4UM3A

Engineered ls-achbp with alpha4-alpha4 binding pocket in complex with ns3920
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
207
structure length
201
Chain Sequence
b'LDRADILYNIRQTSRPDVIPTQRRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLAHVVSDGEVQYTPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE BINDING PROTEIN
publication title Achbp Engineered to Mimic the Alpha4-Alpha4 Binding Pocket in Alpha4Beta2 Nicotinic Acetylcholine Receptors Reveals Interface Specific Interactions Important for Binding and Activity
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 45
structure length 201
sequence length 207
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, Q, R, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i, j, k, l, m, n
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4um3A00
3RQUA 5HCMA 3PMZA 5JMEA 2XQ8A 3WTHA 3ZDHA 5FJVA 4PIRA 3T4MA 4TWDA 2ZJUA 5KE4A 5HCJA 5HEGA 5HEUA 3U8LA 4AFHA 2BG9B 4BQTA 5AFNA 2W8FA 5L47A 2XQAA 3SQ6A 5J5HA 4COFA 5AFMB 1UX2A 4HFHA 3UU6A 5HEHA 2XQ9A 3TLUA 4XK9A 5CFBA 3SH1A 4B5DA 2YKSA 2WZYA 2BG9A 2YN6A 2YMDA 2ZJVA 3GUAA 4NZBA 4TNWA 3IGQA 3UU3A 5AFMA 2XQ7A 2QC1B 4ILBA 4X5TA 4TNVA 3WTNA 4LMKA 3RQWA 5HEJA 2X00A 3C79A 2BYSA 2XYTA 3UQ7A 5AFLA 2Y54A 2Y58A 5HEOA 5TVCA 4QACA 3EI0A 2YOEA 3EHZA 3P4WA 4IL4A 3UU8A 4DBMA 5AFKA 2XNTA 2BR7A 5BP0A 4ZR6A 5AFHA 5BRXA 2WNCA 5J5GA 4ZK4A 2XQ5A 3U8NA 2BG9E 2BJ0A 4EZ1A 4QAAA 3WTKA 4ILCA 2XQ6A 5AINA 3JAEA 4NPPA 3RI5A 5LG3A 4ZRUA 4UM1A 4WV9A 4D01A 4A97A 2WNLA 5AFJA 2VL0A 2XZ6A 5J0ZA 5L4HA 4HQPA 2YMEA 2BYPA 1UV6A 4IREA 4XHEA 5J5IA 4HFBA 2W8GA 3TLSA 2XZ5A 4QH4A 3SQ9A 2PGZA 1I9BA 3TLWA 5LXBA 2XYSA 4UM3S 2Y7YA 4QH1A 2WN9A 5IUXA 4LMLA 4HFIA 4HFCA 3PEOA 5J5FA 4BFQA 4QH5A 4AFTA 4HFEA 3WIPA 4Z90A 2BYQA 2X00D 2BG9C 4ZJTA 4TWFA 4ZK1A 4ILAA 4QABA 3TLVA 3U8MA 4UM3P 4TWHA 3P50A 3WTIA 2XQ3A 2WNJA 2PH9A 4FRRA 2XNVA 3U8JA 5BW2A 4ALXA 3UUBA 3UQ4A 3UU5A 3WTMA 4UY2A 4UM3A 3U8KA 2Y56A 3UU4A 4AFGA 4A98A 4UXUA 3WTJA 2C9TA 2BR8A 4Z91A 3ZDGA 2BYRA 3RIAA 3EAMA 4ZZCA 4LMJA 3C84A 4IL9A 3JAFA 1UW6A 4ZZBA 3RIFA 4ZJSA 2XNUA 2BYNA 3SIOA 4F8HA 3RHWA 2UZ6A 3JADA 2Y57A 4HFDA 3WTLA 3WTOA 5SYOA 2XQ4A 5KZUA 5L4EA 3TLTA 3LSVA 5CO5A 3ZKRA
chains in the Genus database with same CATH superfamily
3RQUA 5HCMA 3PMZA 5JMEA 2XQ8A 3WTHA 3ZDHA 5FJVA 4PIRA 3T4MA 4TWDA 2ZJUA 5KE4A 5HCJA 5HEGA 5HEUA 3U8LA 4AFHA 2BG9B 4BQTA 5AFNA 2W8FA 5L47A 2XQAA 3SQ6A 5J5HA 4COFA 5AFMB 1UX2A 4HFHA 3UU6A 5HEHA 2XQ9A 3TLUA 4XK9A 5CFBA 3SH1A 4B5DA 2YKSA 2WZYA 2BG9A 2YN6A 2YMDA 2ZJVA 3GUAA 4NZBA 4TNWA 3IGQA 3UU3A 5AFMA 2XQ7A 2QC1B 4ILBA 4X5TA 4TNVA 3WTNA 4LMKA 3RQWA 5HEJA 2X00A 3C79A 2BYSA 2XYTA 3UQ7A 5AFLA 2Y54A 2Y58A 5HEOA 5TVCA 4QACA 3EI0A 2YOEA 3EHZA 3P4WA 4IL4A 3UU8A 4DBMA 5AFKA 2XNTA 2BR7A 5BP0A 4ZR6A 5AFHA 5BRXA 2WNCA 5J5GA 4ZK4A 2XQ5A 3U8NA 2BG9E 2BJ0A 4EZ1A 4QAAA 3WTKA 4ILCA 2XQ6A 5AINA 3JAEA 4NPPA 3RI5A 5LG3A 4ZRUA 4UM1A 4WV9A 4D01A 4A97A 2WNLA 5AFJA 2VL0A 2XZ6A 5J0ZA 5L4HA 4HQPA 2YMEA 2BYPA 1UV6A 4IREA 4XHEA 5J5IA 4HFBA 2W8GA 3TLSA 2XZ5A 4QH4A 3SQ9A 2PGZA 1I9BA 3TLWA 5LXBA 2XYSA 4UM3S 2Y7YA 4QH1A 2WN9A 5IUXA 4LMLA 4HFIA 4HFCA 3PEOA 5J5FA 4BFQA 4QH5A 4AFTA 4HFEA 3WIPA 4Z90A 2BYQA 2X00D 2BG9C 4ZJTA 4TWFA 4ZK1A 4ILAA 4QABA 3TLVA 3U8MA 4UM3P 4TWHA 3P50A 3WTIA 2XQ3A 2WNJA 2PH9A 4FRRA 2XNVA 3U8JA 5BW2A 4ALXA 3UUBA 3UQ4A 3UU5A 3WTMA 4UY2A 4UM3A 3U8KA 2Y56A 3UU4A 4AFGA 4A98A 4UXUA 3WTJA 2C9TA 2BR8A 4Z91A 3ZDGA 2BYRA 3RIAA 3EAMA 4ZZCA 4LMJA 3C84A 4IL9A 3JAFA 1UW6A 4ZZBA 3RIFA 4ZJSA 2XNUA 2BYNA 3SIOA 4F8HA 3RHWA 2UZ6A 3JADA 2Y57A 4HFDA 3WTLA 3WTOA 5SYOA 2XQ4A 5KZUA 5L4EA 3TLTA 3LSVA 5CO5A 3ZKRA
chains in the Genus database with same CATH topology
3RQUA 5HCMA 3PMZA 5JMEA 2XQ8A 3WTHA 3ZDHA 5FJVA 4PIRA 3T4MA 4TWDA 2ZJUA 5KE4A 5HCJA 5HEGA 5HEUA 3U8LA 4AFHA 2BG9B 4BQTA 5AFNA 2W8FA 5L47A 2XQAA 3SQ6A 5J5HA 4COFA 5AFMB 1UX2A 4HFHA 3UU6A 5HEHA 2XQ9A 3TLUA 4XK9A 5CFBA 3SH1A 4B5DA 2YKSA 2WZYA 2BG9A 2YN6A 2YMDA 2ZJVA 3GUAA 4NZBA 4TNWA 3IGQA 3UU3A 5AFMA 2XQ7A 2QC1B 4ILBA 4X5TA 4TNVA 3WTNA 4LMKA 3RQWA 5HEJA 2X00A 3C79A 2BYSA 2XYTA 3UQ7A 5AFLA 2Y54A 2Y58A 5HEOA 5TVCA 4QACA 3EI0A 2YOEA 3EHZA 3P4WA 4IL4A 3UU8A 4DBMA 5AFKA 2XNTA 2BR7A 5BP0A 4ZR6A 5AFHA 5BRXA 2WNCA 5J5GA 4ZK4A 2XQ5A 3U8NA 2BG9E 2BJ0A 4EZ1A 4QAAA 3WTKA 4ILCA 2XQ6A 5AINA 3JAEA 4NPPA 3RI5A 5LG3A 4ZRUA 4UM1A 4WV9A 4D01A 4A97A 2WNLA 5AFJA 2VL0A 2XZ6A 5J0ZA 5L4HA 4HQPA 2YMEA 2BYPA 1UV6A 4IREA 4XHEA 5J5IA 4HFBA 2W8GA 3TLSA 2XZ5A 4QH4A 3SQ9A 2PGZA 1I9BA 3TLWA 5LXBA 2XYSA 4UM3S 2Y7YA 4QH1A 2WN9A 5IUXA 4LMLA 4HFIA 4HFCA 3PEOA 5J5FA 4BFQA 4QH5A 4AFTA 4HFEA 3WIPA 4Z90A 2BYQA 2X00D 2BG9C 4ZJTA 4TWFA 4ZK1A 4ILAA 4QABA 3TLVA 3U8MA 4UM3P 4TWHA 3P50A 3WTIA 2XQ3A 2WNJA 2PH9A 4FRRA 2XNVA 3U8JA 5BW2A 4ALXA 3UUBA 3UQ4A 3UU5A 3WTMA 4UY2A 4UM3A 3U8KA 2Y56A 3UU4A 4AFGA 4A98A 4UXUA 3WTJA 2C9TA 2BR8A 4Z91A 3ZDGA 2BYRA 3RIAA 3EAMA 4ZZCA 4LMJA 3C84A 4IL9A 3JAFA 1UW6A 4ZZBA 3RIFA 4ZJSA 2XNUA 2BYNA 3SIOA 4F8HA 3RHWA 2UZ6A 3JADA 2Y57A 4HFDA 3WTLA 3WTOA 5SYOA 2XQ4A 5KZUA 5L4EA 3TLTA 3LSVA 5CO5A 3ZKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQU A;  5HCM A;  3PMZ A;  5JME A;  2XQ8 A;  3WTH A;  3ZDH A;  5FJV A;  4PIR A;  3T4M A;  4TWD A;  2ZJU A;  5KE4 A;  5HCJ A;  5HEG A;  5HEU A;  3U8L A;  4AFH A;  2BG9 B;  4BQT A;  5AFN A;  2W8F A;  5L47 A;  2XQA A;  3SQ6 A;  5J5H A;  4COF A;  5AFM B;  1UX2 A;  4HFH A;  3UU6 A;  5HEH A;  2XQ9 A;  3TLU A;  4XK9 A;  5CFB A;  3SH1 A;  4B5D A;  2YKS A;  2WZY A;  2BG9 A;  2YN6 A;  2YMD A;  2ZJV A;  3GUA A;  4NZB A;  4TNW A;  3IGQ A;  3UU3 A;  5AFM A;  2XQ7 A;  2QC1 B;  4ILB A;  4X5T A;  4TNV A;  3WTN A;  4LMK A;  3RQW A;  5HEJ A;  2X00 A;  3C79 A;  2BYS A;  2XYT A;  3UQ7 A;  5AFL A;  2Y54 A;  2Y58 A;  5HEO A;  5TVC A;  4QAC A;  3EI0 A;  2YOE A;  3EHZ A;  3P4W A;  4IL4 A;  3UU8 A;  4DBM A;  5AFK A;  2XNT A;  2BR7 A;  5BP0 A;  4ZR6 A;  5AFH A;  5BRX A;  2WNC A;  5J5G A;  4ZK4 A;  2XQ5 A;  3U8N A;  2BG9 E;  2BJ0 A;  4EZ1 A;  4QAA A;  3WTK A;  4ILC A;  2XQ6 A;  5AIN A;  3JAE A;  4NPP A;  3RI5 A;  5LG3 A;  4ZRU A;  4UM1 A;  4WV9 A;  4D01 A;  4A97 A;  2WNL A;  5AFJ A;  2VL0 A;  2XZ6 A;  5J0Z A;  5L4H A;  4HQP A;  2YME A;  2BYP A;  1UV6 A;  4IRE A;  4XHE A;  5J5I A;  4HFB A;  2W8G A;  3TLS A;  2XZ5 A;  4QH4 A;  3SQ9 A;  2PGZ A;  1I9B A;  3TLW A;  5LXB A;  2XYS A;  4UM3 S;  2Y7Y A;  4QH1 A;  2WN9 A;  5IUX A;  4LML A;  4HFI A;  4HFC A;  3PEO A;  5J5F A;  4BFQ A;  4QH5 A;  4AFT A;  4HFE A;  3WIP A;  4Z90 A;  2BYQ A;  2X00 D;  2BG9 C;  4ZJT A;  4TWF A;  4ZK1 A;  4ILA A;  4QAB A;  3TLV A;  3U8M A;  4UM3 P;  4TWH A;  3P50 A;  3WTI A;  2XQ3 A;  2WNJ A;  2PH9 A;  4FRR A;  2XNV A;  3U8J A;  5BW2 A;  4ALX A;  3UUB A;  3UQ4 A;  3UU5 A;  3WTM A;  4UY2 A;  4UM3 A;  3U8K A;  2Y56 A;  3UU4 A;  4AFG A;  4A98 A;  4UXU A;  3WTJ A;  2C9T A;  2BR8 A;  4Z91 A;  3ZDG A;  2BYR A;  3RIA A;  3EAM A;  4ZZC A;  4LMJ A;  3C84 A;  4IL9 A;  3JAF A;  1UW6 A;  4ZZB A;  3RIF A;  4ZJS A;  2XNU A;  2BYN A;  3SIO A;  4F8H A;  3RHW A;  2UZ6 A;  3JAD A;  2Y57 A;  4HFD A;  3WTL A;  3WTO A;  5SYO A;  2XQ4 A;  5KZU A;  5L4E A;  3TLT A;  3LSV A;  5CO5 A;  3ZKR A; 
#chains in the Genus database with same CATH topology
 3RQU A;  5HCM A;  3PMZ A;  5JME A;  2XQ8 A;  3WTH A;  3ZDH A;  5FJV A;  4PIR A;  3T4M A;  4TWD A;  2ZJU A;  5KE4 A;  5HCJ A;  5HEG A;  5HEU A;  3U8L A;  4AFH A;  2BG9 B;  4BQT A;  5AFN A;  2W8F A;  5L47 A;  2XQA A;  3SQ6 A;  5J5H A;  4COF A;  5AFM B;  1UX2 A;  4HFH A;  3UU6 A;  5HEH A;  2XQ9 A;  3TLU A;  4XK9 A;  5CFB A;  3SH1 A;  4B5D A;  2YKS A;  2WZY A;  2BG9 A;  2YN6 A;  2YMD A;  2ZJV A;  3GUA A;  4NZB A;  4TNW A;  3IGQ A;  3UU3 A;  5AFM A;  2XQ7 A;  2QC1 B;  4ILB A;  4X5T A;  4TNV A;  3WTN A;  4LMK A;  3RQW A;  5HEJ A;  2X00 A;  3C79 A;  2BYS A;  2XYT A;  3UQ7 A;  5AFL A;  2Y54 A;  2Y58 A;  5HEO A;  5TVC A;  4QAC A;  3EI0 A;  2YOE A;  3EHZ A;  3P4W A;  4IL4 A;  3UU8 A;  4DBM A;  5AFK A;  2XNT A;  2BR7 A;  5BP0 A;  4ZR6 A;  5AFH A;  5BRX A;  2WNC A;  5J5G A;  4ZK4 A;  2XQ5 A;  3U8N A;  2BG9 E;  2BJ0 A;  4EZ1 A;  4QAA A;  3WTK A;  4ILC A;  2XQ6 A;  5AIN A;  3JAE A;  4NPP A;  3RI5 A;  5LG3 A;  4ZRU A;  4UM1 A;  4WV9 A;  4D01 A;  4A97 A;  2WNL A;  5AFJ A;  2VL0 A;  2XZ6 A;  5J0Z A;  5L4H A;  4HQP A;  2YME A;  2BYP A;  1UV6 A;  4IRE A;  4XHE A;  5J5I A;  4HFB A;  2W8G A;  3TLS A;  2XZ5 A;  4QH4 A;  3SQ9 A;  2PGZ A;  1I9B A;  3TLW A;  5LXB A;  2XYS A;  4UM3 S;  2Y7Y A;  4QH1 A;  2WN9 A;  5IUX A;  4LML A;  4HFI A;  4HFC A;  3PEO A;  5J5F A;  4BFQ A;  4QH5 A;  4AFT A;  4HFE A;  3WIP A;  4Z90 A;  2BYQ A;  2X00 D;  2BG9 C;  4ZJT A;  4TWF A;  4ZK1 A;  4ILA A;  4QAB A;  3TLV A;  3U8M A;  4UM3 P;  4TWH A;  3P50 A;  3WTI A;  2XQ3 A;  2WNJ A;  2PH9 A;  4FRR A;  2XNV A;  3U8J A;  5BW2 A;  4ALX A;  3UUB A;  3UQ4 A;  3UU5 A;  3WTM A;  4UY2 A;  4UM3 A;  3U8K A;  2Y56 A;  3UU4 A;  4AFG A;  4A98 A;  4UXU A;  3WTJ A;  2C9T A;  2BR8 A;  4Z91 A;  3ZDG A;  2BYR A;  3RIA A;  3EAM A;  4ZZC A;  4LMJ A;  3C84 A;  4IL9 A;  3JAF A;  1UW6 A;  4ZZB A;  3RIF A;  4ZJS A;  2XNU A;  2BYN A;  3SIO A;  4F8H A;  3RHW A;  2UZ6 A;  3JAD A;  2Y57 A;  4HFD A;  3WTL A;  3WTO A;  5SYO A;  2XQ4 A;  5KZU A;  5L4E A;  3TLT A;  3LSV A;  5CO5 A;  3ZKR A; 
#chains in the Genus database with same CATH homology
 3RQU A;  5HCM A;  3PMZ A;  5JME A;  2XQ8 A;  3WTH A;  3ZDH A;  5FJV A;  4PIR A;  3T4M A;  4TWD A;  2ZJU A;  5KE4 A;  5HCJ A;  5HEG A;  5HEU A;  3U8L A;  4AFH A;  2BG9 B;  4BQT A;  5AFN A;  2W8F A;  5L47 A;  2XQA A;  3SQ6 A;  5J5H A;  4COF A;  5AFM B;  1UX2 A;  4HFH A;  3UU6 A;  5HEH A;  2XQ9 A;  3TLU A;  4XK9 A;  5CFB A;  3SH1 A;  4B5D A;  2YKS A;  2WZY A;  2BG9 A;  2YN6 A;  2YMD A;  2ZJV A;  3GUA A;  4NZB A;  4TNW A;  3IGQ A;  3UU3 A;  5AFM A;  2XQ7 A;  2QC1 B;  4ILB A;  4X5T A;  4TNV A;  3WTN A;  4LMK A;  3RQW A;  5HEJ A;  2X00 A;  3C79 A;  2BYS A;  2XYT A;  3UQ7 A;  5AFL A;  2Y54 A;  2Y58 A;  5HEO A;  5TVC A;  4QAC A;  3EI0 A;  2YOE A;  3EHZ A;  3P4W A;  4IL4 A;  3UU8 A;  4DBM A;  5AFK A;  2XNT A;  2BR7 A;  5BP0 A;  4ZR6 A;  5AFH A;  5BRX A;  2WNC A;  5J5G A;  4ZK4 A;  2XQ5 A;  3U8N A;  2BG9 E;  2BJ0 A;  4EZ1 A;  4QAA A;  3WTK A;  4ILC A;  2XQ6 A;  5AIN A;  3JAE A;  4NPP A;  3RI5 A;  5LG3 A;  4ZRU A;  4UM1 A;  4WV9 A;  4D01 A;  4A97 A;  2WNL A;  5AFJ A;  2VL0 A;  2XZ6 A;  5J0Z A;  5L4H A;  4HQP A;  2YME A;  2BYP A;  1UV6 A;  4IRE A;  4XHE A;  5J5I A;  4HFB A;  2W8G A;  3TLS A;  2XZ5 A;  4QH4 A;  3SQ9 A;  2PGZ A;  1I9B A;  3TLW A;  5LXB A;  2XYS A;  4UM3 S;  2Y7Y A;  4QH1 A;  2WN9 A;  5IUX A;  4LML A;  4HFI A;  4HFC A;  3PEO A;  5J5F A;  4BFQ A;  4QH5 A;  4AFT A;  4HFE A;  3WIP A;  4Z90 A;  2BYQ A;  2X00 D;  2BG9 C;  4ZJT A;  4TWF A;  4ZK1 A;  4ILA A;  4QAB A;  3TLV A;  3U8M A;  4UM3 P;  4TWH A;  3P50 A;  3WTI A;  2XQ3 A;  2WNJ A;  2PH9 A;  4FRR A;  2XNV A;  3U8J A;  5BW2 A;  4ALX A;  3UUB A;  3UQ4 A;  3UU5 A;  3WTM A;  4UY2 A;  4UM3 A;  3U8K A;  2Y56 A;  3UU4 A;  4AFG A;  4A98 A;  4UXU A;  3WTJ A;  2C9T A;  2BR8 A;  4Z91 A;  3ZDG A;  2BYR A;  3RIA A;  3EAM A;  4ZZC A;  4LMJ A;  3C84 A;  4IL9 A;  3JAF A;  1UW6 A;  4ZZB A;  3RIF A;  4ZJS A;  2XNU A;  2BYN A;  3SIO A;  4F8H A;  3RHW A;  2UZ6 A;  3JAD A;  2Y57 A;  4HFD A;  3WTL A;  3WTO A;  5SYO A;  2XQ4 A;  5KZU A;  5L4E A;  3TLT A;  3LSV A;  5CO5 A;  3ZKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...