A;  3RI5 A;  4D01 A;  3WTK A;  2XZ6 A;  3EAM A;  4UM1 A;  4TNW A;  4ILC A;  2XQ7 A;  3WIP A;  3TLT A;  2WNJ A;  2BG9 E;  3TLV A;  5AFJ A;  2C9T A;  5AFM A;  3WTI A;  5J5F A;  3UU3 A;  2WZY A;  2BG9 C;  4QAC A;  4Z90 A;  5J5G A;  1UX2 A;  3PMZ A;  3TLS A;  4LML A;  5L47 A;  3RIF A;  2WN9 A;  4EZ1 A;  4TWF A;  2X00 D;  3JAE A;  3U8J A;  2XQA A;  4DBM A;  2XZ5 A;  3WTL A;  2Y54 A;  4QH5 A;  3GUA A;  5TVC A;  2X00 A;  4TWD A;  2BYR A;  3C84 A;  3RQW A;  2PH9 A;  4A97 A;  3UQ4 A;  3ZDG A;  3TLW A;  3ZKR A;  2BR7 A;  4X5T A;  2W8G A;  3RHW A;  3UQ7 A;  3C79 A;  4ILB A;  3SH1 A;  5KE4 A;  2XQ9 A;  4HFC A;  2QC1 B;  2BG9 A;  3RIA A;  4TWH A;  3U8K A;  2BR8 A;  1UW6 A;  5CFB A;  5J0Z A;  2WNC A;  4UM3 P;  5BW2 A;  2XYT A;  4HFD A;  2Y56 A;  4PIR A;  4UXU A;  3UU6 A;  5J5I A;  5KZU A;  2PGZ A;  4F8H A;  5HCM A;  4COF A;  3TLU A;  2XQ5 A;  5L4E A;  3SQ9 A;  4QH4 A;  5BP0 A;  4WV9 A;  5SYO A;  4QAA A;  3UU5 A;  4UY2 A;  5HCJ A;  5AFN A;  1UV6 A;  4ZJS A;  4BFQ A;  3WTO A;  4BQT A;  5BRX A;  2XNU A;  5LXB A;  5AFM B;  3UU8 A;  4ALX A;  3EHZ A;  4XHE A;  3T4M A;  3WTH A;  3ZDH A;  5CO5 A;  3WTN A;  2XQ4 A;  4ZRU A;  4LMJ A;  5L4H A;  5AIN A;  4A98 A;  2XNT A;  4TNV A;  3SQ6 A;  2XQ8 A;  4ZJT A;  4ZK1 A;  4ZZC A;  3SIO A;  2XQ6 A;  2Y58 A;  2YME A;  3PEO A;  1I9B A;  2ZJU A;  3U8M A;  3P4W A;  4ZK4 A;  3IGQ A;  2Y7Y A;  3LSV A;  3U8L A;  5HEG A;  2YKS A;  4ZZB A;  5HEJ A;  2BG9 B;  3UUB A;  4UM3 S;  2BYQ A;  5HEU A;  2BYN A;  5IUX A;  2ZJV A;  2XYS A;  4QH1 A;  3U8N A;  3WTJ A;  2WNL A;  4QAB A;  4UM3 A;  5HEO A;  2BYP A;  5AFL A;  4FRR A;  2XQ3 A;  3P50 A;  4HFI A;  4Z91 A;  4ZR6 A;  5HEH A;  2XNV A;  5LG3 A;  4NZB A;  2BYS A;  4HQP A;  4AFH A;  4XK9 A;  2W8F A;  4NPP A;  5AFK A;  4IL9 A;  4LMK A;  5FJV A;  5AFH A;  2YOE A;  2BJ0 A;  3JAF A; 
#chains in the Genus database with same CATH topology
 2UZ6 A;  4B5D A;  5J5H A;  2YN6 A;  4AFG A;  4AFT A;  3RQU A;  4IL4 A;  2Y57 A;  3JAD A;  4ILA A;  4IRE A;  4HFB A;  3WTM A;  3UU4 A;  2VL0 A;  4HFH A;  5JME A;  2YMD A;  3EI0 A;  4HFE A;  3RI5 A;  4D01 A;  3WTK A;  2XZ6 A;  3EAM A;  4UM1 A;  4TNW A;  4ILC A;  2XQ7 A;  3WIP A;  3TLT A;  2WNJ A;  2BG9 E;  3TLV A;  5AFJ A;  2C9T A;  5AFM A;  3WTI A;  5J5F A;  3UU3 A;  2WZY A;  2BG9 C;  4QAC A;  4Z90 A;  5J5G A;  1UX2 A;  3PMZ A;  3TLS A;  4LML A;  5L47 A;  3RIF A;  2WN9 A;  4EZ1 A;  4TWF A;  2X00 D;  3JAE A;  3U8J A;  2XQA A;  4DBM A;  2XZ5 A;  3WTL A;  2Y54 A;  4QH5 A;  3GUA A;  5TVC A;  2X00 A;  4TWD A;  2BYR A;  3C84 A;  3RQW A;  2PH9 A;  4A97 A;  3UQ4 A;  3ZDG A;  3TLW A;  3ZKR A;  2BR7 A;  4X5T A;  2W8G A;  3RHW A;  3UQ7 A;  3C79 A;  4ILB A;  3SH1 A;  5KE4 A;  2XQ9 A;  4HFC A;  2QC1 B;  2BG9 A;  3RIA A;  4TWH A;  3U8K A;  2BR8 A;  1UW6 A;  5CFB A;  5J0Z A;  2WNC A;  4UM3 P;  5BW2 A;  2XYT A;  4HFD A;  2Y56 A;  4PIR A;  4UXU A;  3UU6 A;  5J5I A;  5KZU A;  2PGZ A;  4F8H A;  5HCM A;  4COF A;  3TLU A;  2XQ5 A;  5L4E A;  3SQ9 A;  4QH4 A;  5BP0 A;  4WV9 A;  5SYO A;  4QAA A;  3UU5 A;  4UY2 A;  5HCJ A;  5AFN A;  1UV6 A;  4ZJS A;  4BFQ A;  3WTO A;  4BQT A;  5BRX A;  2XNU A;  5LXB A;  5AFM B;  3UU8 A;  4ALX A;  3EHZ A;  4XHE A;  3T4M A;  3WTH A;  3ZDH A;  5CO5 A;  3WTN A;  2XQ4 A;  4ZRU A;  4LMJ A;  5L4H A;  5AIN A;  4A98 A;  2XNT A;  4TNV A;  3SQ6 A;  2XQ8 A;  4ZJT A;  4ZK1 A;  4ZZC A;  3SIO A;  2XQ6 A;  2Y58 A;  2YME A;  3PEO A;  1I9B A;  2ZJU A;  3U8M A;  3P4W A;  4ZK4 A;  3IGQ A;  2Y7Y A;  3LSV A;  3U8L A;  5HEG A;  2YKS A;  4ZZB A;  5HEJ A;  2BG9 B;  3UUB A;  4UM3 S;  2BYQ A;  5HEU A;  2BYN A;  5IUX A;  2ZJV A;  2XYS A;  4QH1 A;  3U8N A;  3WTJ A;  2WNL A;  4QAB A;  4UM3 A;  5HEO A;  2BYP A;  5AFL A;  4FRR A;  2XQ3 A;  3P50 A;  4HFI A;  4Z91 A;  4ZR6 A;  5HEH A;  2XNV A;  5LG3 A;  4NZB A;  2BYS A;  4HQP A;  4AFH A;  4XK9 A;  2W8F A;  4NPP A;  5AFK A;  4IL9 A;  4LMK A;  5FJV A;  5AFH A;  2YOE A;  2BJ0 A;  3JAF A; 
#chains in the Genus database with same CATH homology
 2UZ6 A;  4B5D A;  5J5H A;  2YN6 A;  4AFG A;  4AFT A;  3RQU A;  4IL4 A;  2Y57 A;  3JAD A;  4ILA A;  4IRE A;  4HFB A;  3WTM A;  3UU4 A;  2VL0 A;  4HFH A;  5JME A;  2YMD A;  3EI0 A;  4HFE A;  3RI5 A;  4D01 A;  3WTK A;  2XZ6 A;  3EAM A;  4UM1 A;  4TNW A;  4ILC A;  2XQ7 A;  3WIP A;  3TLT A;  2WNJ A;  2BG9 E;  3TLV A;  5AFJ A;  2C9T A;  5AFM A;  3WTI A;  5J5F A;  3UU3 A;  2WZY A;  2BG9 C;  4QAC A;  4Z90 A;  5J5G A;  1UX2 A;  3PMZ A;  3TLS A;  4LML A;  5L47 A;  3RIF A;  2WN9 A;  4EZ1 A;  4TWF A;  2X00 D;  3JAE A;  3U8J A;  2XQA A;  4DBM A;  2XZ5 A;  3WTL A;  2Y54 A;  4QH5 A;  3GUA A;  5TVC A;  2X00 A;  4TWD A;  2BYR A;  3C84 A;  3RQW A;  2PH9 A;  4A97 A;  3UQ4 A;  3ZDG A;  3TLW A;  3ZKR A;  2BR7 A;  4X5T A;  2W8G A;  3RHW A;  3UQ7 A;  3C79 A;  4ILB A;  3SH1 A;  5KE4 A;  2XQ9 A;  4HFC A;  2QC1 B;  2BG9 A;  3RIA A;  4TWH A;  3U8K A;  2BR8 A;  1UW6 A;  5CFB A;  5J0Z A;  2WNC A;  4UM3 P;  5BW2 A;  2XYT A;  4HFD A;  2Y56 A;  4PIR A;  4UXU A;  3UU6 A;  5J5I A;  5KZU A;  2PGZ A;  4F8H A;  5HCM A;  4COF A;  3TLU A;  2XQ5 A;  5L4E A;  3SQ9 A;  4QH4 A;  5BP0 A;  4WV9 A;  5SYO A;  4QAA A;  3UU5 A;  4UY2 A;  5HCJ A;  5AFN A;  1UV6 A;  4ZJS A;  4BFQ A;  3WTO A;  4BQT A;  5BRX A;  2XNU A;  5LXB A;  5AFM B;  3UU8 A;  4ALX A;  3EHZ A;  4XHE A;  3T4M A;  3WTH A;  3ZDH A;  5CO5 A;  3WTN A;  2XQ4 A;  4ZRU A;  4LMJ A;  5L4H A;  5AIN A;  4A98 A;  2XNT A;  4TNV A;  3SQ6 A;  2XQ8 A;  4ZJT A;  4ZK1 A;  4ZZC A;  3SIO A;  2XQ6 A;  2Y58 A;  2YME A;  3PEO A;  1I9B A;  2ZJU A;  3U8M A;  3P4W A;  4ZK4 A;  3IGQ A;  2Y7Y A;  3LSV A;  3U8L A;  5HEG A;  2YKS A;  4ZZB A;  5HEJ A;  2BG9 B;  3UUB A;  4UM3 S;  2BYQ A;  5HEU A;  2BYN A;  5IUX A;  2ZJV A;  2XYS A;  4QH1 A;  3U8N A;  3WTJ A;  2WNL A;  4QAB A;  4UM3 A;  5HEO A;  2BYP A;  5AFL A;  4FRR A;  2XQ3 A;  3P50 A;  4HFI A;  4Z91 A;  4ZR6 A;  5HEH A;  2XNV A;  5LG3 A;  4NZB A;  2BYS A;  4HQP A;  4AFH A;  4XK9 A;  2W8F A;  4NPP A;  5AFK A;  4IL9 A;  4LMK A;  5FJV A;  5AFH A;  2YOE A;  2BJ0 A;  3JAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...