4UM3A

Engineered ls-achbp with alpha4-alpha4 binding pocket in complex with ns3920
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
207
structure length
201
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLAHVVSDGEVQYTPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords ACETYLCHOLINE BINDING PROTEIN
publication title Achbp Engineered to Mimic the Alpha4-Alpha4 Binding Pocket in Alpha4Beta2 Nicotinic Acetylcholine Receptors Reveals Interface Specific Interactions Important for Binding and Activity
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 45
structure length 201
sequence length 207
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, Q, R, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i, j, k, l, m, n
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4um3A00
4UM3A 4AFTA 4IL9A 5TVCA 3U8MA 2PH9A 3T4MA 2QC1B 5J5GA 3RI5A 2PGZA 2BR7A 4ZJSA 4ZZBA 5BP0A 4NPPA 3EHZA 4UM3P 2XNTA 2XQ3A 3ZDHA 3U8NA 2BG9A 4QAAA 5AFLA 3UU5A 4A97A 3WTOA 5IUXA 2ZJUA 2XZ5A 3UU3A 1I9BA 5AFMA 5L4EA 2VL0A 4AFHA 5L47A 2XQ4A 4EZ1A 2XZ6A 3TLTA 3WTMA 4NZBA 2YOEA 4BQTA 3RQWA 4HFEA 4XK9A 3WIPA 4B5DA 4D01A 4TWHA 3TLVA 2XNUA 4ILCA 5KZUA 4TWFA 3RIFA 2WNJA 5HCJA 3ZKRA 3SQ9A 5J0ZA 4ILBA 4QH4A 4QH5A 4FRRA 2XYTA 5CFBA 3UU8A 2BYSA 3C79A 5HEJA 3SH1A 5HEGA 3UQ7A 3WTIA 2BYRA 3UQ4A 2UZ6A 3JAFA 2XQ6A 4UM1A 4ZR6A 5CO5A 4QH1A 2WZYA 4QACA 3EI0A 4ZZCA 3U8JA 2XQ5A 3GUAA 3UU6A 2Y56A 4HFBA 5AFJA 3WTJA 4TNVA 2YMEA 2XQAA 5AFNA 3LSVA 4ZJTA 2YKSA 4HFCA 1UX2A 4F8HA 4Z90A 2X00D 2X00A 2WN9A 3TLWA 3WTNA 5KE4A 5L4HA 2BG9C 3IGQA 5HEUA 4TNWA 2BYPA 1UW6A 2BG9E 2Y7YA 4PIRA 2XQ8A 3U8KA 3RIAA 4TWDA 3JAEA 3WTKA 3SQ6A 3PEOA 2XNVA 4LMLA 4WV9A 4LMKA 2C9TA 3JADA 4UY2A 5J5FA 5J5HA 2BR8A 2BYQA 2Y57A 3UUBA 5AINA 5HEHA 4AFGA 4HFIA 2WNCA 5AFHA 4XHEA 5J5IA 5LXBA 3RQUA 5AFMB 3PMZA 2BJ0A 4IL4A 4A98A 5SYOA 4ZRUA 4DBMA 5BW2A 3UU4A 5HCMA 3WTHA 3P50A 5LG3A 2YMDA 3P4WA 4LMJA 3TLUA 4X5TA 5FJVA 2BYNA 2Y54A 4ZK4A 4ILAA 4COFA 4UM3S 4ZK1A 5BRXA 3C84A 5JMEA 5HEOA 4UXUA 4Z91A 2Y58A 2BG9B 3TLSA 4BFQA 4IREA 3RHWA 3WTLA 3EAMA 2ZJVA 4HQPA 4QABA 2XQ9A 2WNLA 2XQ7A 2YN6A 4HFHA 3SIOA 3ZDGA 4ALXA 5AFKA 2W8FA 2W8GA 3U8LA 1UV6A 2XYSA 4HFDA
chains in the Genus database with same CATH superfamily
4UM3A 4AFTA 4IL9A 5TVCA 3U8MA 2PH9A 3T4MA 2QC1B 5J5GA 3RI5A 2PGZA 2BR7A 4ZJSA 4ZZBA 5BP0A 4NPPA 3EHZA 4UM3P 2XNTA 2XQ3A 3ZDHA 3U8NA 2BG9A 4QAAA 5AFLA 3UU5A 4A97A 3WTOA 5IUXA 2ZJUA 2XZ5A 3UU3A 1I9BA 5AFMA 5L4EA 2VL0A 4AFHA 5L47A 2XQ4A 4EZ1A 2XZ6A 3TLTA 3WTMA 4NZBA 2YOEA 4BQTA 3RQWA 4HFEA 4XK9A 3WIPA 4B5DA 4D01A 4TWHA 3TLVA 2XNUA 4ILCA 5KZUA 4TWFA 3RIFA 2WNJA 5HCJA 3ZKRA 3SQ9A 5J0ZA 4ILBA 4QH4A 4QH5A 4FRRA 2XYTA 5CFBA 3UU8A 2BYSA 3C79A 5HEJA 3SH1A 5HEGA 3UQ7A 3WTIA 2BYRA 3UQ4A 2UZ6A 3JAFA 2XQ6A 4UM1A 4ZR6A 5CO5A 4QH1A 2WZYA 4QACA 3EI0A 4ZZCA 3U8JA 2XQ5A 3GUAA 3UU6A 2Y56A 4HFBA 5AFJA 3WTJA 4TNVA 2YMEA 2XQAA 5AFNA 3LSVA 4ZJTA 2YKSA 4HFCA 1UX2A 4F8HA 4Z90A 2X00D 2X00A 2WN9A 3TLWA 3WTNA 5KE4A 5L4HA 2BG9C 3IGQA 5HEUA 4TNWA 2BYPA 1UW6A 2BG9E 2Y7YA 4PIRA 2XQ8A 3U8KA 3RIAA 4TWDA 3JAEA 3WTKA 3SQ6A 3PEOA 2XNVA 4LMLA 4WV9A 4LMKA 2C9TA 3JADA 4UY2A 5J5FA 5J5HA 2BR8A 2BYQA 2Y57A 3UUBA 5AINA 5HEHA 4AFGA 4HFIA 2WNCA 5AFHA 4XHEA 5J5IA 5LXBA 3RQUA 5AFMB 3PMZA 2BJ0A 4IL4A 4A98A 5SYOA 4ZRUA 4DBMA 5BW2A 3UU4A 5HCMA 3WTHA 3P50A 5LG3A 2YMDA 3P4WA 4LMJA 3TLUA 4X5TA 5FJVA 2BYNA 2Y54A 4ZK4A 4ILAA 4COFA 4UM3S 4ZK1A 5BRXA 3C84A 5JMEA 5HEOA 4UXUA 4Z91A 2Y58A 2BG9B 3TLSA 4BFQA 4IREA 3RHWA 3WTLA 3EAMA 2ZJVA 4HQPA 4QABA 2XQ9A 2WNLA 2XQ7A 2YN6A 4HFHA 3SIOA 3ZDGA 4ALXA 5AFKA 2W8FA 2W8GA 3U8LA 1UV6A 2XYSA 4HFDA
chains in the Genus database with same CATH topology
4UM3A 4AFTA 4IL9A 5TVCA 3U8MA 2PH9A 3T4MA 2QC1B 5J5GA 3RI5A 2PGZA 2BR7A 4ZJSA 4ZZBA 5BP0A 4NPPA 3EHZA 4UM3P 2XNTA 2XQ3A 3ZDHA 3U8NA 2BG9A 4QAAA 5AFLA 3UU5A 4A97A 3WTOA 5IUXA 2ZJUA 2XZ5A 3UU3A 1I9BA 5AFMA 5L4EA 2VL0A 4AFHA 5L47A 2XQ4A 4EZ1A 2XZ6A 3TLTA 3WTMA 4NZBA 2YOEA 4BQTA 3RQWA 4HFEA 4XK9A 3WIPA 4B5DA 4D01A 4TWHA 3TLVA 2XNUA 4ILCA 5KZUA 4TWFA 3RIFA 2WNJA 5HCJA 3ZKRA 3SQ9A 5J0ZA 4ILBA 4QH4A 4QH5A 4FRRA 2XYTA 5CFBA 3UU8A 2BYSA 3C79A 5HEJA 3SH1A 5HEGA 3UQ7A 3WTIA 2BYRA 3UQ4A 2UZ6A 3JAFA 2XQ6A 4UM1A 4ZR6A 5CO5A 4QH1A 2WZYA 4QACA 3EI0A 4ZZCA 3U8JA 2XQ5A 3GUAA 3UU6A 2Y56A 4HFBA 5AFJA 3WTJA 4TNVA 2YMEA 2XQAA 5AFNA 3LSVA 4ZJTA 2YKSA 4HFCA 1UX2A 4F8HA 4Z90A 2X00D 2X00A 2WN9A 3TLWA 3WTNA 5KE4A 5L4HA 2BG9C 3IGQA 5HEUA 4TNWA 2BYPA 1UW6A 2BG9E 2Y7YA 4PIRA 2XQ8A 3U8KA 3RIAA 4TWDA 3JAEA 3WTKA 3SQ6A 3PEOA 2XNVA 4LMLA 4WV9A 4LMKA 2C9TA 3JADA 4UY2A 5J5FA 5J5HA 2BR8A 2BYQA 2Y57A 3UUBA 5AINA 5HEHA 4AFGA 4HFIA 2WNCA 5AFHA 4XHEA 5J5IA 5LXBA 3RQUA 5AFMB 3PMZA 2BJ0A 4IL4A 4A98A 5SYOA 4ZRUA 4DBMA 5BW2A 3UU4A 5HCMA 3WTHA 3P50A 5LG3A 2YMDA 3P4WA 4LMJA 3TLUA 4X5TA 5FJVA 2BYNA 2Y54A 4ZK4A 4ILAA 4COFA 4UM3S 4ZK1A 5BRXA 3C84A 5JMEA 5HEOA 4UXUA 4Z91A 2Y58A 2BG9B 3TLSA 4BFQA 4IREA 3RHWA 3WTLA 3EAMA 2ZJVA 4HQPA 4QABA 2XQ9A 2WNLA 2XQ7A 2YN6A 4HFHA 3SIOA 3ZDGA 4ALXA 5AFKA 2W8FA 2W8GA 3U8LA 1UV6A 2XYSA 4HFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UM3 A;  4AFT A;  4IL9 A;  5TVC A;  3U8M A;  2PH9 A;  3T4M A;  2QC1 B;  5J5G A;  3RI5 A;  2PGZ A;  2BR7 A;  4ZJS A;  4ZZB A;  5BP0 A;  4NPP A;  3EHZ A;  4UM3 P;  2XNT A;  2XQ3 A;  3ZDH A;  3U8N A;  2BG9 A;  4QAA A;  5AFL A;  3UU5 A;  4A97 A;  3WTO A;  5IUX A;  2ZJU A;  2XZ5 A;  3UU3 A;  1I9B A;  5AFM A;  5L4E A;  2VL0 A;  4AFH A;  5L47 A;  2XQ4 A;  4EZ1 A;  2XZ6 A;  3TLT A;  3WTM A;  4NZB A;  2YOE A;  4BQT A;  3RQW A;  4HFE A;  4XK9 A;  3WIP A;  4B5D A;  4D01 A;  4TWH A;  3TLV A;  2XNU A;  4ILC A;  5KZU A;  4TWF A;  3RIF A;  2WNJ A;  5HCJ A;  3ZKR A;  3SQ9 A;  5J0Z A;  4ILB A;  4QH4 A;  4QH5 A;  4FRR A;  2XYT A;  5CFB A;  3UU8 A;  2BYS A;  3C79 A;  5HEJ A;  3SH1 A;  5HEG A;  3UQ7 A;  3WTI A;  2BYR A;  3UQ4 A;  2UZ6 A;  3JAF A;  2XQ6 A;  4UM1 A;  4ZR6 A;  5CO5 A;  4QH1 A;  2WZY A;  4QAC A;  3EI0 A;  4ZZC A;  3U8J A;  2XQ5 A;  3GUA A;  3UU6 A;  2Y56 A;  4HFB A;  5AFJ A;  3WTJ A;  4TNV A;  2YME A;  2XQA A;  5AFN A;  3LSV A;  4ZJT A;  2YKS A;  4HFC A;  1UX2 A;  4F8H A;  4Z90 A;  2X00 D;  2X00 A;  2WN9 A;  3TLW A;  3WTN A;  5KE4 A;  5L4H A;  2BG9 C;  3IGQ A;  5HEU A;  4TNW A;  2BYP A;  1UW6 A;  2BG9 E;  2Y7Y A;  4PIR A;  2XQ8 A;  3U8K A;  3RIA A;  4TWD A;  3JAE A;  3WTK A;  3SQ6 A;  3PEO A;  2XNV A;  4LML A;  4WV9 A;  4LMK A;  2C9T A;  3JAD A;  4UY2 A;  5J5F A;  5J5H A;  2BR8 A;  2BYQ A;  2Y57 A;  3UUB A;  5AIN A;  5HEH A;  4AFG A;  4HFI A;  2WNC A;  5AFH A;  4XHE A;  5J5I A;  5LXB A;  3RQU A;  5AFM B;  3PMZ A;  2BJ0 A;  4IL4 A;  4A98 A;  5SYO A;  4ZRU A;  4DBM A;  5BW2 A;  3UU4 A;  5HCM A;  3WTH A;  3P50 A;  5LG3 A;  2YMD A;  3P4W A;  4LMJ A;  3TLU A;  4X5T A;  5FJV A;  2BYN A;  2Y54 A;  4ZK4 A;  4ILA A;  4COF A;  4UM3 S;  4ZK1 A;  5BRX A;  3C84 A;  5JME A;  5HEO A;  4UXU A;  4Z91 A;  2Y58 A;  2BG9 B;  3TLS A;  4BFQ A;  4IRE A;  3RHW A;  3WTL A;  3EAM A;  2ZJV A;  4HQP A;  4QAB A;  2XQ9 A;  2WNL A;  2XQ7 A;  2YN6 A;  4HFH A;  3SIO A;  3ZDG A;  4ALX A;  5AFK A;  2W8F A;  2W8G A;  3U8L A;  1UV6 A;  2XYS A;  4HFD A; 
#chains in the Genus database with same CATH topology
 4UM3 A;  4AFT A;  4IL9 A;  5TVC A;  3U8M A;  2PH9 A;  3T4M A;  2QC1 B;  5J5G A;  3RI5 A;  2PGZ A;  2BR7 A;  4ZJS A;  4ZZB A;  5BP0 A;  4NPP A;  3EHZ A;  4UM3 P;  2XNT A;  2XQ3 A;  3ZDH A;  3U8N A;  2BG9 A;  4QAA A;  5AFL A;  3UU5 A;  4A97 A;  3WTO A;  5IUX A;  2ZJU A;  2XZ5 A;  3UU3 A;  1I9B A;  5AFM A;  5L4E A;  2VL0 A;  4AFH A;  5L47 A;  2XQ4 A;  4EZ1 A;  2XZ6 A;  3TLT A;  3WTM A;  4NZB A;  2YOE A;  4BQT A;  3RQW A;  4HFE A;  4XK9 A;  3WIP A;  4B5D A;  4D01 A;  4TWH A;  3TLV A;  2XNU A;  4ILC A;  5KZU A;  4TWF A;  3RIF A;  2WNJ A;  5HCJ A;  3ZKR A;  3SQ9 A;  5J0Z A;  4ILB A;  4QH4 A;  4QH5 A;  4FRR A;  2XYT A;  5CFB A;  3UU8 A;  2BYS A;  3C79 A;  5HEJ A;  3SH1 A;  5HEG A;  3UQ7 A;  3WTI A;  2BYR A;  3UQ4 A;  2UZ6 A;  3JAF A;  2XQ6 A;  4UM1 A;  4ZR6 A;  5CO5 A;  4QH1 A;  2WZY A;  4QAC A;  3EI0 A;  4ZZC A;  3U8J A;  2XQ5 A;  3GUA A;  3UU6 A;  2Y56 A;  4HFB A;  5AFJ A;  3WTJ A;  4TNV A;  2YME A;  2XQA A;  5AFN A;  3LSV A;  4ZJT A;  2YKS A;  4HFC A;  1UX2 A;  4F8H A;  4Z90 A;  2X00 D;  2X00 A;  2WN9 A;  3TLW A;  3WTN A;  5KE4 A;  5L4H A;  2BG9 C;  3IGQ A;  5HEU A;  4TNW A;  2BYP A;  1UW6 A;  2BG9 E;  2Y7Y A;  4PIR A;  2XQ8 A;  3U8K A;  3RIA A;  4TWD A;  3JAE A;  3WTK A;  3SQ6 A;  3PEO A;  2XNV A;  4LML A;  4WV9 A;  4LMK A;  2C9T A;  3JAD A;  4UY2 A;  5J5F A;  5J5H A;  2BR8 A;  2BYQ A;  2Y57 A;  3UUB A;  5AIN A;  5HEH A;  4AFG A;  4HFI A;  2WNC A;  5AFH A;  4XHE A;  5J5I A;  5LXB A;  3RQU A;  5AFM B;  3PMZ A;  2BJ0 A;  4IL4 A;  4A98 A;  5SYO A;  4ZRU A;  4DBM A;  5BW2 A;  3UU4 A;  5HCM A;  3WTH A;  3P50 A;  5LG3 A;  2YMD A;  3P4W A;  4LMJ A;  3TLU A;  4X5T A;  5FJV A;  2BYN A;  2Y54 A;  4ZK4 A;  4ILA A;  4COF A;  4UM3 S;  4ZK1 A;  5BRX A;  3C84 A;  5JME A;  5HEO A;  4UXU A;  4Z91 A;  2Y58 A;  2BG9 B;  3TLS A;  4BFQ A;  4IRE A;  3RHW A;  3WTL A;  3EAM A;  2ZJV A;  4HQP A;  4QAB A;  2XQ9 A;  2WNL A;  2XQ7 A;  2YN6 A;  4HFH A;  3SIO A;  3ZDG A;  4ALX A;  5AFK A;  2W8F A;  2W8G A;  3U8L A;  1UV6 A;  2XYS A;  4HFD A; 
#chains in the Genus database with same CATH homology
 4UM3 A;  4AFT A;  4IL9 A;  5TVC A;  3U8M A;  2PH9 A;  3T4M A;  2QC1 B;  5J5G A;  3RI5 A;  2PGZ A;  2BR7 A;  4ZJS A;  4ZZB A;  5BP0 A;  4NPP A;  3EHZ A;  4UM3 P;  2XNT A;  2XQ3 A;  3ZDH A;  3U8N A;  2BG9 A;  4QAA A;  5AFL A;  3UU5 A;  4A97 A;  3WTO A;  5IUX A;  2ZJU A;  2XZ5 A;  3UU3 A;  1I9B A;  5AFM A;  5L4E A;  2VL0 A;  4AFH A;  5L47 A;  2XQ4 A;  4EZ1 A;  2XZ6 A;  3TLT A;  3WTM A;  4NZB A;  2YOE A;  4BQT A;  3RQW A;  4HFE A;  4XK9 A;  3WIP A;  4B5D A;  4D01 A;  4TWH A;  3TLV A;  2XNU A;  4ILC A;  5KZU A;  4TWF A;  3RIF A;  2WNJ A;  5HCJ A;  3ZKR A;  3SQ9 A;  5J0Z A;  4ILB A;  4QH4 A;  4QH5 A;  4FRR A;  2XYT A;  5CFB A;  3UU8 A;  2BYS A;  3C79 A;  5HEJ A;  3SH1 A;  5HEG A;  3UQ7 A;  3WTI A;  2BYR A;  3UQ4 A;  2UZ6 A;  3JAF A;  2XQ6 A;  4UM1 A;  4ZR6 A;  5CO5 A;  4QH1 A;  2WZY A;  4QAC A;  3EI0 A;  4ZZC A;  3U8J A;  2XQ5 A;  3GUA A;  3UU6 A;  2Y56 A;  4HFB A;  5AFJ A;  3WTJ A;  4TNV A;  2YME A;  2XQA A;  5AFN A;  3LSV A;  4ZJT A;  2YKS A;  4HFC A;  1UX2 A;  4F8H A;  4Z90 A;  2X00 D;  2X00 A;  2WN9 A;  3TLW A;  3WTN A;  5KE4 A;  5L4H A;  2BG9 C;  3IGQ A;  5HEU A;  4TNW A;  2BYP A;  1UW6 A;  2BG9 E;  2Y7Y A;  4PIR A;  2XQ8 A;  3U8K A;  3RIA A;  4TWD A;  3JAE A;  3WTK A;  3SQ6 A;  3PEO A;  2XNV A;  4LML A;  4WV9 A;  4LMK A;  2C9T A;  3JAD A;  4UY2 A;  5J5F A;  5J5H A;  2BR8 A;  2BYQ A;  2Y57 A;  3UUB A;  5AIN A;  5HEH A;  4AFG A;  4HFI A;  2WNC A;  5AFH A;  4XHE A;  5J5I A;  5LXB A;  3RQU A;  5AFM B;  3PMZ A;  2BJ0 A;  4IL4 A;  4A98 A;  5SYO A;  4ZRU A;  4DBM A;  5BW2 A;  3UU4 A;  5HCM A;  3WTH A;  3P50 A;  5LG3 A;  2YMD A;  3P4W A;  4LMJ A;  3TLU A;  4X5T A;  5FJV A;  2BYN A;  2Y54 A;  4ZK4 A;  4ILA A;  4COF A;  4UM3 S;  4ZK1 A;  5BRX A;  3C84 A;  5JME A;  5HEO A;  4UXU A;  4Z91 A;  2Y58 A;  2BG9 B;  3TLS A;  4BFQ A;  4IRE A;  3RHW A;  3WTL A;  3EAM A;  2ZJV A;  4HQP A;  4QAB A;  2XQ9 A;  2WNL A;  2XQ7 A;  2YN6 A;  4HFH A;  3SIO A;  3ZDG A;  4ALX A;  5AFK A;  2W8F A;  2W8G A;  3U8L A;  1UV6 A;  2XYS A;  4HFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...