4HFCA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to 2-bromo-ethanol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfcA01
3ZDHA 4Z90A 4XHEA 4QACA 4NPPA 1UV6A 2BR8A 2XQ8A 4IL4A 5J0ZA 2W8FA 2WNCA 2XYSA 5AFKA 4QABA 4LMJA 5BRXA 2PH9A 3C79A 4WV9A 3UUBA 4ZJSA 3EAMA 4ZR6A 4DBMA 2XQAA 2UZ6A 3TLVA 5CO5A 3P4WA 4UM3A 3RQWA 4AFGA 3WTOA 1OEDB 3EHZA 3RI5A 4X5TA 3SQ9A 2LKHA 3TLUA 2MAWA 2W8GA 4LMKA 2QC1B 4NZBA 3IGQA 2BYRA 4QH5A 2WNLA 4UM1A 5KZUA 4F8HA 1UX2A 4UY2A 3ZKRA 2YOEA 5J5GA 3SQ6A 2ZJUA 4TNWA 2XQ6A 2BYQA 4COFA 4AFHA 2XYTA 4QAAA 4ILAA 2ZJVA 3UQ4A 4AFTA 2KSRA 5AFLA 5HCMA 3JAEA 2PGZA 4B5DA 4ILBA 2XQ5A 2LLYA 4UM3P 4UXUA 3U8NA 5HEGA 3WTIA 4ALXA 3EI0A 2VL0A 3GUAA 3UU8A 2BG9C 3WTKA 4D01A 1OEDA 5HEJA 5L4HA 3T4MA 4UM3S 5L47A 4TWHA 4BFQA 2BYNA 4HFCA 2LKGA 2XZ6A 3U8LA 2XZ5A 5HEHA 4ZK4A 5BW2A 4BQTA 4HFDA 3ZDGA 2XNTA 3TLSA 2XNVA 4HFHA 5IUXA 5J5IA 3PMZA 3JAFA 5HEUA 2YMDA 5AFMA 4A98A 3UU4A 2YKSA 5J5FA 3RIFA 2YN6A 2YMEA 4EZ1A 2M6BA 2Y54A 3SIOA 3WTJA 3WTLA 2Y56A 3U8JA 4TNVA 2Y7YA 5J5HA 5JMEA 4LMLA 3UU3A 5L4EA 5AINA 5LG3A 2BJ0A 2WZYA 4ZRUA 5SYOA 1UW6A 1OEDC 2BG9B 3LSVA 2XQ4A 2WNJA 3PEOA 5LXBA 4IREA 2BR7A 5TVCA 2BYSA 2Y58A 2X00A 4XK9A 4ZJTA 2M6IA 2XNUA 3WTMA 2BYPA 3U8MA 4HFEA 3TLTA 5HEOA 4ZZBA 4HQPA 3RIAA 1OEDE 4A97A 3U8KA 5FJVA 5AFHA 5HCJA 4PIRA 3UQ7A 3WIPA 2XQ9A 3UU6A 2WN9A 2Y57A 2BG9E 2BG9A 3P50A 3JADA 5CFBA 4Z91A 2C9TA 2XQ7A 4TWFA 4ZZCA 3RHWA 4IL9A 4FRRA 3C84A 2XQ3A 4QH4A 5BP0A 3WTNA 5KE4A 3UU5A 4ZK1A 3WTHA 4ILCA 3SH1A 5AFNA 4HFIA 3TLWA 3RQUA 1I9BA 4TWDA 2LM2A 4HFBA 4QH1A 5AFMB 2X00D 5AFJA
chains in the Genus database with same CATH superfamily
2E9XB 5LMNT 2KZ7B 5J2TE 4PJLA 4H9QC 4GYSA 2XQAA 5FL1A 4YFSA 3TLVA 4DV4T 4EV6A 3RPUA 2BBJA 5LJMA 4UM1A 4TNWA 2XQYA 5TAOA 1VRBA 2X0LB 4DR7T 5JDHA 4IE6A 2FJAA 4UM3P 2BS4A 1WYBA 3N2GE 4TWHA 4BFQA 2XNVA 2WDQA 3WAKA 2JRKA 2PG8A 4QHOA 2YINA 4AXPA 5JREA 5FXVA 4LFCT 2V6XA 5AQMB 2WMNA 5ETWA 4K0UA 3O1IA 4U2ZA 4B3ST 3AEDA 1AJ3A 3LFMA 3D0TA 3GA8A 4IREA 1D0ZA 3OYZA 2BKPA 2CHNA 3NRYA 5M4YA 3TLTA 5LA6E 5LNKA 2OV9A 4O4HE 1BR2A 4WZXA 1G73A 3UUMA 4PJJA 1QLBA 1D0XA 2LSIA 3KV9A 2LHNA 4QACA 3MACA 4O2BE 1HNZT 4DO0A 5JRCA 4O4IE 4EB6E 5LP6E 3T8OA 2LRKA 3PUYF 4JI7T 4X62T 2H7VC 4UVBB 3N9MA 4QH5A 3C98B 1MNDA 1KF6A 4DNDA 5AQJB 3RIUC 3K3OA 3JAEA 4ZI3D 3Q5WA 1YD8G 3HI2A 4UEMA 3Q5EA 4JLEA 3N9OA 5IUXA 3CIRA 1UGOA 3VR8A 4U72A 3ONLC 5AFMA 5H6RB 1XNQT 1HG5A 2YN6A 3RLFF 2V5DA 2Y56A 3U8JA 5FVLA 3I9WA 3JC6C 2N9DA 4IDOA 4DVDA 2VQET 2Y58A 1Z8UA 3AE1A 4X66T 2M67A 1YQ4A 4ASKA 5HXEA 3LK3B 4GK0E 3K3NA 4YJ2E 3P50A 3JADA 2J47A 4X1KE 1YW0A 3N9NA 4UELA 3VKGA 3WTNA 2CLYB 2HH7A 4DMVA 1LKXA 5DJQC 2DHRA 2XYSA 2K48A 3VKHA 2WDRA 3O1HA 2XM1A 4H63V 3I1AA 1ZEEA 2W4XA 2FUPA 1T98A 3GN5A 2C5KT 3PV0F 4O8SA 5JDLA 1OWAA 2MAWA 1GQEA 4FI5A 4LMKA 2XAFB 2CWOA 3Q2MA 2NTYA 1WCRA 2D9DA 4QX7B 4WYVA 2E2AA 3AEAA 2JQHA 3CWZB 5HXHA 3ANWA 4X65T 3OTOT 3EVYA 1S35A 3UFGA 3W15B 3LK42 2QVAA 3J9X1 4UVAB 4H9RC 4UXUA 2JPFA 5FY0A 5ABFB 1D0YA 4OFZA 2EHOC 2IDOB 1IBMT 3LG7A 3KINB 4YSXA 2YMDA 1ZOYA 2X9HA 3ABVA 5JDQA 1WR0A 5LBMA 4GIWA 2PTFA 1OEDC 4AKRB 5BMVE 3RRCA 4DV6T 3A5XA 4H63H 3RRWA 1LVKA 2VQFT 3PUSA 1XNRT 2WBLA 4DV5T 3OYXA 3P4PA 1MIVA 1N34T 2CEAA 3DTOA 3SFDA 1E1HB 2BG9A 4B3MT 4JV5T 2V8SV 4AI6A 4CXXA 3RC3A 3FZLB 3RQUA 1LVFA 1KNPA 1L0VA 3NZPA 3P4QA 3KDSE 2IC9A 3FB2A 5C2TA 4TZ4C 1KNZA 3M3ZB 4AQYT 3C79A 3AA0B 4U2YA 2DNXA 3JC6D 2NP9A 4A56A 2Y6XA 2GK9A 4DUYT 1OEDB 3B13A 3TLUA 2H88A 5L3EB 2XSAA 3OJAA 2Z6EA 2VB6A 2XQ6A 4PNIA 4N78D 2XJ7A 1ZV4X 2I59A 5CB4E 3SS1A 3WTKA 5L47A 4LFAT 2CLYC 1W0BA 2XZ6A 1NWMX 4BQTA 2KLQA 3CX6B 2UUCT 4YY3T 4X64T 4EEDA 5IYZE 1T8BA 2UXNB 2HHHT 2LE8A 5JDNA 2DWKA 4OK0A 4HWIB 3NKZA 5CA0E 4ANJA 3LBXA 3PEOA 1KEYA 3MZKB 5JR9A 4JI2T 5LXTE 1FMWA 2XNUA 3UT5E 4DV7T 1T72A 5FJVA 2H3RA 2X66A 3VHLA 3V5UA 1FJGT 1I94T 5KE4A 4ILCA 5AFNA 5L3CB 2SPCA 5GONE 4LF9T 4UF0B 2X68A 3NWIA 3KV5A 4ZI3C 5DABA 2RPAA 3PE0A 4U74A 4KX6A 2VVNA 1J5ET 4PK6A 2NTXA 5FKYA 4LF7T 4JBWF 5J5GA 2ZJUA 4ZEYA 3OKQA 3A8YC 4IIJE 1U4QA 3C64A 2ZM6T 4KMCA 2X9YA 3ZMTB 1JNRA 1N32T 3AE6A 2RP4A 2IIUA 4XZCA 3ONXA 3NRXA 5CA1E 1S94A 3RYHE 4JI0T 3AAEB 4LF5T 1MNEA 3QK6A 3VRAA 2EHOA 2LSGA 5JMEA 3H3MA 4E7ZA 1WYCA 4NUVA 4X1YE 2XQ4A 2UUBT 1Y01A 5TVCA 4G2AA 1IJ6A 2WDVA 3U8MA 5HEOA 4JUYA 3ZMSB 3PTRB 4ISTA 4JI3T 4LF6T 2N1GA 5BR8T 4B6XA 3MK7C 4JI8T 1FEWA 4IDNA 2UXCT 2H7OA 2LM2A 3AA1B 4J2CA 3PU8A 4DR4T 2KNDA 3UFEA 3FBLA 2BKOA 2UU9T 3EDUA 3PURA 2WQYA 3CKDA 1KNRA 1J5WA 4EAHA 1O3XA 3QB5A 3C4ZA 4JEUB 2BYRA 3RGLA 3SOLA 3SQ6A 2QRXA 5FMNA 4KUMB 1UK5A 4ZS2A 3UUXB 3N2OA 2PGZA 2PBIA 2WZHA 3AE3A 2W2UA 1BR0A 2QGSA 4UM3S 3AXJB 2V7KA 2LKGA 5BW2A 3O9XA 5JDGA 2KWIB 4HN9A 3ZN1B 2Y8DA 3GWHA 2A3DA 5HWXA 4H9PC 3QUJA 3HKCE 4YSYA 5E0OA 3B5MA 1HTJF 2OLTA 4NXMT 2L3LA 2LT3A 4NUUA 2BYSA 3F31A 4IDQA 3RIAA 1JNZA 4YSZA 2MOZA 2Y57A 3MXZA 3DJBA 4EGWA 4IL9A 4YHJA 1M7KA 1U5PA 3KVAA 1X9BA 5JDFA 3MJXA 5JRCB 1V9DA 1G8XA 4NXNT 3ZMZB 4OYKA 2CXFA 4AKHA 5EK3A 3ZT5A 2V7LA 3AE5A 4EZHA 2XY8B 1HR0T 3PDYA 5ABEA 5FY7A 2WY2A 3AEGA 3R6NA 2NW8A 1XZYA 2LHRA 2WMOA 4EIWA 4AFHA 2C5JA 2XAQB 4DUZT 2W61A 5JDMA 5AFLA 3AXJA 2WZIA 5HAXA 2CHOA 4ILBA 2XQ5A 5FL0A 3LJCA 3GUAA 2VVSA 4U7IA 4D01A 2ZM2A 3AA6B 3AE4A 5AQRB 2WCAA 2BYNA 2C0SA 2WWUA 3AE9A 2IMLA 5EK2A 2PJQA 2UXXB 5LOVE 5HWYA 2LEHA 2BJ0A 3VR9A 3RC8A 1ZP0A 5AQUB 2X00A 5AQHB 3TKLB 4YHHT 3RIUA 4IE0A 4MALA 2L8KA 4IDPA 4LF4T 3QNUA 2BBHA 3WIPA 3FXEB 2L9QA 5KXJA 2WN9A 2WU2A 3UUNA 2DCFA 3HR0A 3CX8B 1HNWT 2W63A 5L3DB 3ZDHA 4XHEA 2XQ8A 2IW5B 5BRXA 5ADXL 4ZR6A 2IC6A 2JQKA 4PJMA 4UM3A 4AFGA 3ZC1A 2H89A 1XDOA 2CBJA 3IGQA 4FJOA 1UX2A 3FZKB 2X0HA 2I6HA 3AVSA 4JI1T 3OBVE 3ZSTA 5LB7B 5EZYE 2YU2A 1WRDA 5JR9C 3KFWX 4ADZA 4ALXA 3EI0A 3L8RA 5CJ5A 1KFYA 5KMGP 3BQLA 4CQIA 3P8CD 4HFHA 1Y64B 2E9XD 2F4VT 3MKDA 1H7CA 3IF8B 4QKNA 4LFBT 2MTQA 4ERRA 3NVOA 2XASB 3J7Yq 3C4WA 5LYJE 1BR4A 1W09A 2OA5A 5AFUL 3RF1A 2V1DB 2BVLA 4C90A 4XK9A 2E5VA 4KHPT 5CGMA 1T7SA 4HQPA 2XSBA 3ANWB 3FHNA 4I4TE 5AQOB 2CWYA 2D2SA 2X9WA 1CHUA 3AE8A 4HEAA 4QH4A 5LG4A 4OYJA 5FXXA 4GK5E 5FP3A 2E8IA 2DL1A 2K3WA 2X00D 5LHHB 4Z8XA 1UCUA 2Q9QB 2NW7A 5LHGB 2WNCA 4ILUA 4LMJA 2KXPB 3I0OA 4I50E 4YJ3E 4ZJSA 3O4XE 2IHR1 3SQ9A 2CBIA 3HL6A 4UV9B 4GYRA 1IBLT 4AKIA 3C50A 2BS3A 3A7MA 1VOMA 2ZJVA 4XBFB 2KSRA 2VL0A 2CE7A 1OEDA 1MMAA 2C5IT 2V5CA 3H3AA 4CN4A 3ZJ2A 4ZS3A 3ZPOA 1WFDA 3SFEA 2HPJA 5AQSB 2YMEA 4EZ1A 2Y54A 4BJNA 5FXWA 3HKEE 2Y7YA 1X79A 1N36T 4CI1B 3AEEA 3V5SA 2V6YB 5L4EA 4GOUA 1VCSA 3P7IA 4TV9E 2LSKA 2XHEB 3AECA 5C3JA 3N2KE 2BZBA 4A97A 1XMOT 3CQGB 5AQVB 4EYUA 1HNXT 2K24A 2BG9E 5ABFA 2C9TA 2XAGB 5JR9B 2XQ3A 3CQCB 4QXCB 4IHJE 1HS7A 4C91A 2VKJA 2I0MA 4JEHB 2JJ9A 4ZHQE 2BR8A 4IL4A 4PK5A 5AFKA 1IJ5A 4I0UA 2XAHB 2PFVA 4YT0A 3E0ZA 2BS2A 5AQFB 5LCYA 1MMGA 1FIOA 2XPKA 5L3BB 5J1GA 4H9OC 4NZBA 4WBOA 3CVRA 2YOEA 4M1PA 2NW9A 2WSSV 4UF0A 3RX6A 3PJAJ 4DR3T 4B3RT 3SWHA 3WAJA 1WLXA 5FNVE 5HCMA 4CN6A 4KHZF 3KBUA 3U8NA 3ZLIA 3WTIA 3QB5K 3UU8A 3ESLA 5LGTB 2XZ5A 5HEHA 4BA9A 4HFDA 2JQ9A 3HKDE 2YKSA 3L39A 1UX4A 3AE7A 3WTLA 3WTJA 4H9SE 3ZT6A 4KI0F 2CXLA 2DLRA 3RYFE 2NOXA 2V26A 4MHCA 4UIGA 2VK9A 4PFPA 4UR9A 1IAPA 3GN5B 5LHIB 4TWFA 3OVUA 3AVRA 3UTKA 3ZSSA 2WS3A 1M62A 3RHWA 1I6ZA 4EEBA 4I55E 3UU5A 4HKAA 4AQFC 2J4GA 3TLWA 4ZI2C 3NBXX 5IHYA 2D5UA 1W0AA 2UXDT 2DWGA 2PH9A 3DP7A 4CZZB 2VKOA 3LK2B 3P4WA 1YXRA 3QC9A 4X5TA 2FJBA 2LKHA 5LGNB 2QC1B 2IAKA 4HWFA 1R8IA 2WNLA 4L5GA 3ZKRA 2Y48B 3GMIA 2LJLA 3X1DA 4QAAA 4TN7B 2CPTA 4AFTA 1UUSA 1DU2A 2QA7A 5IWAT 4NIQA 3CK6A 3ETVA 5HEGA 2ZMAA 2WU5A 3EDVA 3N5LA 1SUMB 4EXTA 3E22E 2W66A 3BQKA 5AQKB 2MYSA 3ZT7A 4E7SA 3P4SA 3PU3A 4KBMB 5J5FA 2HN1A 2RA1A 2M6BA 2MBGA 2G0UA 3LDQB 5J5HA 4WW0A 3UU3A 3KBTA 5H6QB 4ZOLE 1UW6A 5L3FB 1YKEB 4TUYE 2LOPA 1IZNB 5DQWA 4ZXLA 2BYPA 4IGUA 3BQIA 2A9UA 3IEEA 2D0UA 5HCJA 2FBWA 4Q25A 1FMVA 2LM9A 4Z91A 3K8PC 4L9IA 4ZK1A 3SH1A 3ZCIA 1I9BA 4QH1A 1XMQT 2YDQA 2JMKA 4BAYB 2EHOD 2WB5A 1D1AA 2J62A 2BKNA 3F2EA 5LBQB 1MIWA 4DBMA 2ZLYA 2ZM0A 3VRBA 3EHZA 5AQGB 3C4XA 3E08A 2HPLA 3ZCJA 3ZC0A 3ZN0B 4AKLA 2BYQA 4COFA 1CUNA 4O4JE 4TV8E 2XYTA 2A72A 4IE7A 5F8PA 5FXZA 4UV8B 4A5XA 3AAAB 4HTEA 2BG9C 4IDZA 2XAJB 5L4HA 4HE8A 4CI2B 3T1HT 4QXHB 4YLHA 5HEUA 4F6RC 3B57A 4U7YA 4B3TT 3PUAA 2ODVA 3SIOA 3ZMUB 4DR6T 3C51A 3EUHA 3U3IA 3FBZA 2YK0A 3VU7H 2V7MA 3FXDB 3RKOA 3PJAA 1E7PA 1EZ3A 5ABGA 2M6IA 4QXBB 3WTMA 2ES0A 1BR1A 5HXCA 4DR5T 3UQ7A 2JMHA 2XQ9A 3HA4A 5J2UE 2IUBA 4FRRA 2B76A 3C84A 4BJMA 5BP0A 4JI4T 3WTHA 2XM2A 3ZMVB 3IBPA 4TWDA 2XTLA 5HXSA 1E2AA 5KDMC 5AQTB 4DV1T 3PUXF 1HF8A 1UV6A 2W8FA 5J0ZA 3RYIE 2K9AA 4P0AA 4OX9T 3EAMA 5LGUB 3PUQA 4CXWA 4EZ4A 2KINB 3RI5A 4CN1A 1HX8A 2VKHA 1D1BA 4YTNA 4F8HA 5L2LA 1HFAA 2HN2A 4DR1T 2Q9QA 4YTPA 3IA3A 2BVMA 4HGAA 2XUEA 3KV4A 2LSJA 5FVKA 3BK9A 3OPCA 5HEJA 1MMDA 3U8LA 4ZK4A 3ZDGA 1UX5A 3AE2A 3TLSA 1YQ3A 4HFVA 1N33T 4PAGA 5L3GB 3PMZA 5AQQB 1NENA 3T1YT 3RIFA 3K1SA 3AEBA 3AA7B 3SRZA 3CPZA 4KP3C 2J1DG 5AINA 1SA0E 4P1NA 2WZYA 4DBQA 2BG9B 3LSVA 3CQXC 2QYWA 3O1JA 4DV3T 3Q5XA 1QSDA 2VURA 3QOFA 4HFEA 2CA5A 2WAUA 2W67A 4ZZBA 3U8KA 4PIRA 1ZHCA 5AQIB 5AQPB 1US7B 2V7IA 4X1IE 1NAFA 5CFBA 3ETUA 1MMNA 2XQ7A 2YU1A 3KV6A 3N9PA 2V6YA 4HFIA 3ZEFB 5C8YE 5AFJA 4WNKA 1KK7A 2P9BA 4QABA 2LOSA 5ABHA 3G06A 3K3QC 4AQFA 5CO5A 3L09A 2VASA 3WI3A 2KMFA 4P0BA 5KZUA 2VL8A 4ZI2D 2CMRA 4QWNB 2E9XC 4DMWA 1Z0PA 3UQ4A 4U31A 3PUZF 3RH3A 1HX1B 3CX7B 1XDPA 4DBRA 3PUGA 3T4MA 5KX5E 2LRLA 1WR6A 3HKBE 4EYYR 2XNTA 4U3CA 4HWHA 4PW8A 3JAFA 3NZQA 4OHFA 2NWBA 4PK4A 4A98A 2VWAA 1VCTA 5FYMA 2UUAT 5A1LA 1QUUA 5JVDE 4DR2T 2AE9A 4LMLA 3EABA 5SYOA 2CRBA 3AAIA 3KVBA 2BR7A 2WP9A 4UXNB 4AIUA 2DI4A 4IE4A 4ZJTA 4O2AE 2W62A 3ZYKA 2E9XA 1OXZA 3IHRA 4CXYA 2VKDA 4ZZCA 4CI3B 2A2FX 3I9YA 2KWHA 2FJEA 4WBNE 1IBKT 2R6GF 4NPPA 5JTGA 4JYAT 5LJNA 2B1EA 4PFOA 5JH7E 3M65A 3N9QA 2BDEA 3R84B 2UZ6A 3RQWA 2N2NA 1SHZC 3H37A 4IT4A 4UY2A 3U78A 2ZM8A 4HWDA 1UURA 4UVCB 4B5DA 2V7JA 4HWCA 4DV0T 3LBXB 4HFCA 3FZMB 3PUWF 4ZI7E 2WM9A 2ACXA 5J5IA 4AKGA 2JQQA 3JCFA 3UU4A 4YXDA 2ODUA 2YDSA 5JQGE 4U33A 3ZYMA 4TNVA 4QX8B 5LMUT 2CXDA 4XAXB 3FZHB 2WNJA 1B7TA 4V1Av 5LXBA 1J1JA 2Q9QD 2K5BB 2ACZA 4MBQA 5AQLB 1D1CA 3Q5DA 5DQVA 3MA9A 2YDRA 2E5LT 2Q9QC 5HXRA 1OEDE 3P4RA 3UULA 1MIYA 2KT9A 2X67A 2W0GA 4P09A 4JI5T 2YEVC 4LF8T 2X9XA 3RYCE 3AEFA 4HFBA 4H9NC 1W9RA 4L0RA 1ZKEA 4Z90A 3AB3B 3ZJ1A 2JIWA 2AXDS 2X51A 4EOZB 4WV9A 3UUBA 1SE7A 2LSYA 4TX5A 3WTOA 2W8GA 4I43B 3N9LA 3RKGA 5EK4A 2CCQA 4ILAA 1XWMA 4DV2T 3S4UA 4G63A 2LLYA 4DIDB 1NEKA 2X0YA 1HG2A 2CM0A 2XZEA 3CMLA 4X20E 3F57A 2WWVA 1HCIA 4AISA 3I0QA 3ONJA 5F3JA 4IE5A 4MFRA 5F5WA 1YKHB 3L3PA 4GKJT 5LG3A 4ZRUA 4GKKT 4AQGA 3ZYLA 2FJDA 5AQNB 3Q9DA 4MLKA 2EHOB 2D0TA 2MPKA 4PJNA 4O4LE 4K0KT 4YTMA 2W00A 2UXBT 5HYAA 5AFHA 3UU6A 5FY1A 2NR4A 3PUVF 3FZFB 4ISSA 5AFMB 1LRZA 4JI6T
chains in the Genus database with same CATH topology
3ZDHA 4Z90A 4XHEA 4QACA 4NPPA 1UV6A 2BR8A 2XQ8A 4IL4A 5J0ZA 2W8FA 2WNCA 2XYSA 5AFKA 4QABA 4LMJA 5BRXA 2PH9A 3C79A 4WV9A 3UUBA 4ZJSA 3EAMA 4ZR6A 4DBMA 2XQAA 2UZ6A 3TLVA 5CO5A 3P4WA 4UM3A 3RQWA 4AFGA 3WTOA 1OEDB 3EHZA 3RI5A 4X5TA 3SQ9A 2LKHA 3TLUA 2MAWA 2W8GA 4LMKA 2QC1B 4NZBA 3IGQA 2BYRA 4QH5A 2WNLA 4UM1A 5KZUA 4F8HA 1UX2A 4UY2A 3ZKRA 2YOEA 5J5GA 3SQ6A 2ZJUA 4TNWA 2XQ6A 2BYQA 4COFA 4AFHA 2XYTA 4QAAA 4ILAA 2ZJVA 3UQ4A 4AFTA 2KSRA 5AFLA 5HCMA 3JAEA 2PGZA 4B5DA 4ILBA 2XQ5A 2LLYA 4UM3P 4UXUA 3U8NA 5HEGA 3WTIA 4ALXA 3EI0A 2VL0A 3GUAA 3UU8A 2BG9C 3WTKA 4D01A 1OEDA 5HEJA 5L4HA 3T4MA 4UM3S 5L47A 4TWHA 4BFQA 2BYNA 4HFCA 2LKGA 2XZ6A 3U8LA 2XZ5A 5HEHA 4ZK4A 5BW2A 4BQTA 4HFDA 3ZDGA 2XNTA 3TLSA 2XNVA 4HFHA 5IUXA 5J5IA 3PMZA 3JAFA 5HEUA 2YMDA 5AFMA 4A98A 3UU4A 2YKSA 5J5FA 3RIFA 2YN6A 2YMEA 4EZ1A 2M6BA 2Y54A 3SIOA 3WTJA 3WTLA 2Y56A 3U8JA 4TNVA 2Y7YA 5J5HA 5JMEA 4LMLA 3UU3A 5L4EA 5AINA 5LG3A 2BJ0A 2WZYA 4ZRUA 5SYOA 1UW6A 1OEDC 2BG9B 3LSVA 2XQ4A 2WNJA 3PEOA 5LXBA 4IREA 2BR7A 5TVCA 2BYSA 2Y58A 2X00A 4XK9A 4ZJTA 2M6IA 2XNUA 3WTMA 2BYPA 3U8MA 4HFEA 3TLTA 5HEOA 4ZZBA 4HQPA 3RIAA 1OEDE 4A97A 3U8KA 5FJVA 5AFHA 5HCJA 4PIRA 3UQ7A 3WIPA 2XQ9A 3UU6A 2WN9A 2Y57A 2BG9E 2BG9A 3P50A 3JADA 5CFBA 4Z91A 2C9TA 2XQ7A 4TWFA 4ZZCA 3RHWA 4IL9A 4FRRA 3C84A 2XQ3A 4QH4A 5BP0A 3WTNA 5KE4A 3UU5A 4ZK1A 3WTHA 4ILCA 3SH1A 5AFNA 4HFIA 3TLWA 3RQUA 1I9BA 4TWDA 2LM2A 4HFBA 4QH1A 5AFMB 2X00D 5AFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDH A;  4Z90 A;  4XHE A;  4QAC A;  4NPP A;  1UV6 A;  2BR8 A;  2XQ8 A;  4IL4 A;  5J0Z A;  2W8F A;  2WNC A;  2XYS A;  5AFK A;  4QAB A;  4LMJ A;  5BRX A;  2PH9 A;  3C79 A;  4WV9 A;  3UUB A;  4ZJS A;  3EAM A;  4ZR6 A;  4DBM A;  2XQA A;  2UZ6 A;  3TLV A;  5CO5 A;  3P4W A;  4UM3 A;  3RQW A;  4AFG A;  3WTO A;  1OED B;  3EHZ A;  3RI5 A;  4X5T A;  3SQ9 A;  2LKH A;  3TLU A;  2MAW A;  2W8G A;  4LMK A;  2QC1 B;  4NZB A;  3IGQ A;  2BYR A;  4QH5 A;  2WNL A;  4UM1 A;  5KZU A;  4F8H A;  1UX2 A;  4UY2 A;  3ZKR A;  2YOE A;  5J5G A;  3SQ6 A;  2ZJU A;  4TNW A;  2XQ6 A;  2BYQ A;  4COF A;  4AFH A;  2XYT A;  4QAA A;  4ILA A;  2ZJV A;  3UQ4 A;  4AFT A;  2KSR A;  5AFL A;  5HCM A;  3JAE A;  2PGZ A;  4B5D A;  4ILB A;  2XQ5 A;  2LLY A;  4UM3 P;  4UXU A;  3U8N A;  5HEG A;  3WTI A;  4ALX A;  3EI0 A;  2VL0 A;  3GUA A;  3UU8 A;  2BG9 C;  3WTK A;  4D01 A;  1OED A;  5HEJ A;  5L4H A;  3T4M A;  4UM3 S;  5L47 A;  4TWH A;  4BFQ A;  2BYN A;  4HFC A;  2LKG A;  2XZ6 A;  3U8L A;  2XZ5 A;  5HEH A;  4ZK4 A;  5BW2 A;  4BQT A;  4HFD A;  3ZDG A;  2XNT A;  3TLS A;  2XNV A;  4HFH A;  5IUX A;  5J5I A;  3PMZ A;  3JAF A;  5HEU A;  2YMD A;  5AFM A;  4A98 A;  3UU4 A;  2YKS A;  5J5F A;  3RIF A;  2YN6 A;  2YME A;  4EZ1 A;  2M6B A;  2Y54 A;  3SIO A;  3WTJ A;  3WTL A;  2Y56 A;  3U8J A;  4TNV A;  2Y7Y A;  5J5H A;  5JME A;  4LML A;  3UU3 A;  5L4E A;  5AIN A;  5LG3 A;  2BJ0 A;  2WZY A;  4ZRU A;  5SYO A;  1UW6 A;  1OED C;  2BG9 B;  3LSV A;  2XQ4 A;  2WNJ A;  3PEO A;  5LXB A;  4IRE A;  2BR7 A;  5TVC A;  2BYS A;  2Y58 A;  2X00 A;  4XK9 A;  4ZJT A;  2M6I A;  2XNU A;  3WTM A;  2BYP A;  3U8M A;  4HFE A;  3TLT A;  5HEO A;  4ZZB A;  4HQP A;  3RIA A;  1OED E;  4A97 A;  3U8K A;  5FJV A;  5AFH A;  5HCJ A;  4PIR A;  3UQ7 A;  3WIP A;  2XQ9 A;  3UU6 A;  2WN9 A;  2Y57 A;  2BG9 E;  2BG9 A;  3P50 A;  3JAD A;  5CFB A;  4Z91 A;  2C9T A;  2XQ7 A;  4TWF A;  4ZZC A;  3RHW A;  4IL9 A;  4FRR A;  3C84 A;  2XQ3 A;  4QH4 A;  5BP0 A;  3WTN A;  5KE4 A;  3UU5 A;  4ZK1 A;  3WTH A;  4ILC A;  3SH1 A;  5AFN A;  4HFI A;  3TLW A;  3RQU A;  1I9B A;  4TWD A;  2LM2 A;  4HFB A;  4QH1 A;  5AFM B;  2X00 D;  5AFJ A; 
#chains in the Genus database with same CATH topology
 2E9X B;  5LMN T;  2KZ7 B;  5J2T E;  4PJL A;  4H9Q C;  4GYS A;  2XQA A;  5FL1 A;  4YFS A;  3TLV A;  4DV4 T;  4EV6 A;  3RPU A;  2BBJ A;  5LJM A;  4UM1 A;  4TNW A;  2XQY A;  5TAO A;  1VRB A;  2X0L B;  4DR7 T;  5JDH A;  4IE6 A;  2FJA A;  4UM3 P;  2BS4 A;  1WYB A;  3N2G E;  4TWH A;  4BFQ A;  2XNV A;  2WDQ A;  3WAK A;  2JRK A;  2PG8 A;  4QHO A;  2YIN A;  4AXP A;  5JRE A;  5FXV A;  4LFC T;  2V6X A;  5AQM B;  2WMN A;  5ETW A;  4K0U A;  3O1I A;  4U2Z A;  4B3S T;  3AED A;  1AJ3 A;  3LFM A;  3D0T A;  3GA8 A;  4IRE A;  1D0Z A;  3OYZ A;  2BKP A;  2CHN A;  3NRY A;  5M4Y A;  3TLT A;  5LA6 E;  5LNK A;  2OV9 A;  4O4H E;  1BR2 A;  4WZX A;  1G73 A;  3UUM A;  4PJJ A;  1QLB A;  1D0X A;  2LSI A;  3KV9 A;  2LHN A;  4QAC A;  3MAC A;  4O2B E;  1HNZ T;  4DO0 A;  5JRC A;  4O4I E;  4EB6 E;  5LP6 E;  3T8O A;  2LRK A;  3PUY F;  4JI7 T;  4X62 T;  2H7V C;  4UVB B;  3N9M A;  4QH5 A;  3C98 B;  1MND A;  1KF6 A;  4DND A;  5AQJ B;  3RIU C;  3K3O A;  3JAE A;  4ZI3 D;  3Q5W A;  1YD8 G;  3HI2 A;  4UEM A;  3Q5E A;  4JLE A;  3N9O A;  5IUX A;  3CIR A;  1UGO A;  3VR8 A;  4U72 A;  3ONL C;  5AFM A;  5H6R B;  1XNQ T;  1HG5 A;  2YN6 A;  3RLF F;  2V5D A;  2Y56 A;  3U8J A;  5FVL A;  3I9W A;  3JC6 C;  2N9D A;  4IDO A;  4DVD A;  2VQE T;  2Y58 A;  1Z8U A;  3AE1 A;  4X66 T;  2M67 A;  1YQ4 A;  4ASK A;  5HXE A;  3LK3 B;  4GK0 E;  3K3N A;  4YJ2 E;  3P50 A;  3JAD A;  2J47 A;  4X1K E;  1YW0 A;  3N9N A;  4UEL A;  3VKG A;  3WTN A;  2CLY B;  2HH7 A;  4DMV A;  1LKX A;  5DJQ C;  2DHR A;  2XYS A;  2K48 A;  3VKH A;  2WDR A;  3O1H A;  2XM1 A;  4H63 V;  3I1A A;  1ZEE A;  2W4X A;  2FUP A;  1T98 A;  3GN5 A;  2C5K T;  3PV0 F;  4O8S A;  5JDL A;  1OWA A;  2MAW A;  1GQE A;  4FI5 A;  4LMK A;  2XAF B;  2CWO A;  3Q2M A;  2NTY A;  1WCR A;  2D9D A;  4QX7 B;  4WYV A;  2E2A A;  3AEA A;  2JQH A;  3CWZ B;  5HXH A;  3ANW A;  4X65 T;  3OTO T;  3EVY A;  1S35 A;  3UFG A;  3W15 B;  3LK4 2;  2QVA A;  3J9X 1;  4UVA B;  4H9R C;  4UXU A;  2JPF A;  5FY0 A;  5ABF B;  1D0Y A;  4OFZ A;  2EHO C;  2IDO B;  1IBM T;  3LG7 A;  3KIN B;  4YSX A;  2YMD A;  1ZOY A;  2X9H A;  3ABV A;  5JDQ A;  1WR0 A;  5LBM A;  4GIW A;  2PTF A;  1OED C;  4AKR B;  5BMV E;  3RRC A;  4DV6 T;  3A5X A;  4H63 H;  3RRW A;  1LVK A;  2VQF T;  3PUS A;  1XNR T;  2WBL A;  4DV5 T;  3OYX A;  3P4P A;  1MIV A;  1N34 T;  2CEA A;  3DTO A;  3SFD A;  1E1H B;  2BG9 A;  4B3M T;  4JV5 T;  2V8S V;  4AI6 A;  4CXX A;  3RC3 A;  3FZL B;  3RQU A;  1LVF A;  1KNP A;  1L0V A;  3NZP A;  3P4Q A;  3KDS E;  2IC9 A;  3FB2 A;  5C2T A;  4TZ4 C;  1KNZ A;  3M3Z B;  4AQY T;  3C79 A;  3AA0 B;  4U2Y A;  2DNX A;  3JC6 D;  2NP9 A;  4A56 A;  2Y6X A;  2GK9 A;  4DUY T;  1OED B;  3B13 A;  3TLU A;  2H88 A;  5L3E B;  2XSA A;  3OJA A;  2Z6E A;  2VB6 A;  2XQ6 A;  4PNI A;  4N78 D;  2XJ7 A;  1ZV4 X;  2I59 A;  5CB4 E;  3SS1 A;  3WTK A;  5L47 A;  4LFA T;  2CLY C;  1W0B A;  2XZ6 A;  1NWM X;  4BQT A;  2KLQ A;  3CX6 B;  2UUC T;  4YY3 T;  4X64 T;  4EED A;  5IYZ E;  1T8B A;  2UXN B;  2HHH T;  2LE8 A;  5JDN A;  2DWK A;  4OK0 A;  4HWI B;  3NKZ A;  5CA0 E;  4ANJ A;  3LBX A;  3PEO A;  1KEY A;  3MZK B;  5JR9 A;  4JI2 T;  5LXT E;  1FMW A;  2XNU A;  3UT5 E;  4DV7 T;  1T72 A;  5FJV A;  2H3R A;  2X66 A;  3VHL A;  3V5U A;  1FJG T;  1I94 T;  5KE4 A;  4ILC A;  5AFN A;  5L3C B;  2SPC A;  5GON E;  4LF9 T;  4UF0 B;  2X68 A;  3NWI A;  3KV5 A;  4ZI3 C;  5DAB A;  2RPA A;  3PE0 A;  4U74 A;  4KX6 A;  2VVN A;  1J5E T;  4PK6 A;  2NTX A;  5FKY A;  4LF7 T;  4JBW F;  5J5G A;  2ZJU A;  4ZEY A;  3OKQ A;  3A8Y C;  4IIJ E;  1U4Q A;  3C64 A;  2ZM6 T;  4KMC A;  2X9Y A;  3ZMT B;  1JNR A;  1N32 T;  3AE6 A;  2RP4 A;  2IIU A;  4XZC A;  3ONX A;  3NRX A;  5CA1 E;  1S94 A;  3RYH E;  4JI0 T;  3AAE B;  4LF5 T;  1MNE A;  3QK6 A;  3VRA A;  2EHO A;  2LSG A;  5JME A;  3H3M A;  4E7Z A;  1WYC A;  4NUV A;  4X1Y E;  2XQ4 A;  2UUB T;  1Y01 A;  5TVC A;  4G2A A;  1IJ6 A;  2WDV A;  3U8M A;  5HEO A;  4JUY A;  3ZMS B;  3PTR B;  4IST A;  4JI3 T;  4LF6 T;  2N1G A;  5BR8 T;  4B6X A;  3MK7 C;  4JI8 T;  1FEW A;  4IDN A;  2UXC T;  2H7O A;  2LM2 A;  3AA1 B;  4J2C A;  3PU8 A;  4DR4 T;  2KND A;  3UFE A;  3FBL A;  2BKO A;  2UU9 T;  3EDU A;  3PUR A;  2WQY A;  3CKD A;  1KNR A;  1J5W A;  4EAH A;  1O3X A;  3QB5 A;  3C4Z A;  4JEU B;  2BYR A;  3RGL A;  3SOL A;  3SQ6 A;  2QRX A;  5FMN A;  4KUM B;  1UK5 A;  4ZS2 A;  3UUX B;  3N2O A;  2PGZ A;  2PBI A;  2WZH A;  3AE3 A;  2W2U A;  1BR0 A;  2QGS A;  4UM3 S;  3AXJ B;  2V7K A;  2LKG A;  5BW2 A;  3O9X A;  5JDG A;  2KWI B;  4HN9 A;  3ZN1 B;  2Y8D A;  3GWH A;  2A3D A;  5HWX A;  4H9P C;  3QUJ A;  3HKC E;  4YSY A;  5E0O A;  3B5M A;  1HTJ F;  2OLT A;  4NXM T;  2L3L A;  2LT3 A;  4NUU A;  2BYS A;  3F31 A;  4IDQ A;  3RIA A;  1JNZ A;  4YSZ A;  2MOZ A;  2Y57 A;  3MXZ A;  3DJB A;  4EGW A;  4IL9 A;  4YHJ A;  1M7K A;  1U5P A;  3KVA A;  1X9B A;  5JDF A;  3MJX A;  5JRC B;  1V9D A;  1G8X A;  4NXN T;  3ZMZ B;  4OYK A;  2CXF A;  4AKH A;  5EK3 A;  3ZT5 A;  2V7L A;  3AE5 A;  4EZH A;  2XY8 B;  1HR0 T;  3PDY A;  5ABE A;  5FY7 A;  2WY2 A;  3AEG A;  3R6N A;  2NW8 A;  1XZY A;  2LHR A;  2WMO A;  4EIW A;  4AFH A;  2C5J A;  2XAQ B;  4DUZ T;  2W61 A;  5JDM A;  5AFL A;  3AXJ A;  2WZI A;  5HAX A;  2CHO A;  4ILB A;  2XQ5 A;  5FL0 A;  3LJC A;  3GUA A;  2VVS A;  4U7I A;  4D01 A;  2ZM2 A;  3AA6 B;  3AE4 A;  5AQR B;  2WCA A;  2BYN A;  2C0S A;  2WWU A;  3AE9 A;  2IML A;  5EK2 A;  2PJQ A;  2UXX B;  5LOV E;  5HWY A;  2LEH A;  2BJ0 A;  3VR9 A;  3RC8 A;  1ZP0 A;  5AQU B;  2X00 A;  5AQH B;  3TKL B;  4YHH T;  3RIU A;  4IE0 A;  4MAL A;  2L8K A;  4IDP A;  4LF4 T;  3QNU A;  2BBH A;  3WIP A;  3FXE B;  2L9Q A;  5KXJ A;  2WN9 A;  2WU2 A;  3UUN A;  2DCF A;  3HR0 A;  3CX8 B;  1HNW T;  2W63 A;  5L3D B;  3ZDH A;  4XHE A;  2XQ8 A;  2IW5 B;  5BRX A;  5ADX L;  4ZR6 A;  2IC6 A;  2JQK A;  4PJM A;  4UM3 A;  4AFG A;  3ZC1 A;  2H89 A;  1XDO A;  2CBJ A;  3IGQ A;  4FJO A;  1UX2 A;  3FZK B;  2X0H A;  2I6H A;  3AVS A;  4JI1 T;  3OBV E;  3ZST A;  5LB7 B;  5EZY E;  2YU2 A;  1WRD A;  5JR9 C;  3KFW X;  4ADZ A;  4ALX A;  3EI0 A;  3L8R A;  5CJ5 A;  1KFY A;  5KMG P;  3BQL A;  4CQI A;  3P8C D;  4HFH A;  1Y64 B;  2E9X D;  2F4V T;  3MKD A;  1H7C A;  3IF8 B;  4QKN A;  4LFB T;  2MTQ A;  4ERR A;  3NVO A;  2XAS B;  3J7Y q;  3C4W A;  5LYJ E;  1BR4 A;  1W09 A;  2OA5 A;  5AFU L;  3RF1 A;  2V1D B;  2BVL A;  4C90 A;  4XK9 A;  2E5V A;  4KHP T;  5CGM A;  1T7S A;  4HQP A;  2XSB A;  3ANW B;  3FHN A;  4I4T E;  5AQO B;  2CWY A;  2D2S A;  2X9W A;  1CHU A;  3AE8 A;  4HEA A;  4QH4 A;  5LG4 A;  4OYJ A;  5FXX A;  4GK5 E;  5FP3 A;  2E8I A;  2DL1 A;  2K3W A;  2X00 D;  5LHH B;  4Z8X A;  1UCU A;  2Q9Q B;  2NW7 A;  5LHG B;  2WNC A;  4ILU A;  4LMJ A;  2KXP B;  3I0O A;  4I50 E;  4YJ3 E;  4ZJS A;  3O4X E;  2IHR 1;  3SQ9 A;  2CBI A;  3HL6 A;  4UV9 B;  4GYR A;  1IBL T;  4AKI A;  3C50 A;  2BS3 A;  3A7M A;  1VOM A;  2ZJV A;  4XBF B;  2KSR A;  2VL0 A;  2CE7 A;  1OED A;  1MMA A;  2C5I T;  2V5C A;  3H3A A;  4CN4 A;  3ZJ2 A;  4ZS3 A;  3ZPO A;  1WFD A;  3SFE A;  2HPJ A;  5AQS B;  2YME A;  4EZ1 A;  2Y54 A;  4BJN A;  5FXW A;  3HKE E;  2Y7Y A;  1X79 A;  1N36 T;  4CI1 B;  3AEE A;  3V5S A;  2V6Y B;  5L4E A;  4GOU A;  1VCS A;  3P7I A;  4TV9 E;  2LSK A;  2XHE B;  3AEC A;  5C3J A;  3N2K E;  2BZB A;  4A97 A;  1XMO T;  3CQG B;  5AQV B;  4EYU A;  1HNX T;  2K24 A;  2BG9 E;  5ABF A;  2C9T A;  2XAG B;  5JR9 B;  2XQ3 A;  3CQC B;  4QXC B;  4IHJ E;  1HS7 A;  4C91 A;  2VKJ A;  2I0M A;  4JEH B;  2JJ9 A;  4ZHQ E;  2BR8 A;  4IL4 A;  4PK5 A;  5AFK A;  1IJ5 A;  4I0U A;  2XAH B;  2PFV A;  4YT0 A;  3E0Z A;  2BS2 A;  5AQF B;  5LCY A;  1MMG A;  1FIO A;  2XPK A;  5L3B B;  5J1G A;  4H9O C;  4NZB A;  4WBO A;  3CVR A;  2YOE A;  4M1P A;  2NW9 A;  2WSS V;  4UF0 A;  3RX6 A;  3PJA J;  4DR3 T;  4B3R T;  3SWH A;  3WAJ A;  1WLX A;  5FNV E;  5HCM A;  4CN6 A;  4KHZ F;  3KBU A;  3U8N A;  3ZLI A;  3WTI A;  3QB5 K;  3UU8 A;  3ESL A;  5LGT B;  2XZ5 A;  5HEH A;  4BA9 A;  4HFD A;  2JQ9 A;  3HKD E;  2YKS A;  3L39 A;  1UX4 A;  3AE7 A;  3WTL A;  3WTJ A;  4H9S E;  3ZT6 A;  4KI0 F;  2CXL A;  2DLR A;  3RYF E;  2NOX A;  2V26 A;  4MHC A;  4UIG A;  2VK9 A;  4PFP A;  4UR9 A;  1IAP A;  3GN5 B;  5LHI B;  4TWF A;  3OVU A;  3AVR A;  3UTK A;  3ZSS A;  2WS3 A;  1M62 A;  3RHW A;  1I6Z A;  4EEB A;  4I55 E;  3UU5 A;  4HKA A;  4AQF C;  2J4G A;  3TLW A;  4ZI2 C;  3NBX X;  5IHY A;  2D5U A;  1W0A A;  2UXD T;  2DWG A;  2PH9 A;  3DP7 A;  4CZZ B;  2VKO A;  3LK2 B;  3P4W A;  1YXR A;  3QC9 A;  4X5T A;  2FJB A;  2LKH A;  5LGN B;  2QC1 B;  2IAK A;  4HWF A;  1R8I A;  2WNL A;  4L5G A;  3ZKR A;  2Y48 B;  3GMI A;  2LJL A;  3X1D A;  4QAA A;  4TN7 B;  2CPT A;  4AFT A;  1UUS A;  1DU2 A;  2QA7 A;  5IWA T;  4NIQ A;  3CK6 A;  3ETV A;  5HEG A;  2ZMA A;  2WU5 A;  3EDV A;  3N5L A;  1SUM B;  4EXT A;  3E22 E;  2W66 A;  3BQK A;  5AQK B;  2MYS A;  3ZT7 A;  4E7S A;  3P4S A;  3PU3 A;  4KBM B;  5J5F A;  2HN1 A;  2RA1 A;  2M6B A;  2MBG A;  2G0U A;  3LDQ B;  5J5H A;  4WW0 A;  3UU3 A;  3KBT A;  5H6Q B;  4ZOL E;  1UW6 A;  5L3F B;  1YKE B;  4TUY E;  2LOP A;  1IZN B;  5DQW A;  4ZXL A;  2BYP A;  4IGU A;  3BQI A;  2A9U A;  3IEE A;  2D0U A;  5HCJ A;  2FBW A;  4Q25 A;  1FMV A;  2LM9 A;  4Z91 A;  3K8P C;  4L9I A;  4ZK1 A;  3SH1 A;  3ZCI A;  1I9B A;  4QH1 A;  1XMQ T;  2YDQ A;  2JMK A;  4BAY B;  2EHO D;  2WB5 A;  1D1A A;  2J62 A;  2BKN A;  3F2E A;  5LBQ B;  1MIW A;  4DBM A;  2ZLY A;  2ZM0 A;  3VRB A;  3EHZ A;  5AQG B;  3C4X A;  3E08 A;  2HPL A;  3ZCJ A;  3ZC0 A;  3ZN0 B;  4AKL A;  2BYQ A;  4COF A;  1CUN A;  4O4J E;  4TV8 E;  2XYT A;  2A72 A;  4IE7 A;  5F8P A;  5FXZ A;  4UV8 B;  4A5X A;  3AAA B;  4HTE A;  2BG9 C;  4IDZ A;  2XAJ B;  5L4H A;  4HE8 A;  4CI2 B;  3T1H T;  4QXH B;  4YLH A;  5HEU A;  4F6R C;  3B57 A;  4U7Y A;  4B3T T;  3PUA A;  2ODV A;  3SIO A;  3ZMU B;  4DR6 T;  3C51 A;  3EUH A;  3U3I A;  3FBZ A;  2YK0 A;  3VU7 H;  2V7M A;  3FXD B;  3RKO A;  3PJA A;  1E7P A;  1EZ3 A;  5ABG A;  2M6I A;  4QXB B;  3WTM A;  2ES0 A;  1BR1 A;  5HXC A;  4DR5 T;  3UQ7 A;  2JMH A;  2XQ9 A;  3HA4 A;  5J2U E;  2IUB A;  4FRR A;  2B76 A;  3C84 A;  4BJM A;  5BP0 A;  4JI4 T;  3WTH A;  2XM2 A;  3ZMV B;  3IBP A;  4TWD A;  2XTL A;  5HXS A;  1E2A A;  5KDM C;  5AQT B;  4DV1 T;  3PUX F;  1HF8 A;  1UV6 A;  2W8F A;  5J0Z A;  3RYI E;  2K9A A;  4P0A A;  4OX9 T;  3EAM A;  5LGU B;  3PUQ A;  4CXW A;  4EZ4 A;  2KIN B;  3RI5 A;  4CN1 A;  1HX8 A;  2VKH A;  1D1B A;  4YTN A;  4F8H A;  5L2L A;  1HFA A;  2HN2 A;  4DR1 T;  2Q9Q A;  4YTP A;  3IA3 A;  2BVM A;  4HGA A;  2XUE A;  3KV4 A;  2LSJ A;  5FVK A;  3BK9 A;  3OPC A;  5HEJ A;  1MMD A;  3U8L A;  4ZK4 A;  3ZDG A;  1UX5 A;  3AE2 A;  3TLS A;  1YQ3 A;  4HFV A;  1N33 T;  4PAG A;  5L3G B;  3PMZ A;  5AQQ B;  1NEN A;  3T1Y T;  3RIF A;  3K1S A;  3AEB A;  3AA7 B;  3SRZ A;  3CPZ A;  4KP3 C;  2J1D G;  5AIN A;  1SA0 E;  4P1N A;  2WZY A;  4DBQ A;  2BG9 B;  3LSV A;  3CQX C;  2QYW A;  3O1J A;  4DV3 T;  3Q5X A;  1QSD A;  2VUR A;  3QOF A;  4HFE A;  2CA5 A;  2WAU A;  2W67 A;  4ZZB A;  3U8K A;  4PIR A;  1ZHC A;  5AQI B;  5AQP B;  1US7 B;  2V7I A;  4X1I E;  1NAF A;  5CFB A;  3ETU A;  1MMN A;  2XQ7 A;  2YU1 A;  3KV6 A;  3N9P A;  2V6Y A;  4HFI A;  3ZEF B;  5C8Y E;  5AFJ A;  4WNK A;  1KK7 A;  2P9B A;  4QAB A;  2LOS A;  5ABH A;  3G06 A;  3K3Q C;  4AQF A;  5CO5 A;  3L09 A;  2VAS A;  3WI3 A;  2KMF A;  4P0B A;  5KZU A;  2VL8 A;  4ZI2 D;  2CMR A;  4QWN B;  2E9X C;  4DMW A;  1Z0P A;  3UQ4 A;  4U31 A;  3PUZ F;  3RH3 A;  1HX1 B;  3CX7 B;  1XDP A;  4DBR A;  3PUG A;  3T4M A;  5KX5 E;  2LRL A;  1WR6 A;  3HKB E;  4EYY R;  2XNT A;  4U3C A;  4HWH A;  4PW8 A;  3JAF A;  3NZQ A;  4OHF A;  2NWB A;  4PK4 A;  4A98 A;  2VWA A;  1VCT A;  5FYM A;  2UUA T;  5A1L A;  1QUU A;  5JVD E;  4DR2 T;  2AE9 A;  4LML A;  3EAB A;  5SYO A;  2CRB A;  3AAI A;  3KVB A;  2BR7 A;  2WP9 A;  4UXN B;  4AIU A;  2DI4 A;  4IE4 A;  4ZJT A;  4O2A E;  2W62 A;  3ZYK A;  2E9X A;  1OXZ A;  3IHR A;  4CXY A;  2VKD A;  4ZZC A;  4CI3 B;  2A2F X;  3I9Y A;  2KWH A;  2FJE A;  4WBN E;  1IBK T;  2R6G F;  4NPP A;  5JTG A;  4JYA T;  5LJN A;  2B1E A;  4PFO A;  5JH7 E;  3M65 A;  3N9Q A;  2BDE A;  3R84 B;  2UZ6 A;  3RQW A;  2N2N A;  1SHZ C;  3H37 A;  4IT4 A;  4UY2 A;  3U78 A;  2ZM8 A;  4HWD A;  1UUR A;  4UVC B;  4B5D A;  2V7J A;  4HWC A;  4DV0 T;  3LBX B;  4HFC A;  3FZM B;  3PUW F;  4ZI7 E;  2WM9 A;  2ACX A;  5J5I A;  4AKG A;  2JQQ A;  3JCF A;  3UU4 A;  4YXD A;  2ODU A;  2YDS A;  5JQG E;  4U33 A;  3ZYM A;  4TNV A;  4QX8 B;  5LMU T;  2CXD A;  4XAX B;  3FZH B;  2WNJ A;  1B7T A;  4V1A v;  5LXB A;  1J1J A;  2Q9Q D;  2K5B B;  2ACZ A;  4MBQ A;  5AQL B;  1D1C A;  3Q5D A;  5DQV A;  3MA9 A;  2YDR A;  2E5L T;  2Q9Q C;  5HXR A;  1OED E;  3P4R A;  3UUL A;  1MIY A;  2KT9 A;  2X67 A;  2W0G A;  4P09 A;  4JI5 T;  2YEV C;  4LF8 T;  2X9X A;  3RYC E;  3AEF A;  4HFB A;  4H9N C;  1W9R A;  4L0R A;  1ZKE A;  4Z90 A;  3AB3 B;  3ZJ1 A;  2JIW A;  2AXD S;  2X51 A;  4EOZ B;  4WV9 A;  3UUB A;  1SE7 A;  2LSY A;  4TX5 A;  3WTO A;  2W8G A;  4I43 B;  3N9L A;  3RKG A;  5EK4 A;  2CCQ A;  4ILA A;  1XWM A;  4DV2 T;  3S4U A;  4G63 A;  2LLY A;  4DID B;  1NEK A;  2X0Y A;  1HG2 A;  2CM0 A;  2XZE A;  3CML A;  4X20 E;  3F57 A;  2WWV A;  1HCI A;  4AIS A;  3I0Q A;  3ONJ A;  5F3J A;  4IE5 A;  4MFR A;  5F5W A;  1YKH B;  3L3P A;  4GKJ T;  5LG3 A;  4ZRU A;  4GKK T;  4AQG A;  3ZYL A;  2FJD A;  5AQN B;  3Q9D A;  4MLK A;  2EHO B;  2D0T A;  2MPK A;  4PJN A;  4O4L E;  4K0K T;  4YTM A;  2W00 A;  2UXB T;  5HYA A;  5AFH A;  3UU6 A;  5FY1 A;  2NR4 A;  3PUV F;  3FZF B;  4ISS A;  5AFM B;  1LRZ A;  4JI6 T; 
#chains in the Genus database with same CATH homology
 3ZDH A;  4Z90 A;  4XHE A;  4QAC A;  4NPP A;  1UV6 A;  2BR8 A;  2XQ8 A;  4IL4 A;  5J0Z A;  2W8F A;  2WNC A;  2XYS A;  5AFK A;  4QAB A;  4LMJ A;  5BRX A;  2PH9 A;  3C79 A;  4WV9 A;  3UUB A;  4ZJS A;  3EAM A;  4ZR6 A;  4DBM A;  2XQA A;  2UZ6 A;  3TLV A;  5CO5 A;  3P4W A;  4UM3 A;  3RQW A;  4AFG A;  3WTO A;  1OED B;  3EHZ A;  3RI5 A;  4X5T A;  3SQ9 A;  2LKH A;  3TLU A;  2MAW A;  2W8G A;  4LMK A;  2QC1 B;  4NZB A;  3IGQ A;  2BYR A;  4QH5 A;  2WNL A;  4UM1 A;  5KZU A;  4F8H A;  1UX2 A;  4UY2 A;  3ZKR A;  2YOE A;  5J5G A;  3SQ6 A;  2ZJU A;  4TNW A;  2XQ6 A;  2BYQ A;  4COF A;  4AFH A;  2XYT A;  4QAA A;  4ILA A;  2ZJV A;  3UQ4 A;  4AFT A;  2KSR A;  5AFL A;  5HCM A;  3JAE A;  2PGZ A;  4B5D A;  4ILB A;  2XQ5 A;  2LLY A;  4UM3 P;  4UXU A;  3U8N A;  5HEG A;  3WTI A;  4ALX A;  3EI0 A;  2VL0 A;  3GUA A;  3UU8 A;  2BG9 C;  3WTK A;  4D01 A;  1OED A;  5HEJ A;  5L4H A;  3T4M A;  4UM3 S;  5L47 A;  4TWH A;  4BFQ A;  2BYN A;  4HFC A;  2LKG A;  2XZ6 A;  3U8L A;  2XZ5 A;  5HEH A;  4ZK4 A;  5BW2 A;  4BQT A;  4HFD A;  3ZDG A;  2XNT A;  3TLS A;  2XNV A;  4HFH A;  5IUX A;  5J5I A;  3PMZ A;  3JAF A;  5HEU A;  2YMD A;  5AFM A;  4A98 A;  3UU4 A;  2YKS A;  5J5F A;  3RIF A;  2YN6 A;  2YME A;  4EZ1 A;  2M6B A;  2Y54 A;  3SIO A;  3WTJ A;  3WTL A;  2Y56 A;  3U8J A;  4TNV A;  2Y7Y A;  5J5H A;  5JME A;  4LML A;  3UU3 A;  5L4E A;  5AIN A;  5LG3 A;  2BJ0 A;  2WZY A;  4ZRU A;  5SYO A;  1UW6 A;  1OED C;  2BG9 B;  3LSV A;  2XQ4 A;  2WNJ A;  3PEO A;  5LXB A;  4IRE A;  2BR7 A;  5TVC A;  2BYS A;  2Y58 A;  2X00 A;  4XK9 A;  4ZJT A;  2M6I A;  2XNU A;  3WTM A;  2BYP A;  3U8M A;  4HFE A;  3TLT A;  5HEO A;  4ZZB A;  4HQP A;  3RIA A;  1OED E;  4A97 A;  3U8K A;  5FJV A;  5AFH A;  5HCJ A;  4PIR A;  3UQ7 A;  3WIP A;  2XQ9 A;  3UU6 A;  2WN9 A;  2Y57 A;  2BG9 E;  2BG9 A;  3P50 A;  3JAD A;  5CFB A;  4Z91 A;  2C9T A;  2XQ7 A;  4TWF A;  4ZZC A;  3RHW A;  4IL9 A;  4FRR A;  3C84 A;  2XQ3 A;  4QH4 A;  5BP0 A;  3WTN A;  5KE4 A;  3UU5 A;  4ZK1 A;  3WTH A;  4ILC A;  3SH1 A;  5AFN A;  4HFI A;  3TLW A;  3RQU A;  1I9B A;  4TWD A;  2LM2 A;  4HFB A;  4QH1 A;  5AFM B;  2X00 D;  5AFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...