4UM3A

Engineered ls-achbp with alpha4-alpha4 binding pocket in complex with ns3920
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
207
structure length
201
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLAHVVSDGEVQYTPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE BINDING PROTEIN
publication title Achbp Engineered to Mimic the Alpha4-Alpha4 Binding Pocket in Alpha4Beta2 Nicotinic Acetylcholine Receptors Reveals Interface Specific Interactions Important for Binding and Activity
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 45
structure length 201
sequence length 207
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, Q, R, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i, j, k, l, m, n
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4um3A00
3RI5A 3IGQA 2XNTA 3SQ9A 2XQ6A 2BG9A 2Y58A 3T4MA 3U8KA 5CFBA 2BYNA 5AFMB 4XHEA 5BRXA 2PH9A 3JAEA 4ILCA 4QABA 3SQ6A 2XQ9A 2BYPA 3SIOA 5L4HA 3UU6A 2BG9E 2XQ7A 3TLSA 4DBMA 4NZBA 4ZK4A 4F8HA 4LMLA 5HEUA 3WIPA 1UX2A 2XQ5A 3WTJA 5HEGA 4TNWA 2BR7A 4Z91A 2Y54A 2XZ5A 4UY2A 3UU8A 4ZZBA 2BG9B 3ZKRA 3UU5A 4TNVA 2XZ6A 3ZDGA 2XYSA 2BYSA 2WNJA 3SH1A 5KZUA 2X00D 4QH5A 4B5DA 4ILAA 2X00A 2XQ8A 4UM3A 2WNCA 4HFHA 5HCJA 4ZJSA 4ZZCA 3WTHA 3U8LA 4UXUA 2XQ4A 5L47A 5LXBA 5HEOA 3TLUA 4AFHA 5J5GA 3C84A 3JAFA 3RIFA 4AFGA 3C79A 3P4WA 4BQTA 2Y7YA 4HFEA 2XYTA 5LG3A 2YMDA 5BW2A 3WTKA 4A98A 2BR8A 1I9BA 2VL0A 4UM1A 4D01A 5FJVA 3GUAA 4LMKA 3JADA 3TLWA 4LMJA 5CO5A 5L4EA 3ZDHA 4FRRA 2XNUA 3WTIA 2Y56A 3RHWA 4Z90A 3WTNA 2BYQA 2WZYA 2QC1B 2Y57A 2WN9A 4HFIA 5IUXA 4HQPA 4X5TA 2XQ3A 5HCMA 2WNLA 2UZ6A 3UQ4A 3UU3A 5AFNA 3RQUA 3LSVA 4HFCA 3PEOA 3TLVA 4ALXA 3U8NA 4IL4A 2PGZA 4NPPA 5J5FA 5KE4A 4ILBA 3EHZA 4TWDA 4TWFA 5AFLA 2ZJVA 5AINA 2ZJUA 4QACA 2C9TA 5AFJA 4BFQA 4ZRUA 4UM3S 5AFHA 2BYRA 4IREA 5BP0A 5J5HA 4HFBA 2YMEA 4TWHA 3UQ7A 3U8MA 4WV9A 4A97A 4ZJTA 4XK9A 4AFTA 1UW6A 5SYOA 2XQAA 3EI0A 4EZ1A 2YN6A 3TLTA 3WTLA 4QAAA 5AFMA 5J5IA 2BJ0A 4ZK1A 4IL9A 5TVCA 4QH1A 5HEHA 3U8JA 4ZR6A 4HFDA 2W8GA 3RIAA 3WTMA 2BG9C 5AFKA 3P50A 4QH4A 4PIRA 3RQWA 5HEJA 2W8FA 3EAMA 5JMEA 2XNVA 4COFA 3UU4A 2YKSA 3WTOA 3PMZA 4UM3P 1UV6A 5J0ZA 3UUBA 2YOEA
chains in the Genus database with same CATH superfamily
3RI5A 3IGQA 2XNTA 3SQ9A 2XQ6A 2BG9A 2Y58A 3T4MA 3U8KA 5CFBA 2BYNA 5AFMB 4XHEA 5BRXA 2PH9A 3JAEA 4ILCA 4QABA 3SQ6A 2XQ9A 2BYPA 3SIOA 5L4HA 3UU6A 2BG9E 2XQ7A 3TLSA 4DBMA 4NZBA 4ZK4A 4F8HA 4LMLA 5HEUA 3WIPA 1UX2A 2XQ5A 3WTJA 5HEGA 4TNWA 2BR7A 4Z91A 2Y54A 2XZ5A 4UY2A 3UU8A 4ZZBA 2BG9B 3ZKRA 3UU5A 4TNVA 2XZ6A 3ZDGA 2XYSA 2BYSA 2WNJA 3SH1A 5KZUA 2X00D 4QH5A 4B5DA 4ILAA 2X00A 2XQ8A 4UM3A 2WNCA 4HFHA 5HCJA 4ZJSA 4ZZCA 3WTHA 3U8LA 4UXUA 2XQ4A 5L47A 5LXBA 5HEOA 3TLUA 4AFHA 5J5GA 3C84A 3JAFA 3RIFA 4AFGA 3C79A 3P4WA 4BQTA 2Y7YA 4HFEA 2XYTA 5LG3A 2YMDA 5BW2A 3WTKA 4A98A 2BR8A 1I9BA 2VL0A 4UM1A 4D01A 5FJVA 3GUAA 4LMKA 3JADA 3TLWA 4LMJA 5CO5A 5L4EA 3ZDHA 4FRRA 2XNUA 3WTIA 2Y56A 3RHWA 4Z90A 3WTNA 2BYQA 2WZYA 2QC1B 2Y57A 2WN9A 4HFIA 5IUXA 4HQPA 4X5TA 2XQ3A 5HCMA 2WNLA 2UZ6A 3UQ4A 3UU3A 5AFNA 3RQUA 3LSVA 4HFCA 3PEOA 3TLVA 4ALXA 3U8NA 4IL4A 2PGZA 4NPPA 5J5FA 5KE4A 4ILBA 3EHZA 4TWDA 4TWFA 5AFLA 2ZJVA 5AINA 2ZJUA 4QACA 2C9TA 5AFJA 4BFQA 4ZRUA 4UM3S 5AFHA 2BYRA 4IREA 5BP0A 5J5HA 4HFBA 2YMEA 4TWHA 3UQ7A 3U8MA 4WV9A 4A97A 4ZJTA 4XK9A 4AFTA 1UW6A 5SYOA 2XQAA 3EI0A 4EZ1A 2YN6A 3TLTA 3WTLA 4QAAA 5AFMA 5J5IA 2BJ0A 4ZK1A 4IL9A 5TVCA 4QH1A 5HEHA 3U8JA 4ZR6A 4HFDA 2W8GA 3RIAA 3WTMA 2BG9C 5AFKA 3P50A 4QH4A 4PIRA 3RQWA 5HEJA 2W8FA 3EAMA 5JMEA 2XNVA 4COFA 3UU4A 2YKSA 3WTOA 3PMZA 4UM3P 1UV6A 5J0ZA 3UUBA 2YOEA
chains in the Genus database with same CATH topology
3RI5A 3IGQA 2XNTA 3SQ9A 2XQ6A 2BG9A 2Y58A 3T4MA 3U8KA 5CFBA 2BYNA 5AFMB 4XHEA 5BRXA 2PH9A 3JAEA 4ILCA 4QABA 3SQ6A 2XQ9A 2BYPA 3SIOA 5L4HA 3UU6A 2BG9E 2XQ7A 3TLSA 4DBMA 4NZBA 4ZK4A 4F8HA 4LMLA 5HEUA 3WIPA 1UX2A 2XQ5A 3WTJA 5HEGA 4TNWA 2BR7A 4Z91A 2Y54A 2XZ5A 4UY2A 3UU8A 4ZZBA 2BG9B 3ZKRA 3UU5A 4TNVA 2XZ6A 3ZDGA 2XYSA 2BYSA 2WNJA 3SH1A 5KZUA 2X00D 4QH5A 4B5DA 4ILAA 2X00A 2XQ8A 4UM3A 2WNCA 4HFHA 5HCJA 4ZJSA 4ZZCA 3WTHA 3U8LA 4UXUA 2XQ4A 5L47A 5LXBA 5HEOA 3TLUA 4AFHA 5J5GA 3C84A 3JAFA 3RIFA 4AFGA 3C79A 3P4WA 4BQTA 2Y7YA 4HFEA 2XYTA 5LG3A 2YMDA 5BW2A 3WTKA 4A98A 2BR8A 1I9BA 2VL0A 4UM1A 4D01A 5FJVA 3GUAA 4LMKA 3JADA 3TLWA 4LMJA 5CO5A 5L4EA 3ZDHA 4FRRA 2XNUA 3WTIA 2Y56A 3RHWA 4Z90A 3WTNA 2BYQA 2WZYA 2QC1B 2Y57A 2WN9A 4HFIA 5IUXA 4HQPA 4X5TA 2XQ3A 5HCMA 2WNLA 2UZ6A 3UQ4A 3UU3A 5AFNA 3RQUA 3LSVA 4HFCA 3PEOA 3TLVA 4ALXA 3U8NA 4IL4A 2PGZA 4NPPA 5J5FA 5KE4A 4ILBA 3EHZA 4TWDA 4TWFA 5AFLA 2ZJVA 5AINA 2ZJUA 4QACA 2C9TA 5AFJA 4BFQA 4ZRUA 4UM3S 5AFHA 2BYRA 4IREA 5BP0A 5J5HA 4HFBA 2YMEA 4TWHA 3UQ7A 3U8MA 4WV9A 4A97A 4ZJTA 4XK9A 4AFTA 1UW6A 5SYOA 2XQAA 3EI0A 4EZ1A 2YN6A 3TLTA 3WTLA 4QAAA 5AFMA 5J5IA 2BJ0A 4ZK1A 4IL9A 5TVCA 4QH1A 5HEHA 3U8JA 4ZR6A 4HFDA 2W8GA 3RIAA 3WTMA 2BG9C 5AFKA 3P50A 4QH4A 4PIRA 3RQWA 5HEJA 2W8FA 3EAMA 5JMEA 2XNVA 4COFA 3UU4A 2YKSA 3WTOA 3PMZA 4UM3P 1UV6A 5J0ZA 3UUBA 2YOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RI5 A;  3IGQ A;  2XNT A;  3SQ9 A;  2XQ6 A;  2BG9 A;  2Y58 A;  3T4M A;  3U8K A;  5CFB A;  2BYN A;  5AFM B;  4XHE A;  5BRX A;  2PH9 A;  3JAE A;  4ILC A;  4QAB A;  3SQ6 A;  2XQ9 A;  2BYP A;  3SIO A;  5L4H A;  3UU6 A;  2BG9 E;  2XQ7 A;  3TLS A;  4DBM A;  4NZB A;  4ZK4 A;  4F8H A;  4LML A;  5HEU A;  3WIP A;  1UX2 A;  2XQ5 A;  3WTJ A;  5HEG A;  4TNW A;  2BR7 A;  4Z91 A;  2Y54 A;  2XZ5 A;  4UY2 A;  3UU8 A;  4ZZB A;  2BG9 B;  3ZKR A;  3UU5 A;  4TNV A;  2XZ6 A;  3ZDG A;  2XYS A;  2BYS A;  2WNJ A;  3SH1 A;  5KZU A;  2X00 D;  4QH5 A;  4B5D A;  4ILA A;  2X00 A;  2XQ8 A;  4UM3 A;  2WNC A;  4HFH A;  5HCJ A;  4ZJS A;  4ZZC A;  3WTH A;  3U8L A;  4UXU A;  2XQ4 A;  5L47 A;  5LXB A;  5HEO A;  3TLU A;  4AFH A;  5J5G A;  3C84 A;  3JAF A;  3RIF A;  4AFG A;  3C79 A;  3P4W A;  4BQT A;  2Y7Y A;  4HFE A;  2XYT A;  5LG3 A;  2YMD A;  5BW2 A;  3WTK A;  4A98 A;  2BR8 A;  1I9B A;  2VL0 A;  4UM1 A;  4D01 A;  5FJV A;  3GUA A;  4LMK A;  3JAD A;  3TLW A;  4LMJ A;  5CO5 A;  5L4E A;  3ZDH A;  4FRR A;  2XNU A;  3WTI A;  2Y56 A;  3RHW A;  4Z90 A;  3WTN A;  2BYQ A;  2WZY A;  2QC1 B;  2Y57 A;  2WN9 A;  4HFI A;  5IUX A;  4HQP A;  4X5T A;  2XQ3 A;  5HCM A;  2WNL A;  2UZ6 A;  3UQ4 A;  3UU3 A;  5AFN A;  3RQU A;  3LSV A;  4HFC A;  3PEO A;  3TLV A;  4ALX A;  3U8N A;  4IL4 A;  2PGZ A;  4NPP A;  5J5F A;  5KE4 A;  4ILB A;  3EHZ A;  4TWD A;  4TWF A;  5AFL A;  2ZJV A;  5AIN A;  2ZJU A;  4QAC A;  2C9T A;  5AFJ A;  4BFQ A;  4ZRU A;  4UM3 S;  5AFH A;  2BYR A;  4IRE A;  5BP0 A;  5J5H A;  4HFB A;  2YME A;  4TWH A;  3UQ7 A;  3U8M A;  4WV9 A;  4A97 A;  4ZJT A;  4XK9 A;  4AFT A;  1UW6 A;  5SYO A;  2XQA A;  3EI0 A;  4EZ1 A;  2YN6 A;  3TLT A;  3WTL A;  4QAA A;  5AFM A;  5J5I A;  2BJ0 A;  4ZK1 A;  4IL9 A;  5TVC A;  4QH1 A;  5HEH A;  3U8J A;  4ZR6 A;  4HFD A;  2W8G A;  3RIA A;  3WTM A;  2BG9 C;  5AFK A;  3P50 A;  4QH4 A;  4PIR A;  3RQW A;  5HEJ A;  2W8F A;  3EAM A;  5JME A;  2XNV A;  4COF A;  3UU4 A;  2YKS A;  3WTO A;  3PMZ A;  4UM3 P;  1UV6 A;  5J0Z A;  3UUB A;  2YOE A; 
#chains in the Genus database with same CATH topology
 3RI5 A;  3IGQ A;  2XNT A;  3SQ9 A;  2XQ6 A;  2BG9 A;  2Y58 A;  3T4M A;  3U8K A;  5CFB A;  2BYN A;  5AFM B;  4XHE A;  5BRX A;  2PH9 A;  3JAE A;  4ILC A;  4QAB A;  3SQ6 A;  2XQ9 A;  2BYP A;  3SIO A;  5L4H A;  3UU6 A;  2BG9 E;  2XQ7 A;  3TLS A;  4DBM A;  4NZB A;  4ZK4 A;  4F8H A;  4LML A;  5HEU A;  3WIP A;  1UX2 A;  2XQ5 A;  3WTJ A;  5HEG A;  4TNW A;  2BR7 A;  4Z91 A;  2Y54 A;  2XZ5 A;  4UY2 A;  3UU8 A;  4ZZB A;  2BG9 B;  3ZKR A;  3UU5 A;  4TNV A;  2XZ6 A;  3ZDG A;  2XYS A;  2BYS A;  2WNJ A;  3SH1 A;  5KZU A;  2X00 D;  4QH5 A;  4B5D A;  4ILA A;  2X00 A;  2XQ8 A;  4UM3 A;  2WNC A;  4HFH A;  5HCJ A;  4ZJS A;  4ZZC A;  3WTH A;  3U8L A;  4UXU A;  2XQ4 A;  5L47 A;  5LXB A;  5HEO A;  3TLU A;  4AFH A;  5J5G A;  3C84 A;  3JAF A;  3RIF A;  4AFG A;  3C79 A;  3P4W A;  4BQT A;  2Y7Y A;  4HFE A;  2XYT A;  5LG3 A;  2YMD A;  5BW2 A;  3WTK A;  4A98 A;  2BR8 A;  1I9B A;  2VL0 A;  4UM1 A;  4D01 A;  5FJV A;  3GUA A;  4LMK A;  3JAD A;  3TLW A;  4LMJ A;  5CO5 A;  5L4E A;  3ZDH A;  4FRR A;  2XNU A;  3WTI A;  2Y56 A;  3RHW A;  4Z90 A;  3WTN A;  2BYQ A;  2WZY A;  2QC1 B;  2Y57 A;  2WN9 A;  4HFI A;  5IUX A;  4HQP A;  4X5T A;  2XQ3 A;  5HCM A;  2WNL A;  2UZ6 A;  3UQ4 A;  3UU3 A;  5AFN A;  3RQU A;  3LSV A;  4HFC A;  3PEO A;  3TLV A;  4ALX A;  3U8N A;  4IL4 A;  2PGZ A;  4NPP A;  5J5F A;  5KE4 A;  4ILB A;  3EHZ A;  4TWD A;  4TWF A;  5AFL A;  2ZJV A;  5AIN A;  2ZJU A;  4QAC A;  2C9T A;  5AFJ A;  4BFQ A;  4ZRU A;  4UM3 S;  5AFH A;  2BYR A;  4IRE A;  5BP0 A;  5J5H A;  4HFB A;  2YME A;  4TWH A;  3UQ7 A;  3U8M A;  4WV9 A;  4A97 A;  4ZJT A;  4XK9 A;  4AFT A;  1UW6 A;  5SYO A;  2XQA A;  3EI0 A;  4EZ1 A;  2YN6 A;  3TLT A;  3WTL A;  4QAA A;  5AFM A;  5J5I A;  2BJ0 A;  4ZK1 A;  4IL9 A;  5TVC A;  4QH1 A;  5HEH A;  3U8J A;  4ZR6 A;  4HFD A;  2W8G A;  3RIA A;  3WTM A;  2BG9 C;  5AFK A;  3P50 A;  4QH4 A;  4PIR A;  3RQW A;  5HEJ A;  2W8F A;  3EAM A;  5JME A;  2XNV A;  4COF A;  3UU4 A;  2YKS A;  3WTO A;  3PMZ A;  4UM3 P;  1UV6 A;  5J0Z A;  3UUB A;  2YOE A; 
#chains in the Genus database with same CATH homology
 3RI5 A;  3IGQ A;  2XNT A;  3SQ9 A;  2XQ6 A;  2BG9 A;  2Y58 A;  3T4M A;  3U8K A;  5CFB A;  2BYN A;  5AFM B;  4XHE A;  5BRX A;  2PH9 A;  3JAE A;  4ILC A;  4QAB A;  3SQ6 A;  2XQ9 A;  2BYP A;  3SIO A;  5L4H A;  3UU6 A;  2BG9 E;  2XQ7 A;  3TLS A;  4DBM A;  4NZB A;  4ZK4 A;  4F8H A;  4LML A;  5HEU A;  3WIP A;  1UX2 A;  2XQ5 A;  3WTJ A;  5HEG A;  4TNW A;  2BR7 A;  4Z91 A;  2Y54 A;  2XZ5 A;  4UY2 A;  3UU8 A;  4ZZB A;  2BG9 B;  3ZKR A;  3UU5 A;  4TNV A;  2XZ6 A;  3ZDG A;  2XYS A;  2BYS A;  2WNJ A;  3SH1 A;  5KZU A;  2X00 D;  4QH5 A;  4B5D A;  4ILA A;  2X00 A;  2XQ8 A;  4UM3 A;  2WNC A;  4HFH A;  5HCJ A;  4ZJS A;  4ZZC A;  3WTH A;  3U8L A;  4UXU A;  2XQ4 A;  5L47 A;  5LXB A;  5HEO A;  3TLU A;  4AFH A;  5J5G A;  3C84 A;  3JAF A;  3RIF A;  4AFG A;  3C79 A;  3P4W A;  4BQT A;  2Y7Y A;  4HFE A;  2XYT A;  5LG3 A;  2YMD A;  5BW2 A;  3WTK A;  4A98 A;  2BR8 A;  1I9B A;  2VL0 A;  4UM1 A;  4D01 A;  5FJV A;  3GUA A;  4LMK A;  3JAD A;  3TLW A;  4LMJ A;  5CO5 A;  5L4E A;  3ZDH A;  4FRR A;  2XNU A;  3WTI A;  2Y56 A;  3RHW A;  4Z90 A;  3WTN A;  2BYQ A;  2WZY A;  2QC1 B;  2Y57 A;  2WN9 A;  4HFI A;  5IUX A;  4HQP A;  4X5T A;  2XQ3 A;  5HCM A;  2WNL A;  2UZ6 A;  3UQ4 A;  3UU3 A;  5AFN A;  3RQU A;  3LSV A;  4HFC A;  3PEO A;  3TLV A;  4ALX A;  3U8N A;  4IL4 A;  2PGZ A;  4NPP A;  5J5F A;  5KE4 A;  4ILB A;  3EHZ A;  4TWD A;  4TWF A;  5AFL A;  2ZJV A;  5AIN A;  2ZJU A;  4QAC A;  2C9T A;  5AFJ A;  4BFQ A;  4ZRU A;  4UM3 S;  5AFH A;  2BYR A;  4IRE A;  5BP0 A;  5J5H A;  4HFB A;  2YME A;  4TWH A;  3UQ7 A;  3U8M A;  4WV9 A;  4A97 A;  4ZJT A;  4XK9 A;  4AFT A;  1UW6 A;  5SYO A;  2XQA A;  3EI0 A;  4EZ1 A;  2YN6 A;  3TLT A;  3WTL A;  4QAA A;  5AFM A;  5J5I A;  2BJ0 A;  4ZK1 A;  4IL9 A;  5TVC A;  4QH1 A;  5HEH A;  3U8J A;  4ZR6 A;  4HFD A;  2W8G A;  3RIA A;  3WTM A;  2BG9 C;  5AFK A;  3P50 A;  4QH4 A;  4PIR A;  3RQW A;  5HEJ A;  2W8F A;  3EAM A;  5JME A;  2XNV A;  4COF A;  3UU4 A;  2YKS A;  3WTO A;  3PMZ A;  4UM3 P;  1UV6 A;  5J0Z A;  3UUB A;  2YOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...