4HFCA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to 2-bromo-ethanol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfcA01
3P4WA 3TLWA 4AFTA 2LKGA 4ZR6A 4F8HA 3ZDHA 4LMJA 2YKSA 3ZKRA 4LMLA 2PGZA 4X5TA 2UZ6A 3EHZA 2BG9C 3JADA 2BYPA 2BYQA 2M6BA 2XQ5A 4ILAA 3WTIA 5AFMA 2XQ7A 2BYNA 4QACA 3C84A 3U8MA 4ZK1A 4A97A 5JMEA 4UXUA 2XZ5A 3WTNA 1OEDA 5HEUA 5AFNA 1UV6A 4TNVA 2LKHA 2M6IA 4QH1A 4A98A 2BYSA 4XK9A 3JAFA 4UY2A 2BG9B 3RQWA 4ZRUA 3RQUA 4IL9A 4FRRA 2KSRA 4XHEA 4ZJSA 2WNLA 5HCMA 3UQ4A 2X00D 2XNUA 4PIRA 2BR8A 4ZK4A 2YMEA 3SH1A 4Z90A 3T4MA 4B5DA 4LMKA 2XQ9A 4QH5A 2XNTA 2WNCA 3GUAA 4TWHA 2PH9A 5CO5A 2WNJA 2Y58A 4QABA 5AFKA 4TWFA 1UW6A 2BG9A 3WTLA 1OEDE 5HEJA 4HFCA 4ZZCA 3ZDGA 2XYTA 3IGQA 2YN6A 2BJ0A 3PEOA 4BQTA 5KZUA 4NPPA 1I9BA 3WTHA 5KE4A 2BG9E 3WIPA 2BR7A 3SQ9A 5J5GA 3U8KA 2YMDA 2ZJUA 4HFHA 5HEOA 3RI5A 3TLVA 2C9TA 3C79A 5L4HA 4NZBA 5AFJA 4ZJTA 4TWDA 2XQ4A 3UU3A 3UU8A 2W8GA 4EZ1A 5AFMB 2VL0A 4UM3P 4UM3A 4HFEA 5HEHA 3UU4A 5FJVA 3UQ7A 5BRXA 3U8NA 5J0ZA 3SIOA 2XQ6A 4UM1A 4ZZBA 5J5HA 5L47A 4AFGA 2WN9A 2X00A 5LXBA 3WTJA 3JAEA 4QAAA 2Y54A 2Y7YA 4DBMA 3TLTA 4HFIA 4IREA 2ZJVA 4UM3S 3RHWA 5J5IA 2XNVA 3WTOA 3EAMA 4HFDA 3UU6A 5HCJA 5BW2A 2XQ8A 5TVCA 1OEDC 5HEGA 3RIFA 5LG3A 2W8FA 3U8JA 5AINA 5J5FA 4AFHA 3TLSA 4WV9A 3WTKA 4TNWA 4HFBA 4HQPA 5SYOA 1UX2A 2MAWA 2Y56A 4BFQA 2XQAA 3WTMA 1OEDB 4ILCA 5IUXA 3SQ6A 2QC1B 3LSVA 5BP0A 3P50A 2XYSA 4Z91A 4ALXA 4ILBA 2WZYA 3PMZA 5AFLA 4D01A 5AFHA 3U8LA 2XQ3A 4QH4A 3TLUA 3UU5A 2BYRA 4COFA 2LLYA 3UUBA 2XZ6A 2YOEA 2LM2A 3EI0A 3RIAA 5L4EA 5CFBA 2Y57A 4IL4A
chains in the Genus database with same CATH superfamily
2A2FX 2XASB 1ZP0A 2EHOB 5BMVE 4EIWA 4ERRA 2PGZA 2WU2A 4IIJE 2C5IT 1MNEA 4I43B 5FXXA 3BQLA 5ABEA 5AQJB 2EHOC 5JR9C 4DR4T 2F4VT 2ACXA 2DL1A 4DV1T 4P0AA 3CQGB 2JIWA 5C3JA 3RX6A 5AQHB 1Y64B 4ZK4A 4HEAA 4WBOA 3T4MA 4B5DA 2XQ9A 3KVAA 3K8PC 4O4IE 2Y58A 5AFKA 4IE6A 5HXCA 2BG9A 3SFEA 1W0BA 2YN6A 3CVRA 1IJ5A 3WIPA 4PFPA 2BR7A 3LDQB 5KX5E 5HEOA 3P4QA 3OPCA 4WZXA 2BVMA 1QLBA 4DV0T 3UU8A 4HFEA 1HX8A 4OX9T 5CGMA 4DIDB 3MA9A 4B3RT 4H9NC 3RIUA 3PJAA 4HFIA 4TN7B 4H9RC 5JQGE 4YJ3E 5HEGA 5AINA 4EB6E 4F6RC 2JQKA 3Q5EA 1YW0A 1J5ET 3ZEFB 2NTXA 1D0XA 4IDNA 4YTPA 2XQ3A 5FY0A 4COFA 2LSGA 5LGNB 3AB3B 4IE7A 3RF1A 4ZR6A 4ILUA 1WLXA 5LMUT 4QXHB 5TAOA 3X1DA 2UZ6A 3EHZA 3PUXF 5GONE 2FJAA 5LXTE 1VOMA 4ZXLA 4X62T 2IIUA 3QB5A 2W62A 2XAQB 3E08A 2W61A 4A98A 5HWYA 2KINB 1T8BA 2HPJA 1MMAA 3LK42 4FRRA 4U2YA 2YMEA 4QH5A 3CQCB 5JDHA 5CO5A 3AAIA 3WTLA 5HEJA 4YLHA 1MNDA 2BJ0A 1UCUA 4ZOLE 3WI3A 4AKGA 2LRLA 2ZM6T 2VVSA 2IC6A 3QNUA 3UQ7A 5JVDE 3BQIA 4LF8T 4AQYT 2WN9A 4DBMA 3RRWA 4TV9E 2R6GF 4WNKA 1VCSA 5JDGA 1UK5A 4JI2T 1HF8A 3ZJ2A 4ZEYA 3HKEE 2X51A 2ZM2A 4ISTA 5HWXA 4IHJE 3ONJA 2KLQA 1LKXA 4NXNT 5H6RB 3C4ZA 4HWDA 4H9SE 3FXEB 2Y57A 3IEEA 1JNRA 1E1HB 2BYQA 2V26A 2XQ5A 1X79A 1YQ4A 4DV3T 5FP3A 1H7CA 3FBZA 4ZI2C 3AE1A 2D5UA 2V7IA 2V5DA 4TV8E 5JDFA 3QUJA 2LSYA 2X00D 3P4PA 1IJ6A 3SH1A 2Y48B 2V7MA 3CX8B 3ANWA 4DMVA 3LBXB 2FJEA 2BDEA 3AXJB 4ZS3A 1Z8UA 2NWBA 3C79A 1Y01A 3SFDA 4N78D 1JNZA 2W63A 5BR8T 2CMRA 5L47A 3AA7B 4HWIB 4JEHB 4UM3S 3MXZA 2QGSA 2OA5A 4HN9A 2W0GA 2WBLA 3ONXA 4U7IA 2LOPA 3MK7C 4CN6A 2BKPA 2C5JA 4DR1T 5AFHA 5AQOB 4O4LE 4U72A 3ABVA 3ZMUB 4YSZA 5FMNA 1MIVA 2DWKA 1V9DA 2X9HA 3TLWA 5L3CB 4GYSA 4WYVA 4C90A 5IWAT 5H6QB 3CX7B 2D0UA 3ONLC 2CM0A 2WCAA 4H63V 3RH3A 4O4JE 5AQGB 3KBUA 4U33A 3U8MA 1OXZA 4U3CA 5ETWA 2PFVA 3OVUA 3RLFF 5L2LA 4GK0E 2HPLA 1J1JA 2ACZA 4AQGA 1D0ZA 2W4XA 2HH7A 2CE7A 4EEDA 2E9XD 2XZEA 3A7MA 2NW9A 2YK0A 1UW6A 4X1YE 1OEDE 2OLTA 5EZYE 4EYUA 2H7VC 2VB6A 4BQTA 3I0OA 2WDVA 2CCQA 3JC6D 2YMDA 3GWHA 2WAUA 4AKIA 2C9TA 3FZHB 4I0UA 5AQVB 2XJ7A 5IHYA 3A8YC 2VKJA 3AE2A 4U31A 2E5VA 5LOVE 4LF7T 3OTOT 2ODVA 2WB5A 5EK4A 2FUPA 5HCJA 3AVSA 1VRBA 4YHJA 3KDSE 3WTKA 3AE5A 3IBPA 3C98B 2MTQA 4HQPA 2A72A 3AEBA 2QC1B 3ZC0A 3ZCIA 4D01A 4EGWA 4OK0A 4LF6T 2BYRA 2LLYA 4JI8T 4UV9B 2LM2A 3MJXA 4IL4A 2V6YA 4AFTA 1R8IA 2K48A 2C0SA 4EZ4A 2NOXA 4BAYB 3ZT5A 2Y6XA 3W15B 2X9XA 3VKGA 1MMDA 3ZT6A 2XM1A 3OBVE 5JMEA 3ZYLA 3AXJA 3ZSTA 3WTNA 3AA6B 1OEDA 4TNVA 2M6IA 4CI1B 2WSSV 2LT3A 3RRCA 4EV6A 2XAFB 5E0OA 3ZT7A 1IBMT 3ZPOA 1BR1A 2VWAA 4BJMA 5AQLB 3RYFE 3AE8A 3LJCA 4QABA 4J2CA 5L3GB 3LFMA 3EDUA 3K3QC 5FKYA 2W67A 4OFZA 1D0YA 5AFUL 3LK3B 3RI5A 2XPKA 5A1LA 2X9YA 3VU7H 4LF4T 2BBJA 2ZM0A 3FZLB 3U78A 2ZJVA 2NTYA 3SWHA 1ZEEA 3R84B 3WTOA 3FXDB 5JDMA 3UTKA 3U8JA 5LG3A 4PK6A 2MBGA 2RP4A 2XY8B 4G2AA 2MYSA 5DQVA 4B3TT 4CZZB 2CHNA 4P1NA 1BR4A 4LF9T 2J62A 4B3MT 4DUYT 1N32T 2UXNB 1FMWA 3EI0A 4YJ2E 4JYAT 5HXEA 2BS2A 5L3EB 4KHZF 4YHHT 1W0AA 2NW8A 4LMJA 5AQPB 5LJNA 3C50A 4JI4T 2W2UA 4GOUA 3I9WA 2BYPA 1SE7A 1M62A 2QRXA 1UURA 5AFMA 2NW7A 2XAGB 2D9DA 2Q9QC 4ADZA 4YXDA 4ZRUA 5C8YE 3RQUA 2E8IA 3KINB 2YU2A 3AAEB 5LJMA 4BA9A 2BS4A 2YDQA 3Q5DA 3HKCE 5AQIB 2UUCT 2ES0A 2XNTA 1IZNB 1KNZA 5LBMA 4HKAA 2ODUA 4QWNB 2WDRA 4NZBA 4MLKA 1QSDA 2XQ4A 4L5GA 4YFSA 4X65T 5AFMB 2WZHA 3HL6A 1HX1B 4NUVA 5LHHB 2M67A 5LGTB 4KHPT 4EAHA 1D1CA 5LB7B 3UU6A 1HCIA 1BR2A 2B1EA 5TVCA 3N2GE 2JMKA 3TLSA 4WW0A 1OEDB 2JQQA 2VKHA 4ZI7E 2D2SA 3LSVA 5BP0A 4ALXA 4UF0B 1DU2A 2WZYA 3PMZA 3PU3A 3AE9A 4DBQA 2H88A 4UEMA 4PJMA 3PURA 3IA3A 1ZKEA 3P4WA 1QUUA 2C5KT 2JPFA 4FJOA 3RC3A 5JRCA 3P7IA 4UXUA 2KZ7B 4DBRA 3CWZB 3CK6A 2Q9QB 2BG9B 3EDVA 5LYJE 2AXDS 3WAKA 4CI2B 3PTRB 5LG4A 2BR8A 2XUEA 4HFVA 1XMOT 4ZI2D 1S35A 1KK7A 2L3LA 2DI4A 3PE0A 2UUAT 2VASA 3NZPA 4JI1T 4TX5A 3TLVA 1FIOA 3O4XE 1O3XA 3ZCJA 3K1SA 1S94A 1KNPA 5HEHA 3O1JA 5LNKA 2ZMAA 2KT9A 4ANJA 5J1GA 4UV8B 3AE4A 2X00A 5HAXA 3EAMA 3ZN0B 2UXCT 5KMGP 1OEDC 2PJQA 4ZI3C 4IDPA 5LMNT 1WRDA 4PK5A 1I94T 3NZQA 3VR8A 3GMIA 3SS1A 4M1PA 1SA0E 1W09A 3ETUA 2XAHB 2XZ6A 3PUGA 5ADXL 4EOZB 2RPAA 3CPZA 1US7B 5LA6E 4L0RA 2NR4A 3PUSA 3NVOA 3E0ZA 1FMVA 2XZ5A 2KWHA 3OYXA 4PK4A 5L3DB 2H7OA 2Q9QD 2LKHA 3AE3A 4XK9A 3JAFA 3I9YA 1D1AA 1KF6A 4U7YA 2A3DA 2UXBT 1YD8G 2L9QA 4GKKT 2WNCA 5FXVA 4TWHA 5LHIB 3EVYA 5CA0E 4TWFA 3K3NA 4HFCA 1WYBA 1W9RA 3PEOA 5CJ5A 4DV7T 4AQFC 3UU3A 4A56A 4ISSA 2WY2A 3OJAA 5AQQB 4IREA 5HXHA 3RHWA 5EK2A 2I0MA 2XNVA 2WS3A 2CWYA 4C91A 2LEHA 5FNVE 3VKHA 2XAJB 2Q9QA 4DR2T 2CBIA 3L09A 5JDNA 1ZOYA 2AE9A 2YEVC 5IYZE 4YY3T 1ZV4X 3BK9A 3QOFA 4NIQA 2YOEA 3RIAA 4BJNA 3NRYA 3C64A 3F2EA 3OYZA 2BG9C 3T8OA 4QACA 4K0UA 5FY7A 1GQEA 2YU1A 1WFDA 3UULA 3GN5B 3GA8A 3KV4A 3FBLA 5LHGB 5FY1A 4IE5A 4AKLA 5JR9B 1XDPA 3LBXA 2B76A 5EK3A 4ZZCA 2JMHA 5KZUA 4NPPA 3ANWB 2A9UA 1KEYA 2Z6EA 5J5GA 4JI6T 1HG2A 5L4HA 5AFJA 2LSJA 4ZJTA 2BKOA 3RC8A 4UM3P 2WMNA 5BRXA 4JI3T 4I55E 2YINA 4DR6T 3SIOA 3VR9A 3AEDA 2VQET 2X66A 4U74A 4QX8B 4O2BE 2Y7YA 2V7LA 3ZC1A 3UUMA 4DV4T 1WR6A 3ZYKA 2X0HA 1T72A 1HNZT 3NWIA 5FL0A 4H9OC 2DNXA 4PW8A 1XNRT 2V1DB 4BFQA 3CX6B 3LK2B 3M65A 2WM9A 4MFRA 4B6XA 3P4SA 4HE8A 3C4WA 3ESLA 2FJDA 4OHFA 2X0LB 3TKLB 3I1AA 5ABHA 4O4HE 3B57A 4QX7B 1UX4A 3AA1B 4AKRB 3AECA 4CN1A 1UGOA 3CKDA 2M6BA 2KWIB 3SRZA 3C84A 2XHEB 5LP6E 4Z8XA 3H3MA 3E22E 5AFNA 2IDOB 3RPUA 2BZBA 2LSKA 4XHEA 4LFBT 1CHUA 5HCMA 4ZS2A 4PJNA 4Z90A 3RKGA 3GUAA 3Q9DA 4IE4A 4LF5T 1G73A 3C51A 2BVLA 3ZLIA 3AVRA 5FYMA 3U8KA 2JQHA 3HA4A 4X20E 5C2TA 2H89A 4LFCT 5FJVA 2EHOD 3FZKB 3L3PA 1WYCA 3ZMZB 4YTNA 1KFYA 4OYKA 1OWAA 2VKDA 4PFOA 5LGUB 4H63H 1XZYA 4HFDA 4O8SA 3RYIE 4B3ST 5BW2A 3RIFA 4AFHA 4ZI3D 4XAXB 1B7TA 4WBNE 4HWCA 2LHRA 1UX2A 4A5XA 1MMGA 2XYSA 4H9PC 3J9X1 2CRBA 2SPCA 5FVLA 4PAGA 2K3WA 4ASKA 1HR0T 4X66T 4KMCA 4X5TA 3ZN1B 4ILAA 4JBWF 3G06A 2QVAA 4QXCB 1YQ3A 2X67A 5ABFA 1U4QA 1NWMX 4CXYA 4IE0A 1LRZA 5JR9A 3RIUC 3N2KE 2BKNA 2XTLA 1LVFA 2QA7A 4I50E 4JI5T 2WNJA 2CXDA 2K9AA 3PDYA 3KBTA 3WTHA 4KI0F 2E9XB 4HFHA 3N9PA 4ZHQE 2LE8A 3UFGA 4TZ4C 4TWDA 1LVKA 4EZ1A 4YSYA 4PJLA 5J2TE 1SHZC 2WWUA 3N9NA 3O9XA 4XBFB 4DMWA 2XQ6A 4ZZBA 5LXBA 2VVNA 4AIUA 3WTJA 3C4XA 4GIWA 1UX5A 5JREA 3PJAJ 2EHOA 5ABGA 3UFEA 3KFWX 4HFBA 4V1Av 5SYOA 2DLRA 2P9BA 4TUYE 4UELA 2XQAA 2DCFA 4ILCA 3MACA 5IUXA 3T1HT 2RA1A 3ZJ1A 3P4RA 1HG5A 2G0UA 3FZMB 1HS7A 5CFBA 2XQYA 3FZFB 2K24A 2LKGA 5DQWA 3AE7A 3N9OA 1G8XA 1HFAA 3A5XA 3F57A 4JI0T 3L39A 3UT5E 2WZIA 3ZMSB 2N9DA 1XMQT 5JDQA 3ZYMA 1XDOA 4UY2A 2V7KA 4KP3C 5JTGA 2E2AA 1D1BA 3UUNA 3RYCE 4UR9A 3NBXX 4FI5A 5JH7E 4XZCA 2VKOA 5CA1E 3PUZF 4X1IE 3CIRA 3ZDGA 1ZHCA 3KV5A 4QHOA 2YDSA 2PG8A 4AKHA 1FJGT 5HYAA 2VL0A 2LJLA 3PV0F 2E9XC 3D0TA 5J5HA 2VURA 5F5WA 4QAAA 3PUYF 5AQSB 5L3BB 5J5IA 2W00A 5KXJA 2CLYB 1CUNA 3N9MA 3H3AA 1NAFA 5J5FA 2W8FA 3F31A 4TNWA 1HTJF 3IF8B 2GK9A 4X64T 4EZHA 2MAWA 2ZM8A 3AA0B 2KMFA 2LOSA 2J4GA 2IW5B 5LBQB 1N34T 3UU5A 2HN2A 1YKHB 3AEFA 2N2NA 3L8RA 4GYRA 4KUMB 5HXSA 4KBMB 3AEAA 3JADA 3RGLA 3DP7A 4A97A 2VK9A 2N1GA 1L0VA 3K3OA 2BYSA 2CA5A 2LM9A 4CN4A 3ZMTB 3RQWA 4IL9A 2KSRA 3AEEA 3HR0A 3PUVF 3UQ4A 4PIRA 4MALA 5AQRB 1J5WA 3I0QA 5HXRA 3IGQA 4JUYA 5KE4A 2I59A 5FXZA 2ZJUA 5J2UE 3AAAB 1MIYA 3PU8A 2PTFA 3ETVA 2Y8DA 3HI2A 3PUQA 3KV9A 4IDZA 3JAEA 4AXPA 4DV2T 1E2AA 4GKJT 5JRCB 3UUXB 2J1DG 5AQFB 2LRKA 1NEKA 4QKNA 2IHR1 3O1HA 4U2ZA 1U5PA 5KDMC 1FEWA 3SQ6A 2CBJA 4UF0A 1N33T 2E9XA 5FXWA 2WP9A 1KNRA 4PJJA 2MOZA 3UUBA 4AQFA 5AQNB 2YKSA 3ZKRA 1IBLT 2DHRA 3WTIA 1XNQT 4YTMA 2X9WA 5HEUA 2LHNA 1UV6A 3B13A 3EABA 2BS3A 3O1IA 4DUZT 1M7KA 4ZJSA 2V7JA 5DJQC 2XM2A 2IUBA 2I6HA 2WWVA 4CQIA 5FL1A 4CI3B 4CXXA 2LSIA 4AISA 2PH9A 4UXNB 3DJBA 5F3JA 1BR0A 1X9BA 2BG9E 3SQ9A 2L8KA 1Z0PA 4DVDA 2CEAA 5FVKA 3QK6A 2CLYC 4UM3A 5J0ZA 3U3IA 1AJ3A 4DO0A 1VCTA 4AFGA 2V5CA 2W66A 2OV9A 4NUUA 4YT0A 4JV5T 4HGAA 4EXTA 3N5LA 3N9QA 4MBQA 1E7PA 4HWFA 2BBHA 2Y56A 2QYWA 3ZSSA 2MPKA 2ZLYA 3JC6C 4Z91A 1IBKT 3U8LA 1MMNA 4IDQA 4QXBB 2VQFT 3ZMVB 1HNWT 3KV6A 5AQMB 2WQYA 2IC9A 3N2OA 1IAPA 2UUBT 2IAKA 4EEBA 4DR3T 4LMLA 3HKBE 4O2AE 5F8PA 2XQ7A 2WDQA 3IHRA 2BYNA 2WMOA 1SUMB 2HHHT 3EUHA 3CMLA 2KXPB 4QH1A 2UU9T 3RKOA 2WNLA 2PBIA 2CXLA 3JCFA 4IT4A 3Q5XA 4YSXA 4LMKA 4EYYR 2D0TA 2V8SV 1T98A 3GN5A 2XYTA 1I9BA 5L3FB 2CHOA 4I4TE 1HNXT 4HWHA 4OYJA 3P8CD 1UUSA 2V6XA 4JEUB 3KVBA 3UU4A 3U8NA 3QC9A 4AI6A 4JLEA 4H9QC 3SOLA 4DR7T 1T7SA 3VRAA 5LCYA 2Y54A 3TLTA 1XWMA 2JJ9A 4P0BA 4GK5E 1N36T 2XQ8A 3M3ZB 4JI7T 2KNDA 1EZ3A 3S4UA 4DR5T 2JRKA 2V6YB 4UVAB 4CXWA 4WV9A 1MIWA 2NP9A 3VHLA 1YKEB 2UXXB 4UVCB 2DWGA 2K5BB 3P50A 3PUAA 4ILBA 5AFLA 2VL8A 4G63A 4UVBB 3LG7A 4QH4A 3TLUA 3BQKA 3MKDA 5AQUB 3AE6A 4F8HA 3ZDHA 4KX6A 3V5UA 2XSAA 5AQTB 3RYHE 2YDRA 4ZK1A 4MHCA 2IMLA 2FJBA 3WAJA 1YXRA 3DTOA 3FB2A 4K0KT 5AQKB 2E5LT 2XNUA 4DNDA 2CWOA 4E7SA 3H37A 3R6NA 3AEGA 3NRXA 3N9LA 4NXMT 1NENA 3FHNA 5DABA 2X0YA 2FBWA 4IGUA 2J47A 2JQ9A 2CPTA 2H3RA 4E7ZA 4Q25A 3B5MA 2W8GA 4IDOA 4L9IA 2UXDT 3Q5WA 4P09A 3NKZA 2HN1A 4UM1A 5M4YA 3MZKB 4HTEA 3J7Yq 3PUWF 2XSBA 4X1KE 3HKDE 4LFAT 2CXFA 2WU5A 5JDLA 1I6ZA 4DV6T 3CQXC 5CB4E 3OKQA 5ABFB 3WTMA 3T1YT 3Q2MA 1WR0A 2X68A 1WCRA 4DV5T 4PNIA 3QB5K 4UIGA 5L4EA 3V5SA 3VRBA
chains in the Genus database with same CATH topology
3P4WA 3TLWA 4AFTA 2LKGA 4ZR6A 4F8HA 3ZDHA 4LMJA 2YKSA 3ZKRA 4LMLA 2PGZA 4X5TA 2UZ6A 3EHZA 2BG9C 3JADA 2BYPA 2BYQA 2M6BA 2XQ5A 4ILAA 3WTIA 5AFMA 2XQ7A 2BYNA 4QACA 3C84A 3U8MA 4ZK1A 4A97A 5JMEA 4UXUA 2XZ5A 3WTNA 1OEDA 5HEUA 5AFNA 1UV6A 4TNVA 2LKHA 2M6IA 4QH1A 4A98A 2BYSA 4XK9A 3JAFA 4UY2A 2BG9B 3RQWA 4ZRUA 3RQUA 4IL9A 4FRRA 2KSRA 4XHEA 4ZJSA 2WNLA 5HCMA 3UQ4A 2X00D 2XNUA 4PIRA 2BR8A 4ZK4A 2YMEA 3SH1A 4Z90A 3T4MA 4B5DA 4LMKA 2XQ9A 4QH5A 2XNTA 2WNCA 3GUAA 4TWHA 2PH9A 5CO5A 2WNJA 2Y58A 4QABA 5AFKA 4TWFA 1UW6A 2BG9A 3WTLA 1OEDE 5HEJA 4HFCA 4ZZCA 3ZDGA 2XYTA 3IGQA 2YN6A 2BJ0A 3PEOA 4BQTA 5KZUA 4NPPA 1I9BA 3WTHA 5KE4A 2BG9E 3WIPA 2BR7A 3SQ9A 5J5GA 3U8KA 2YMDA 2ZJUA 4HFHA 5HEOA 3RI5A 3TLVA 2C9TA 3C79A 5L4HA 4NZBA 5AFJA 4ZJTA 4TWDA 2XQ4A 3UU3A 3UU8A 2W8GA 4EZ1A 5AFMB 2VL0A 4UM3P 4UM3A 4HFEA 5HEHA 3UU4A 5FJVA 3UQ7A 5BRXA 3U8NA 5J0ZA 3SIOA 2XQ6A 4UM1A 4ZZBA 5J5HA 5L47A 4AFGA 2WN9A 2X00A 5LXBA 3WTJA 3JAEA 4QAAA 2Y54A 2Y7YA 4DBMA 3TLTA 4HFIA 4IREA 2ZJVA 4UM3S 3RHWA 5J5IA 2XNVA 3WTOA 3EAMA 4HFDA 3UU6A 5HCJA 5BW2A 2XQ8A 5TVCA 1OEDC 5HEGA 3RIFA 5LG3A 2W8FA 3U8JA 5AINA 5J5FA 4AFHA 3TLSA 4WV9A 3WTKA 4TNWA 4HFBA 4HQPA 5SYOA 1UX2A 2MAWA 2Y56A 4BFQA 2XQAA 3WTMA 1OEDB 4ILCA 5IUXA 3SQ6A 2QC1B 3LSVA 5BP0A 3P50A 2XYSA 4Z91A 4ALXA 4ILBA 2WZYA 3PMZA 5AFLA 4D01A 5AFHA 3U8LA 2XQ3A 4QH4A 3TLUA 3UU5A 2BYRA 4COFA 2LLYA 3UUBA 2XZ6A 2YOEA 2LM2A 3EI0A 3RIAA 5L4EA 5CFBA 2Y57A 4IL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4W A;  3TLW A;  4AFT A;  2LKG A;  4ZR6 A;  4F8H A;  3ZDH A;  4LMJ A;  2YKS A;  3ZKR A;  4LML A;  2PGZ A;  4X5T A;  2UZ6 A;  3EHZ A;  2BG9 C;  3JAD A;  2BYP A;  2BYQ A;  2M6B A;  2XQ5 A;  4ILA A;  3WTI A;  5AFM A;  2XQ7 A;  2BYN A;  4QAC A;  3C84 A;  3U8M A;  4ZK1 A;  4A97 A;  5JME A;  4UXU A;  2XZ5 A;  3WTN A;  1OED A;  5HEU A;  5AFN A;  1UV6 A;  4TNV A;  2LKH A;  2M6I A;  4QH1 A;  4A98 A;  2BYS A;  4XK9 A;  3JAF A;  4UY2 A;  2BG9 B;  3RQW A;  4ZRU A;  3RQU A;  4IL9 A;  4FRR A;  2KSR A;  4XHE A;  4ZJS A;  2WNL A;  5HCM A;  3UQ4 A;  2X00 D;  2XNU A;  4PIR A;  2BR8 A;  4ZK4 A;  2YME A;  3SH1 A;  4Z90 A;  3T4M A;  4B5D A;  4LMK A;  2XQ9 A;  4QH5 A;  2XNT A;  2WNC A;  3GUA A;  4TWH A;  2PH9 A;  5CO5 A;  2WNJ A;  2Y58 A;  4QAB A;  5AFK A;  4TWF A;  1UW6 A;  2BG9 A;  3WTL A;  1OED E;  5HEJ A;  4HFC A;  4ZZC A;  3ZDG A;  2XYT A;  3IGQ A;  2YN6 A;  2BJ0 A;  3PEO A;  4BQT A;  5KZU A;  4NPP A;  1I9B A;  3WTH A;  5KE4 A;  2BG9 E;  3WIP A;  2BR7 A;  3SQ9 A;  5J5G A;  3U8K A;  2YMD A;  2ZJU A;  4HFH A;  5HEO A;  3RI5 A;  3TLV A;  2C9T A;  3C79 A;  5L4H A;  4NZB A;  5AFJ A;  4ZJT A;  4TWD A;  2XQ4 A;  3UU3 A;  3UU8 A;  2W8G A;  4EZ1 A;  5AFM B;  2VL0 A;  4UM3 P;  4UM3 A;  4HFE A;  5HEH A;  3UU4 A;  5FJV A;  3UQ7 A;  5BRX A;  3U8N A;  5J0Z A;  3SIO A;  2XQ6 A;  4UM1 A;  4ZZB A;  5J5H A;  5L47 A;  4AFG A;  2WN9 A;  2X00 A;  5LXB A;  3WTJ A;  3JAE A;  4QAA A;  2Y54 A;  2Y7Y A;  4DBM A;  3TLT A;  4HFI A;  4IRE A;  2ZJV A;  4UM3 S;  3RHW A;  5J5I A;  2XNV A;  3WTO A;  3EAM A;  4HFD A;  3UU6 A;  5HCJ A;  5BW2 A;  2XQ8 A;  5TVC A;  1OED C;  5HEG A;  3RIF A;  5LG3 A;  2W8F A;  3U8J A;  5AIN A;  5J5F A;  4AFH A;  3TLS A;  4WV9 A;  3WTK A;  4TNW A;  4HFB A;  4HQP A;  5SYO A;  1UX2 A;  2MAW A;  2Y56 A;  4BFQ A;  2XQA A;  3WTM A;  1OED B;  4ILC A;  5IUX A;  3SQ6 A;  2QC1 B;  3LSV A;  5BP0 A;  3P50 A;  2XYS A;  4Z91 A;  4ALX A;  4ILB A;  2WZY A;  3PMZ A;  5AFL A;  4D01 A;  5AFH A;  3U8L A;  2XQ3 A;  4QH4 A;  3TLU A;  3UU5 A;  2BYR A;  4COF A;  2LLY A;  3UUB A;  2XZ6 A;  2YOE A;  2LM2 A;  3EI0 A;  3RIA A;  5L4E A;  5CFB A;  2Y57 A;  4IL4 A; 
#chains in the Genus database with same CATH topology
 2A2F X;  2XAS B;  1ZP0 A;  2EHO B;  5BMV E;  4EIW A;  4ERR A;  2PGZ A;  2WU2 A;  4IIJ E;  2C5I T;  1MNE A;  4I43 B;  5FXX A;  3BQL A;  5ABE A;  5AQJ B;  2EHO C;  5JR9 C;  4DR4 T;  2F4V T;  2ACX A;  2DL1 A;  4DV1 T;  4P0A A;  3CQG B;  2JIW A;  5C3J A;  3RX6 A;  5AQH B;  1Y64 B;  4ZK4 A;  4HEA A;  4WBO A;  3T4M A;  4B5D A;  2XQ9 A;  3KVA A;  3K8P C;  4O4I E;  2Y58 A;  5AFK A;  4IE6 A;  5HXC A;  2BG9 A;  3SFE A;  1W0B A;  2YN6 A;  3CVR A;  1IJ5 A;  3WIP A;  4PFP A;  2BR7 A;  3LDQ B;  5KX5 E;  5HEO A;  3P4Q A;  3OPC A;  4WZX A;  2BVM A;  1QLB A;  4DV0 T;  3UU8 A;  4HFE A;  1HX8 A;  4OX9 T;  5CGM A;  4DID B;  3MA9 A;  4B3R T;  4H9N C;  3RIU A;  3PJA A;  4HFI A;  4TN7 B;  4H9R C;  5JQG E;  4YJ3 E;  5HEG A;  5AIN A;  4EB6 E;  4F6R C;  2JQK A;  3Q5E A;  1YW0 A;  1J5E T;  3ZEF B;  2NTX A;  1D0X A;  4IDN A;  4YTP A;  2XQ3 A;  5FY0 A;  4COF A;  2LSG A;  5LGN B;  3AB3 B;  4IE7 A;  3RF1 A;  4ZR6 A;  4ILU A;  1WLX A;  5LMU T;  4QXH B;  5TAO A;  3X1D A;  2UZ6 A;  3EHZ A;  3PUX F;  5GON E;  2FJA A;  5LXT E;  1VOM A;  4ZXL A;  4X62 T;  2IIU A;  3QB5 A;  2W62 A;  2XAQ B;  3E08 A;  2W61 A;  4A98 A;  5HWY A;  2KIN B;  1T8B A;  2HPJ A;  1MMA A;  3LK4 2;  4FRR A;  4U2Y A;  2YME A;  4QH5 A;  3CQC B;  5JDH A;  5CO5 A;  3AAI A;  3WTL A;  5HEJ A;  4YLH A;  1MND A;  2BJ0 A;  1UCU A;  4ZOL E;  3WI3 A;  4AKG A;  2LRL A;  2ZM6 T;  2VVS A;  2IC6 A;  3QNU A;  3UQ7 A;  5JVD E;  3BQI A;  4LF8 T;  4AQY T;  2WN9 A;  4DBM A;  3RRW A;  4TV9 E;  2R6G F;  4WNK A;  1VCS A;  5JDG A;  1UK5 A;  4JI2 T;  1HF8 A;  3ZJ2 A;  4ZEY A;  3HKE E;  2X51 A;  2ZM2 A;  4IST A;  5HWX A;  4IHJ E;  3ONJ A;  2KLQ A;  1LKX A;  4NXN T;  5H6R B;  3C4Z A;  4HWD A;  4H9S E;  3FXE B;  2Y57 A;  3IEE A;  1JNR A;  1E1H B;  2BYQ A;  2V26 A;  2XQ5 A;  1X79 A;  1YQ4 A;  4DV3 T;  5FP3 A;  1H7C A;  3FBZ A;  4ZI2 C;  3AE1 A;  2D5U A;  2V7I A;  2V5D A;  4TV8 E;  5JDF A;  3QUJ A;  2LSY A;  2X00 D;  3P4P A;  1IJ6 A;  3SH1 A;  2Y48 B;  2V7M A;  3CX8 B;  3ANW A;  4DMV A;  3LBX B;  2FJE A;  2BDE A;  3AXJ B;  4ZS3 A;  1Z8U A;  2NWB A;  3C79 A;  1Y01 A;  3SFD A;  4N78 D;  1JNZ A;  2W63 A;  5BR8 T;  2CMR A;  5L47 A;  3AA7 B;  4HWI B;  4JEH B;  4UM3 S;  3MXZ A;  2QGS A;  2OA5 A;  4HN9 A;  2W0G A;  2WBL A;  3ONX A;  4U7I A;  2LOP A;  3MK7 C;  4CN6 A;  2BKP A;  2C5J A;  4DR1 T;  5AFH A;  5AQO B;  4O4L E;  4U72 A;  3ABV A;  3ZMU B;  4YSZ A;  5FMN A;  1MIV A;  2DWK A;  1V9D A;  2X9H A;  3TLW A;  5L3C B;  4GYS A;  4WYV A;  4C90 A;  5IWA T;  5H6Q B;  3CX7 B;  2D0U A;  3ONL C;  2CM0 A;  2WCA A;  4H63 V;  3RH3 A;  4O4J E;  5AQG B;  3KBU A;  4U33 A;  3U8M A;  1OXZ A;  4U3C A;  5ETW A;  2PFV A;  3OVU A;  3RLF F;  5L2L A;  4GK0 E;  2HPL A;  1J1J A;  2ACZ A;  4AQG A;  1D0Z A;  2W4X A;  2HH7 A;  2CE7 A;  4EED A;  2E9X D;  2XZE A;  3A7M A;  2NW9 A;  2YK0 A;  1UW6 A;  4X1Y E;  1OED E;  2OLT A;  5EZY E;  4EYU A;  2H7V C;  2VB6 A;  4BQT A;  3I0O A;  2WDV A;  2CCQ A;  3JC6 D;  2YMD A;  3GWH A;  2WAU A;  4AKI A;  2C9T A;  3FZH B;  4I0U A;  5AQV B;  2XJ7 A;  5IHY A;  3A8Y C;  2VKJ A;  3AE2 A;  4U31 A;  2E5V A;  5LOV E;  4LF7 T;  3OTO T;  2ODV A;  2WB5 A;  5EK4 A;  2FUP A;  5HCJ A;  3AVS A;  1VRB A;  4YHJ A;  3KDS E;  3WTK A;  3AE5 A;  3IBP A;  3C98 B;  2MTQ A;  4HQP A;  2A72 A;  3AEB A;  2QC1 B;  3ZC0 A;  3ZCI A;  4D01 A;  4EGW A;  4OK0 A;  4LF6 T;  2BYR A;  2LLY A;  4JI8 T;  4UV9 B;  2LM2 A;  3MJX A;  4IL4 A;  2V6Y A;  4AFT A;  1R8I A;  2K48 A;  2C0S A;  4EZ4 A;  2NOX A;  4BAY B;  3ZT5 A;  2Y6X A;  3W15 B;  2X9X A;  3VKG A;  1MMD A;  3ZT6 A;  2XM1 A;  3OBV E;  5JME A;  3ZYL A;  3AXJ A;  3ZST A;  3WTN A;  3AA6 B;  1OED A;  4TNV A;  2M6I A;  4CI1 B;  2WSS V;  2LT3 A;  3RRC A;  4EV6 A;  2XAF B;  5E0O A;  3ZT7 A;  1IBM T;  3ZPO A;  1BR1 A;  2VWA A;  4BJM A;  5AQL B;  3RYF E;  3AE8 A;  3LJC A;  4QAB A;  4J2C A;  5L3G B;  3LFM A;  3EDU A;  3K3Q C;  5FKY A;  2W67 A;  4OFZ A;  1D0Y A;  5AFU L;  3LK3 B;  3RI5 A;  2XPK A;  5A1L A;  2X9Y A;  3VU7 H;  4LF4 T;  2BBJ A;  2ZM0 A;  3FZL B;  3U78 A;  2ZJV A;  2NTY A;  3SWH A;  1ZEE A;  3R84 B;  3WTO A;  3FXD B;  5JDM A;  3UTK A;  3U8J A;  5LG3 A;  4PK6 A;  2MBG A;  2RP4 A;  2XY8 B;  4G2A A;  2MYS A;  5DQV A;  4B3T T;  4CZZ B;  2CHN A;  4P1N A;  1BR4 A;  4LF9 T;  2J62 A;  4B3M T;  4DUY T;  1N32 T;  2UXN B;  1FMW A;  3EI0 A;  4YJ2 E;  4JYA T;  5HXE A;  2BS2 A;  5L3E B;  4KHZ F;  4YHH T;  1W0A A;  2NW8 A;  4LMJ A;  5AQP B;  5LJN A;  3C50 A;  4JI4 T;  2W2U A;  4GOU A;  3I9W A;  2BYP A;  1SE7 A;  1M62 A;  2QRX A;  1UUR A;  5AFM A;  2NW7 A;  2XAG B;  2D9D A;  2Q9Q C;  4ADZ A;  4YXD A;  4ZRU A;  5C8Y E;  3RQU A;  2E8I A;  3KIN B;  2YU2 A;  3AAE B;  5LJM A;  4BA9 A;  2BS4 A;  2YDQ A;  3Q5D A;  3HKC E;  5AQI B;  2UUC T;  2ES0 A;  2XNT A;  1IZN B;  1KNZ A;  5LBM A;  4HKA A;  2ODU A;  4QWN B;  2WDR A;  4NZB A;  4MLK A;  1QSD A;  2XQ4 A;  4L5G A;  4YFS A;  4X65 T;  5AFM B;  2WZH A;  3HL6 A;  1HX1 B;  4NUV A;  5LHH B;  2M67 A;  5LGT B;  4KHP T;  4EAH A;  1D1C A;  5LB7 B;  3UU6 A;  1HCI A;  1BR2 A;  2B1E A;  5TVC A;  3N2G E;  2JMK A;  3TLS A;  4WW0 A;  1OED B;  2JQQ A;  2VKH A;  4ZI7 E;  2D2S A;  3LSV A;  5BP0 A;  4ALX A;  4UF0 B;  1DU2 A;  2WZY A;  3PMZ A;  3PU3 A;  3AE9 A;  4DBQ A;  2H88 A;  4UEM A;  4PJM A;  3PUR A;  3IA3 A;  1ZKE A;  3P4W A;  1QUU A;  2C5K T;  2JPF A;  4FJO A;  3RC3 A;  5JRC A;  3P7I A;  4UXU A;  2KZ7 B;  4DBR A;  3CWZ B;  3CK6 A;  2Q9Q B;  2BG9 B;  3EDV A;  5LYJ E;  2AXD S;  3WAK A;  4CI2 B;  3PTR B;  5LG4 A;  2BR8 A;  2XUE A;  4HFV A;  1XMO T;  4ZI2 D;  1S35 A;  1KK7 A;  2L3L A;  2DI4 A;  3PE0 A;  2UUA T;  2VAS A;  3NZP A;  4JI1 T;  4TX5 A;  3TLV A;  1FIO A;  3O4X E;  1O3X A;  3ZCJ A;  3K1S A;  1S94 A;  1KNP A;  5HEH A;  3O1J A;  5LNK A;  2ZMA A;  2KT9 A;  4ANJ A;  5J1G A;  4UV8 B;  3AE4 A;  2X00 A;  5HAX A;  3EAM A;  3ZN0 B;  2UXC T;  5KMG P;  1OED C;  2PJQ A;  4ZI3 C;  4IDP A;  5LMN T;  1WRD A;  4PK5 A;  1I94 T;  3NZQ A;  3VR8 A;  3GMI A;  3SS1 A;  4M1P A;  1SA0 E;  1W09 A;  3ETU A;  2XAH B;  2XZ6 A;  3PUG A;  5ADX L;  4EOZ B;  2RPA A;  3CPZ A;  1US7 B;  5LA6 E;  4L0R A;  2NR4 A;  3PUS A;  3NVO A;  3E0Z A;  1FMV A;  2XZ5 A;  2KWH A;  3OYX A;  4PK4 A;  5L3D B;  2H7O A;  2Q9Q D;  2LKH A;  3AE3 A;  4XK9 A;  3JAF A;  3I9Y A;  1D1A A;  1KF6 A;  4U7Y A;  2A3D A;  2UXB T;  1YD8 G;  2L9Q A;  4GKK T;  2WNC A;  5FXV A;  4TWH A;  5LHI B;  3EVY A;  5CA0 E;  4TWF A;  3K3N A;  4HFC A;  1WYB A;  1W9R A;  3PEO A;  5CJ5 A;  4DV7 T;  4AQF C;  3UU3 A;  4A56 A;  4ISS A;  2WY2 A;  3OJA A;  5AQQ B;  4IRE A;  5HXH A;  3RHW A;  5EK2 A;  2I0M A;  2XNV A;  2WS3 A;  2CWY A;  4C91 A;  2LEH A;  5FNV E;  3VKH A;  2XAJ B;  2Q9Q A;  4DR2 T;  2CBI A;  3L09 A;  5JDN A;  1ZOY A;  2AE9 A;  2YEV C;  5IYZ E;  4YY3 T;  1ZV4 X;  3BK9 A;  3QOF A;  4NIQ A;  2YOE A;  3RIA A;  4BJN A;  3NRY A;  3C64 A;  3F2E A;  3OYZ A;  2BG9 C;  3T8O A;  4QAC A;  4K0U A;  5FY7 A;  1GQE A;  2YU1 A;  1WFD A;  3UUL A;  3GN5 B;  3GA8 A;  3KV4 A;  3FBL A;  5LHG B;  5FY1 A;  4IE5 A;  4AKL A;  5JR9 B;  1XDP A;  3LBX A;  2B76 A;  5EK3 A;  4ZZC A;  2JMH A;  5KZU A;  4NPP A;  3ANW B;  2A9U A;  1KEY A;  2Z6E A;  5J5G A;  4JI6 T;  1HG2 A;  5L4H A;  5AFJ A;  2LSJ A;  4ZJT A;  2BKO A;  3RC8 A;  4UM3 P;  2WMN A;  5BRX A;  4JI3 T;  4I55 E;  2YIN A;  4DR6 T;  3SIO A;  3VR9 A;  3AED A;  2VQE T;  2X66 A;  4U74 A;  4QX8 B;  4O2B E;  2Y7Y A;  2V7L A;  3ZC1 A;  3UUM A;  4DV4 T;  1WR6 A;  3ZYK A;  2X0H A;  1T72 A;  1HNZ T;  3NWI A;  5FL0 A;  4H9O C;  2DNX A;  4PW8 A;  1XNR T;  2V1D B;  4BFQ A;  3CX6 B;  3LK2 B;  3M65 A;  2WM9 A;  4MFR A;  4B6X A;  3P4S A;  4HE8 A;  3C4W A;  3ESL A;  2FJD A;  4OHF A;  2X0L B;  3TKL B;  3I1A A;  5ABH A;  4O4H E;  3B57 A;  4QX7 B;  1UX4 A;  3AA1 B;  4AKR B;  3AEC A;  4CN1 A;  1UGO A;  3CKD A;  2M6B A;  2KWI B;  3SRZ A;  3C84 A;  2XHE B;  5LP6 E;  4Z8X A;  3H3M A;  3E22 E;  5AFN A;  2IDO B;  3RPU A;  2BZB A;  2LSK A;  4XHE A;  4LFB T;  1CHU A;  5HCM A;  4ZS2 A;  4PJN A;  4Z90 A;  3RKG A;  3GUA A;  3Q9D A;  4IE4 A;  4LF5 T;  1G73 A;  3C51 A;  2BVL A;  3ZLI A;  3AVR A;  5FYM A;  3U8K A;  2JQH A;  3HA4 A;  4X20 E;  5C2T A;  2H89 A;  4LFC T;  5FJV A;  2EHO D;  3FZK B;  3L3P A;  1WYC A;  3ZMZ B;  4YTN A;  1KFY A;  4OYK A;  1OWA A;  2VKD A;  4PFO A;  5LGU B;  4H63 H;  1XZY A;  4HFD A;  4O8S A;  3RYI E;  4B3S T;  5BW2 A;  3RIF A;  4AFH A;  4ZI3 D;  4XAX B;  1B7T A;  4WBN E;  4HWC A;  2LHR A;  1UX2 A;  4A5X A;  1MMG A;  2XYS A;  4H9P C;  3J9X 1;  2CRB A;  2SPC A;  5FVL A;  4PAG A;  2K3W A;  4ASK A;  1HR0 T;  4X66 T;  4KMC A;  4X5T A;  3ZN1 B;  4ILA A;  4JBW F;  3G06 A;  2QVA A;  4QXC B;  1YQ3 A;  2X67 A;  5ABF A;  1U4Q A;  1NWM X;  4CXY A;  4IE0 A;  1LRZ A;  5JR9 A;  3RIU C;  3N2K E;  2BKN A;  2XTL A;  1LVF A;  2QA7 A;  4I50 E;  4JI5 T;  2WNJ A;  2CXD A;  2K9A A;  3PDY A;  3KBT A;  3WTH A;  4KI0 F;  2E9X B;  4HFH A;  3N9P A;  4ZHQ E;  2LE8 A;  3UFG A;  4TZ4 C;  4TWD A;  1LVK A;  4EZ1 A;  4YSY A;  4PJL A;  5J2T E;  1SHZ C;  2WWU A;  3N9N A;  3O9X A;  4XBF B;  4DMW A;  2XQ6 A;  4ZZB A;  5LXB A;  2VVN A;  4AIU A;  3WTJ A;  3C4X A;  4GIW A;  1UX5 A;  5JRE A;  3PJA J;  2EHO A;  5ABG A;  3UFE A;  3KFW X;  4HFB A;  4V1A v;  5SYO A;  2DLR A;  2P9B A;  4TUY E;  4UEL A;  2XQA A;  2DCF A;  4ILC A;  3MAC A;  5IUX A;  3T1H T;  2RA1 A;  3ZJ1 A;  3P4R A;  1HG5 A;  2G0U A;  3FZM B;  1HS7 A;  5CFB A;  2XQY A;  3FZF B;  2K24 A;  2LKG A;  5DQW A;  3AE7 A;  3N9O A;  1G8X A;  1HFA A;  3A5X A;  3F57 A;  4JI0 T;  3L39 A;  3UT5 E;  2WZI A;  3ZMS B;  2N9D A;  1XMQ T;  5JDQ A;  3ZYM A;  1XDO A;  4UY2 A;  2V7K A;  4KP3 C;  5JTG A;  2E2A A;  1D1B A;  3UUN A;  3RYC E;  4UR9 A;  3NBX X;  4FI5 A;  5JH7 E;  4XZC A;  2VKO A;  5CA1 E;  3PUZ F;  4X1I E;  3CIR A;  3ZDG A;  1ZHC A;  3KV5 A;  4QHO A;  2YDS A;  2PG8 A;  4AKH A;  1FJG T;  5HYA A;  2VL0 A;  2LJL A;  3PV0 F;  2E9X C;  3D0T A;  5J5H A;  2VUR A;  5F5W A;  4QAA A;  3PUY F;  5AQS B;  5L3B B;  5J5I A;  2W00 A;  5KXJ A;  2CLY B;  1CUN A;  3N9M A;  3H3A A;  1NAF A;  5J5F A;  2W8F A;  3F31 A;  4TNW A;  1HTJ F;  3IF8 B;  2GK9 A;  4X64 T;  4EZH A;  2MAW A;  2ZM8 A;  3AA0 B;  2KMF A;  2LOS A;  2J4G A;  2IW5 B;  5LBQ B;  1N34 T;  3UU5 A;  2HN2 A;  1YKH B;  3AEF A;  2N2N A;  3L8R A;  4GYR A;  4KUM B;  5HXS A;  4KBM B;  3AEA A;  3JAD A;  3RGL A;  3DP7 A;  4A97 A;  2VK9 A;  2N1G A;  1L0V A;  3K3O A;  2BYS A;  2CA5 A;  2LM9 A;  4CN4 A;  3ZMT B;  3RQW A;  4IL9 A;  2KSR A;  3AEE A;  3HR0 A;  3PUV F;  3UQ4 A;  4PIR A;  4MAL A;  5AQR B;  1J5W A;  3I0Q A;  5HXR A;  3IGQ A;  4JUY A;  5KE4 A;  2I59 A;  5FXZ A;  2ZJU A;  5J2U E;  3AAA B;  1MIY A;  3PU8 A;  2PTF A;  3ETV A;  2Y8D A;  3HI2 A;  3PUQ A;  3KV9 A;  4IDZ A;  3JAE A;  4AXP A;  4DV2 T;  1E2A A;  4GKJ T;  5JRC B;  3UUX B;  2J1D G;  5AQF B;  2LRK A;  1NEK A;  4QKN A;  2IHR 1;  3O1H A;  4U2Z A;  1U5P A;  5KDM C;  1FEW A;  3SQ6 A;  2CBJ A;  4UF0 A;  1N33 T;  2E9X A;  5FXW A;  2WP9 A;  1KNR A;  4PJJ A;  2MOZ A;  3UUB A;  4AQF A;  5AQN B;  2YKS A;  3ZKR A;  1IBL T;  2DHR A;  3WTI A;  1XNQ T;  4YTM A;  2X9W A;  5HEU A;  2LHN A;  1UV6 A;  3B13 A;  3EAB A;  2BS3 A;  3O1I A;  4DUZ T;  1M7K A;  4ZJS A;  2V7J A;  5DJQ C;  2XM2 A;  2IUB A;  2I6H A;  2WWV A;  4CQI A;  5FL1 A;  4CI3 B;  4CXX A;  2LSI A;  4AIS A;  2PH9 A;  4UXN B;  3DJB A;  5F3J A;  1BR0 A;  1X9B A;  2BG9 E;  3SQ9 A;  2L8K A;  1Z0P A;  4DVD A;  2CEA A;  5FVK A;  3QK6 A;  2CLY C;  4UM3 A;  5J0Z A;  3U3I A;  1AJ3 A;  4DO0 A;  1VCT A;  4AFG A;  2V5C A;  2W66 A;  2OV9 A;  4NUU A;  4YT0 A;  4JV5 T;  4HGA A;  4EXT A;  3N5L A;  3N9Q A;  4MBQ A;  1E7P A;  4HWF A;  2BBH A;  2Y56 A;  2QYW A;  3ZSS A;  2MPK A;  2ZLY A;  3JC6 C;  4Z91 A;  1IBK T;  3U8L A;  1MMN A;  4IDQ A;  4QXB B;  2VQF T;  3ZMV B;  1HNW T;  3KV6 A;  5AQM B;  2WQY A;  2IC9 A;  3N2O A;  1IAP A;  2UUB T;  2IAK A;  4EEB A;  4DR3 T;  4LML A;  3HKB E;  4O2A E;  5F8P A;  2XQ7 A;  2WDQ A;  3IHR A;  2BYN A;  2WMO A;  1SUM B;  2HHH T;  3EUH A;  3CML A;  2KXP B;  4QH1 A;  2UU9 T;  3RKO A;  2WNL A;  2PBI A;  2CXL A;  3JCF A;  4IT4 A;  3Q5X A;  4YSX A;  4LMK A;  4EYY R;  2D0T A;  2V8S V;  1T98 A;  3GN5 A;  2XYT A;  1I9B A;  5L3F B;  2CHO A;  4I4T E;  1HNX T;  4HWH A;  4OYJ A;  3P8C D;  1UUS A;  2V6X A;  4JEU B;  3KVB A;  3UU4 A;  3U8N A;  3QC9 A;  4AI6 A;  4JLE A;  4H9Q C;  3SOL A;  4DR7 T;  1T7S A;  3VRA A;  5LCY A;  2Y54 A;  3TLT A;  1XWM A;  2JJ9 A;  4P0B A;  4GK5 E;  1N36 T;  2XQ8 A;  3M3Z B;  4JI7 T;  2KND A;  1EZ3 A;  3S4U A;  4DR5 T;  2JRK A;  2V6Y B;  4UVA B;  4CXW A;  4WV9 A;  1MIW A;  2NP9 A;  3VHL A;  1YKE B;  2UXX B;  4UVC B;  2DWG A;  2K5B B;  3P50 A;  3PUA A;  4ILB A;  5AFL A;  2VL8 A;  4G63 A;  4UVB B;  3LG7 A;  4QH4 A;  3TLU A;  3BQK A;  3MKD A;  5AQU B;  3AE6 A;  4F8H A;  3ZDH A;  4KX6 A;  3V5U A;  2XSA A;  5AQT B;  3RYH E;  2YDR A;  4ZK1 A;  4MHC A;  2IML A;  2FJB A;  3WAJ A;  1YXR A;  3DTO A;  3FB2 A;  4K0K T;  5AQK B;  2E5L T;  2XNU A;  4DND A;  2CWO A;  4E7S A;  3H37 A;  3R6N A;  3AEG A;  3NRX A;  3N9L A;  4NXM T;  1NEN A;  3FHN A;  5DAB A;  2X0Y A;  2FBW A;  4IGU A;  2J47 A;  2JQ9 A;  2CPT A;  2H3R A;  4E7Z A;  4Q25 A;  3B5M A;  2W8G A;  4IDO A;  4L9I A;  2UXD T;  3Q5W A;  4P09 A;  3NKZ A;  2HN1 A;  4UM1 A;  5M4Y A;  3MZK B;  4HTE A;  3J7Y q;  3PUW F;  2XSB A;  4X1K E;  3HKD E;  4LFA T;  2CXF A;  2WU5 A;  5JDL A;  1I6Z A;  4DV6 T;  3CQX C;  5CB4 E;  3OKQ A;  5ABF B;  3WTM A;  3T1Y T;  3Q2M A;  1WR0 A;  2X68 A;  1WCR A;  4DV5 T;  4PNI A;  3QB5 K;  4UIG A;  5L4E A;  3V5S A;  3VRB A; 
#chains in the Genus database with same CATH homology
 3P4W A;  3TLW A;  4AFT A;  2LKG A;  4ZR6 A;  4F8H A;  3ZDH A;  4LMJ A;  2YKS A;  3ZKR A;  4LML A;  2PGZ A;  4X5T A;  2UZ6 A;  3EHZ A;  2BG9 C;  3JAD A;  2BYP A;  2BYQ A;  2M6B A;  2XQ5 A;  4ILA A;  3WTI A;  5AFM A;  2XQ7 A;  2BYN A;  4QAC A;  3C84 A;  3U8M A;  4ZK1 A;  4A97 A;  5JME A;  4UXU A;  2XZ5 A;  3WTN A;  1OED A;  5HEU A;  5AFN A;  1UV6 A;  4TNV A;  2LKH A;  2M6I A;  4QH1 A;  4A98 A;  2BYS A;  4XK9 A;  3JAF A;  4UY2 A;  2BG9 B;  3RQW A;  4ZRU A;  3RQU A;  4IL9 A;  4FRR A;  2KSR A;  4XHE A;  4ZJS A;  2WNL A;  5HCM A;  3UQ4 A;  2X00 D;  2XNU A;  4PIR A;  2BR8 A;  4ZK4 A;  2YME A;  3SH1 A;  4Z90 A;  3T4M A;  4B5D A;  4LMK A;  2XQ9 A;  4QH5 A;  2XNT A;  2WNC A;  3GUA A;  4TWH A;  2PH9 A;  5CO5 A;  2WNJ A;  2Y58 A;  4QAB A;  5AFK A;  4TWF A;  1UW6 A;  2BG9 A;  3WTL A;  1OED E;  5HEJ A;  4HFC A;  4ZZC A;  3ZDG A;  2XYT A;  3IGQ A;  2YN6 A;  2BJ0 A;  3PEO A;  4BQT A;  5KZU A;  4NPP A;  1I9B A;  3WTH A;  5KE4 A;  2BG9 E;  3WIP A;  2BR7 A;  3SQ9 A;  5J5G A;  3U8K A;  2YMD A;  2ZJU A;  4HFH A;  5HEO A;  3RI5 A;  3TLV A;  2C9T A;  3C79 A;  5L4H A;  4NZB A;  5AFJ A;  4ZJT A;  4TWD A;  2XQ4 A;  3UU3 A;  3UU8 A;  2W8G A;  4EZ1 A;  5AFM B;  2VL0 A;  4UM3 P;  4UM3 A;  4HFE A;  5HEH A;  3UU4 A;  5FJV A;  3UQ7 A;  5BRX A;  3U8N A;  5J0Z A;  3SIO A;  2XQ6 A;  4UM1 A;  4ZZB A;  5J5H A;  5L47 A;  4AFG A;  2WN9 A;  2X00 A;  5LXB A;  3WTJ A;  3JAE A;  4QAA A;  2Y54 A;  2Y7Y A;  4DBM A;  3TLT A;  4HFI A;  4IRE A;  2ZJV A;  4UM3 S;  3RHW A;  5J5I A;  2XNV A;  3WTO A;  3EAM A;  4HFD A;  3UU6 A;  5HCJ A;  5BW2 A;  2XQ8 A;  5TVC A;  1OED C;  5HEG A;  3RIF A;  5LG3 A;  2W8F A;  3U8J A;  5AIN A;  5J5F A;  4AFH A;  3TLS A;  4WV9 A;  3WTK A;  4TNW A;  4HFB A;  4HQP A;  5SYO A;  1UX2 A;  2MAW A;  2Y56 A;  4BFQ A;  2XQA A;  3WTM A;  1OED B;  4ILC A;  5IUX A;  3SQ6 A;  2QC1 B;  3LSV A;  5BP0 A;  3P50 A;  2XYS A;  4Z91 A;  4ALX A;  4ILB A;  2WZY A;  3PMZ A;  5AFL A;  4D01 A;  5AFH A;  3U8L A;  2XQ3 A;  4QH4 A;  3TLU A;  3UU5 A;  2BYR A;  4COF A;  2LLY A;  3UUB A;  2XZ6 A;  2YOE A;  2LM2 A;  3EI0 A;  3RIA A;  5L4E A;  5CFB A;  2Y57 A;  4IL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...