2ZJUA

Crystal structure of lymnaea stagnalis acetylcholine binding protein (ls-achbp) complexed with imidacloprid
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
207
structure length
207
Chain Sequence
AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Acetylcholine-binding protein
publication title Crystal structures of Lymnaea stagnalis AChBP in complex with neonicotinoid insecticides imidacloprid and clothianidin
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 48
structure length 207
sequence length 207
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2zjuA00
2ZJVA 2XQ7A 5BRXA 3RHWA 4ZZBA 5AFMA 4Z91A 5L47A 5J5FA 2YMEA 2XQAA 4ILCA 4UM3A 5HEJA 2W8FA 3UU4A 2Y56A 3IGQA 4IL4A 5J0ZA 3UUBA 3TLSA 1I9BA 4LMKA 5L4HA 3JADA 3JAFA 3U8MA 4B5DA 2BG9B 2BG9C 4ZK1A 4HFDA 4QACA 3UU8A 4UY2A 4F8HA 2XQ8A 3WTLA 3SQ9A 4AFGA 4TNWA 2YOEA 2BR8A 2UZ6A 2XQ6A 5HEOA 2WNLA 4XHEA 3U8LA 4ZRUA 2PH9A 5JMEA 4LMJA 2BYSA 4IL9A 5BW2A 5HEGA 2W8GA 3C84A 3TLWA 3WTOA 2WZYA 4TWFA 4ZR6A 3SH1A 2YMDA 2WN9A 2BYNA 4EZ1A 4FRRA 4ILBA 2Y54A 4COFA 4QH4A 5HCJA 4DBMA 4ZK4A 3SIOA 5CFBA 3PEOA 2QC1B 2XQ3A 5CO5A 1UV6A 2YN6A 3C79A 3UQ4A 2XNVA 4QABA 4BFQA 4BQTA 4IREA 4QH5A 2WNCA 3UU6A 3UU3A 5AFKA 5IUXA 3WTIA 2PGZA 2BG9A 5AFNA 4PIRA 5SYOA 3UU5A 3TLTA 3U8JA 4QAAA 5AINA 2XYSA 5AFJA 2XZ6A 3RI5A 4AFHA 5HCMA 3PMZA 2XZ5A 3EI0A 2BYRA 2XYTA 4AFTA 5KE4A 3RIFA 4HFCA 5J5GA 3P4WA 4D01A 4LMLA 5LXBA 3ZDGA 3SQ6A 1UW6A 2Y58A 5J5HA 2XQ4A 4UM3S 4ZJTA 2VL0A 4TNVA 4ZZCA 1UX2A 5KZUA 2ZJUA 2YKSA 5HEUA 5L4EA 3U8KA 4WV9A 3WTKA 2XQ9A 5TVCA 4HQPA 5J5IA 2C9TA 3WTNA 4A98A 2Y7YA 4TWHA 2XNUA 3LSVA 3U8NA 5AFLA 2X00A 3RQUA 5FJVA 4A97A 4ZJSA 4X5TA 3WTHA 2XNTA 3RIAA 3TLUA 2BYQA 4TWDA 4QH1A 5HEHA 3ZKRA 5AFHA 4UM1A 4HFIA 2XQ5A 4ILAA 5LG3A 3WIPA 4UXUA 3GUAA 3EAMA 2X00D 2BYPA 4NPPA 4NZBA 3EHZA 3RQWA 3JAEA 3WTJA 3ZDHA 4XK9A 3TLVA 4ALXA 4HFHA 2BR7A 2Y57A 4HFEA 2WNJA 3WTMA 5BP0A 2BJ0A 4UM3P 3P50A 4Z90A 3T4MA 5AFMB 3UQ7A 4HFBA 2BG9E
chains in the Genus database with same CATH superfamily
2ZJVA 2XQ7A 5BRXA 3RHWA 4ZZBA 5AFMA 4Z91A 5L47A 5J5FA 2YMEA 2XQAA 4ILCA 4UM3A 5HEJA 2W8FA 3UU4A 2Y56A 3IGQA 4IL4A 5J0ZA 3UUBA 3TLSA 1I9BA 4LMKA 5L4HA 3JADA 3JAFA 3U8MA 4B5DA 2BG9B 2BG9C 4ZK1A 4HFDA 4QACA 3UU8A 4UY2A 4F8HA 2XQ8A 3WTLA 3SQ9A 4AFGA 4TNWA 2YOEA 2BR8A 2UZ6A 2XQ6A 5HEOA 2WNLA 4XHEA 3U8LA 4ZRUA 2PH9A 5JMEA 4LMJA 2BYSA 4IL9A 5BW2A 5HEGA 2W8GA 3C84A 3TLWA 3WTOA 2WZYA 4TWFA 4ZR6A 3SH1A 2YMDA 2WN9A 2BYNA 4EZ1A 4FRRA 4ILBA 2Y54A 4COFA 4QH4A 5HCJA 4DBMA 4ZK4A 3SIOA 5CFBA 3PEOA 2QC1B 2XQ3A 5CO5A 1UV6A 2YN6A 3C79A 3UQ4A 2XNVA 4QABA 4BFQA 4BQTA 4IREA 4QH5A 2WNCA 3UU6A 3UU3A 5AFKA 5IUXA 3WTIA 2PGZA 2BG9A 5AFNA 4PIRA 5SYOA 3UU5A 3TLTA 3U8JA 4QAAA 5AINA 2XYSA 5AFJA 2XZ6A 3RI5A 4AFHA 5HCMA 3PMZA 2XZ5A 3EI0A 2BYRA 2XYTA 4AFTA 5KE4A 3RIFA 4HFCA 5J5GA 3P4WA 4D01A 4LMLA 5LXBA 3ZDGA 3SQ6A 1UW6A 2Y58A 5J5HA 2XQ4A 4UM3S 4ZJTA 2VL0A 4TNVA 4ZZCA 1UX2A 5KZUA 2ZJUA 2YKSA 5HEUA 5L4EA 3U8KA 4WV9A 3WTKA 2XQ9A 5TVCA 4HQPA 5J5IA 2C9TA 3WTNA 4A98A 2Y7YA 4TWHA 2XNUA 3LSVA 3U8NA 5AFLA 2X00A 3RQUA 5FJVA 4A97A 4ZJSA 4X5TA 3WTHA 2XNTA 3RIAA 3TLUA 2BYQA 4TWDA 4QH1A 5HEHA 3ZKRA 5AFHA 4UM1A 4HFIA 2XQ5A 4ILAA 5LG3A 3WIPA 4UXUA 3GUAA 3EAMA 2X00D 2BYPA 4NPPA 4NZBA 3EHZA 3RQWA 3JAEA 3WTJA 3ZDHA 4XK9A 3TLVA 4ALXA 4HFHA 2BR7A 2Y57A 4HFEA 2WNJA 3WTMA 5BP0A 2BJ0A 4UM3P 3P50A 4Z90A 3T4MA 5AFMB 3UQ7A 4HFBA 2BG9E
chains in the Genus database with same CATH topology
2ZJVA 2XQ7A 5BRXA 3RHWA 4ZZBA 5AFMA 4Z91A 5L47A 5J5FA 2YMEA 2XQAA 4ILCA 4UM3A 5HEJA 2W8FA 3UU4A 2Y56A 3IGQA 4IL4A 5J0ZA 3UUBA 3TLSA 1I9BA 4LMKA 5L4HA 3JADA 3JAFA 3U8MA 4B5DA 2BG9B 2BG9C 4ZK1A 4HFDA 4QACA 3UU8A 4UY2A 4F8HA 2XQ8A 3WTLA 3SQ9A 4AFGA 4TNWA 2YOEA 2BR8A 2UZ6A 2XQ6A 5HEOA 2WNLA 4XHEA 3U8LA 4ZRUA 2PH9A 5JMEA 4LMJA 2BYSA 4IL9A 5BW2A 5HEGA 2W8GA 3C84A 3TLWA 3WTOA 2WZYA 4TWFA 4ZR6A 3SH1A 2YMDA 2WN9A 2BYNA 4EZ1A 4FRRA 4ILBA 2Y54A 4COFA 4QH4A 5HCJA 4DBMA 4ZK4A 3SIOA 5CFBA 3PEOA 2QC1B 2XQ3A 5CO5A 1UV6A 2YN6A 3C79A 3UQ4A 2XNVA 4QABA 4BFQA 4BQTA 4IREA 4QH5A 2WNCA 3UU6A 3UU3A 5AFKA 5IUXA 3WTIA 2PGZA 2BG9A 5AFNA 4PIRA 5SYOA 3UU5A 3TLTA 3U8JA 4QAAA 5AINA 2XYSA 5AFJA 2XZ6A 3RI5A 4AFHA 5HCMA 3PMZA 2XZ5A 3EI0A 2BYRA 2XYTA 4AFTA 5KE4A 3RIFA 4HFCA 5J5GA 3P4WA 4D01A 4LMLA 5LXBA 3ZDGA 3SQ6A 1UW6A 2Y58A 5J5HA 2XQ4A 4UM3S 4ZJTA 2VL0A 4TNVA 4ZZCA 1UX2A 5KZUA 2ZJUA 2YKSA 5HEUA 5L4EA 3U8KA 4WV9A 3WTKA 2XQ9A 5TVCA 4HQPA 5J5IA 2C9TA 3WTNA 4A98A 2Y7YA 4TWHA 2XNUA 3LSVA 3U8NA 5AFLA 2X00A 3RQUA 5FJVA 4A97A 4ZJSA 4X5TA 3WTHA 2XNTA 3RIAA 3TLUA 2BYQA 4TWDA 4QH1A 5HEHA 3ZKRA 5AFHA 4UM1A 4HFIA 2XQ5A 4ILAA 5LG3A 3WIPA 4UXUA 3GUAA 3EAMA 2X00D 2BYPA 4NPPA 4NZBA 3EHZA 3RQWA 3JAEA 3WTJA 3ZDHA 4XK9A 3TLVA 4ALXA 4HFHA 2BR7A 2Y57A 4HFEA 2WNJA 3WTMA 5BP0A 2BJ0A 4UM3P 3P50A 4Z90A 3T4MA 5AFMB 3UQ7A 4HFBA 2BG9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJV A;  2XQ7 A;  5BRX A;  3RHW A;  4ZZB A;  5AFM A;  4Z91 A;  5L47 A;  5J5F A;  2YME A;  2XQA A;  4ILC A;  4UM3 A;  5HEJ A;  2W8F A;  3UU4 A;  2Y56 A;  3IGQ A;  4IL4 A;  5J0Z A;  3UUB A;  3TLS A;  1I9B A;  4LMK A;  5L4H A;  3JAD A;  3JAF A;  3U8M A;  4B5D A;  2BG9 B;  2BG9 C;  4ZK1 A;  4HFD A;  4QAC A;  3UU8 A;  4UY2 A;  4F8H A;  2XQ8 A;  3WTL A;  3SQ9 A;  4AFG A;  4TNW A;  2YOE A;  2BR8 A;  2UZ6 A;  2XQ6 A;  5HEO A;  2WNL A;  4XHE A;  3U8L A;  4ZRU A;  2PH9 A;  5JME A;  4LMJ A;  2BYS A;  4IL9 A;  5BW2 A;  5HEG A;  2W8G A;  3C84 A;  3TLW A;  3WTO A;  2WZY A;  4TWF A;  4ZR6 A;  3SH1 A;  2YMD A;  2WN9 A;  2BYN A;  4EZ1 A;  4FRR A;  4ILB A;  2Y54 A;  4COF A;  4QH4 A;  5HCJ A;  4DBM A;  4ZK4 A;  3SIO A;  5CFB A;  3PEO A;  2QC1 B;  2XQ3 A;  5CO5 A;  1UV6 A;  2YN6 A;  3C79 A;  3UQ4 A;  2XNV A;  4QAB A;  4BFQ A;  4BQT A;  4IRE A;  4QH5 A;  2WNC A;  3UU6 A;  3UU3 A;  5AFK A;  5IUX A;  3WTI A;  2PGZ A;  2BG9 A;  5AFN A;  4PIR A;  5SYO A;  3UU5 A;  3TLT A;  3U8J A;  4QAA A;  5AIN A;  2XYS A;  5AFJ A;  2XZ6 A;  3RI5 A;  4AFH A;  5HCM A;  3PMZ A;  2XZ5 A;  3EI0 A;  2BYR A;  2XYT A;  4AFT A;  5KE4 A;  3RIF A;  4HFC A;  5J5G A;  3P4W A;  4D01 A;  4LML A;  5LXB A;  3ZDG A;  3SQ6 A;  1UW6 A;  2Y58 A;  5J5H A;  2XQ4 A;  4UM3 S;  4ZJT A;  2VL0 A;  4TNV A;  4ZZC A;  1UX2 A;  5KZU A;  2ZJU A;  2YKS A;  5HEU A;  5L4E A;  3U8K A;  4WV9 A;  3WTK A;  2XQ9 A;  5TVC A;  4HQP A;  5J5I A;  2C9T A;  3WTN A;  4A98 A;  2Y7Y A;  4TWH A;  2XNU A;  3LSV A;  3U8N A;  5AFL A;  2X00 A;  3RQU A;  5FJV A;  4A97 A;  4ZJS A;  4X5T A;  3WTH A;  2XNT A;  3RIA A;  3TLU A;  2BYQ A;  4TWD A;  4QH1 A;  5HEH A;  3ZKR A;  5AFH A;  4UM1 A;  4HFI A;  2XQ5 A;  4ILA A;  5LG3 A;  3WIP A;  4UXU A;  3GUA A;  3EAM A;  2X00 D;  2BYP A;  4NPP A;  4NZB A;  3EHZ A;  3RQW A;  3JAE A;  3WTJ A;  3ZDH A;  4XK9 A;  3TLV A;  4ALX A;  4HFH A;  2BR7 A;  2Y57 A;  4HFE A;  2WNJ A;  3WTM A;  5BP0 A;  2BJ0 A;  4UM3 P;  3P50 A;  4Z90 A;  3T4M A;  5AFM B;  3UQ7 A;  4HFB A;  2BG9 E; 
#chains in the Genus database with same CATH topology
 2ZJV A;  2XQ7 A;  5BRX A;  3RHW A;  4ZZB A;  5AFM A;  4Z91 A;  5L47 A;  5J5F A;  2YME A;  2XQA A;  4ILC A;  4UM3 A;  5HEJ A;  2W8F A;  3UU4 A;  2Y56 A;  3IGQ A;  4IL4 A;  5J0Z A;  3UUB A;  3TLS A;  1I9B A;  4LMK A;  5L4H A;  3JAD A;  3JAF A;  3U8M A;  4B5D A;  2BG9 B;  2BG9 C;  4ZK1 A;  4HFD A;  4QAC A;  3UU8 A;  4UY2 A;  4F8H A;  2XQ8 A;  3WTL A;  3SQ9 A;  4AFG A;  4TNW A;  2YOE A;  2BR8 A;  2UZ6 A;  2XQ6 A;  5HEO A;  2WNL A;  4XHE A;  3U8L A;  4ZRU A;  2PH9 A;  5JME A;  4LMJ A;  2BYS A;  4IL9 A;  5BW2 A;  5HEG A;  2W8G A;  3C84 A;  3TLW A;  3WTO A;  2WZY A;  4TWF A;  4ZR6 A;  3SH1 A;  2YMD A;  2WN9 A;  2BYN A;  4EZ1 A;  4FRR A;  4ILB A;  2Y54 A;  4COF A;  4QH4 A;  5HCJ A;  4DBM A;  4ZK4 A;  3SIO A;  5CFB A;  3PEO A;  2QC1 B;  2XQ3 A;  5CO5 A;  1UV6 A;  2YN6 A;  3C79 A;  3UQ4 A;  2XNV A;  4QAB A;  4BFQ A;  4BQT A;  4IRE A;  4QH5 A;  2WNC A;  3UU6 A;  3UU3 A;  5AFK A;  5IUX A;  3WTI A;  2PGZ A;  2BG9 A;  5AFN A;  4PIR A;  5SYO A;  3UU5 A;  3TLT A;  3U8J A;  4QAA A;  5AIN A;  2XYS A;  5AFJ A;  2XZ6 A;  3RI5 A;  4AFH A;  5HCM A;  3PMZ A;  2XZ5 A;  3EI0 A;  2BYR A;  2XYT A;  4AFT A;  5KE4 A;  3RIF A;  4HFC A;  5J5G A;  3P4W A;  4D01 A;  4LML A;  5LXB A;  3ZDG A;  3SQ6 A;  1UW6 A;  2Y58 A;  5J5H A;  2XQ4 A;  4UM3 S;  4ZJT A;  2VL0 A;  4TNV A;  4ZZC A;  1UX2 A;  5KZU A;  2ZJU A;  2YKS A;  5HEU A;  5L4E A;  3U8K A;  4WV9 A;  3WTK A;  2XQ9 A;  5TVC A;  4HQP A;  5J5I A;  2C9T A;  3WTN A;  4A98 A;  2Y7Y A;  4TWH A;  2XNU A;  3LSV A;  3U8N A;  5AFL A;  2X00 A;  3RQU A;  5FJV A;  4A97 A;  4ZJS A;  4X5T A;  3WTH A;  2XNT A;  3RIA A;  3TLU A;  2BYQ A;  4TWD A;  4QH1 A;  5HEH A;  3ZKR A;  5AFH A;  4UM1 A;  4HFI A;  2XQ5 A;  4ILA A;  5LG3 A;  3WIP A;  4UXU A;  3GUA A;  3EAM A;  2X00 D;  2BYP A;  4NPP A;  4NZB A;  3EHZ A;  3RQW A;  3JAE A;  3WTJ A;  3ZDH A;  4XK9 A;  3TLV A;  4ALX A;  4HFH A;  2BR7 A;  2Y57 A;  4HFE A;  2WNJ A;  3WTM A;  5BP0 A;  2BJ0 A;  4UM3 P;  3P50 A;  4Z90 A;  3T4M A;  5AFM B;  3UQ7 A;  4HFB A;  2BG9 E; 
#chains in the Genus database with same CATH homology
 2ZJV A;  2XQ7 A;  5BRX A;  3RHW A;  4ZZB A;  5AFM A;  4Z91 A;  5L47 A;  5J5F A;  2YME A;  2XQA A;  4ILC A;  4UM3 A;  5HEJ A;  2W8F A;  3UU4 A;  2Y56 A;  3IGQ A;  4IL4 A;  5J0Z A;  3UUB A;  3TLS A;  1I9B A;  4LMK A;  5L4H A;  3JAD A;  3JAF A;  3U8M A;  4B5D A;  2BG9 B;  2BG9 C;  4ZK1 A;  4HFD A;  4QAC A;  3UU8 A;  4UY2 A;  4F8H A;  2XQ8 A;  3WTL A;  3SQ9 A;  4AFG A;  4TNW A;  2YOE A;  2BR8 A;  2UZ6 A;  2XQ6 A;  5HEO A;  2WNL A;  4XHE A;  3U8L A;  4ZRU A;  2PH9 A;  5JME A;  4LMJ A;  2BYS A;  4IL9 A;  5BW2 A;  5HEG A;  2W8G A;  3C84 A;  3TLW A;  3WTO A;  2WZY A;  4TWF A;  4ZR6 A;  3SH1 A;  2YMD A;  2WN9 A;  2BYN A;  4EZ1 A;  4FRR A;  4ILB A;  2Y54 A;  4COF A;  4QH4 A;  5HCJ A;  4DBM A;  4ZK4 A;  3SIO A;  5CFB A;  3PEO A;  2QC1 B;  2XQ3 A;  5CO5 A;  1UV6 A;  2YN6 A;  3C79 A;  3UQ4 A;  2XNV A;  4QAB A;  4BFQ A;  4BQT A;  4IRE A;  4QH5 A;  2WNC A;  3UU6 A;  3UU3 A;  5AFK A;  5IUX A;  3WTI A;  2PGZ A;  2BG9 A;  5AFN A;  4PIR A;  5SYO A;  3UU5 A;  3TLT A;  3U8J A;  4QAA A;  5AIN A;  2XYS A;  5AFJ A;  2XZ6 A;  3RI5 A;  4AFH A;  5HCM A;  3PMZ A;  2XZ5 A;  3EI0 A;  2BYR A;  2XYT A;  4AFT A;  5KE4 A;  3RIF A;  4HFC A;  5J5G A;  3P4W A;  4D01 A;  4LML A;  5LXB A;  3ZDG A;  3SQ6 A;  1UW6 A;  2Y58 A;  5J5H A;  2XQ4 A;  4UM3 S;  4ZJT A;  2VL0 A;  4TNV A;  4ZZC A;  1UX2 A;  5KZU A;  2ZJU A;  2YKS A;  5HEU A;  5L4E A;  3U8K A;  4WV9 A;  3WTK A;  2XQ9 A;  5TVC A;  4HQP A;  5J5I A;  2C9T A;  3WTN A;  4A98 A;  2Y7Y A;  4TWH A;  2XNU A;  3LSV A;  3U8N A;  5AFL A;  2X00 A;  3RQU A;  5FJV A;  4A97 A;  4ZJS A;  4X5T A;  3WTH A;  2XNT A;  3RIA A;  3TLU A;  2BYQ A;  4TWD A;  4QH1 A;  5HEH A;  3ZKR A;  5AFH A;  4UM1 A;  4HFI A;  2XQ5 A;  4ILA A;  5LG3 A;  3WIP A;  4UXU A;  3GUA A;  3EAM A;  2X00 D;  2BYP A;  4NPP A;  4NZB A;  3EHZ A;  3RQW A;  3JAE A;  3WTJ A;  3ZDH A;  4XK9 A;  3TLV A;  4ALX A;  4HFH A;  2BR7 A;  2Y57 A;  4HFE A;  2WNJ A;  3WTM A;  5BP0 A;  2BJ0 A;  4UM3 P;  3P50 A;  4Z90 A;  3T4M A;  5AFM B;  3UQ7 A;  4HFB A;  2BG9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...