4HFCA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to 2-bromo-ethanol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfcA01
4NZBA 4XK9A 5FJVA 4HFEA 2XQ5A 4HFBA 2PGZA 3UU5A 3WIPA 2XQ6A 2BR8A 2LM2A 2XQ7A 3ZDGA 3RIAA 3C84A 4QABA 4QH5A 2XQ9A 3WTJA 2WNJA 5KE4A 2MAWA 2QC1B 5KZUA 3RHWA 4FRRA 3U8KA 2XQ3A 5AFKA 2BG9A 3U8MA 4ILBA 5SYOA 4DBMA 2C9TA 3U8JA 4HFCA 4ILCA 2YMDA 1OEDC 2YN6A 2YOEA 3P50A 2Y7YA 3JAEA 3TLSA 2BYNA 2XYTA 2XYSA 4ZK4A 4AFGA 5HEGA 4UM3S 3RI5A 2W8FA 2M6BA 2WN9A 4UY2A 2YMEA 3UQ7A 5J5GA 5BRXA 4QH4A 3T4MA 5IUXA 3TLVA 2M6IA 3TLTA 3C79A 2W8GA 4ZK1A 3UUBA 2Y57A 4NPPA 3EHZA 5HCMA 4QACA 4UM3P 3RQUA 3SH1A 4IL4A 3GUAA 3EI0A 2LLYA 3TLWA 4TNWA 3WTKA 4TWFA 2BG9B 3EAMA 2XQ8A 4ZZCA 2WZYA 2ZJVA 2BYPA 2WNLA 2KSRA 3PEOA 4AFHA 5AFMA 3WTHA 5JMEA 4HFDA 1OEDE 3JAFA 3UU3A 4LMJA 2BYSA 2BYRA 4UXUA 4B5DA 3SIOA 5J5HA 4ZZBA 4LMKA 4COFA 2XNTA 4ILAA 3PMZA 2XQ4A 4ZR6A 5J5IA 2Y58A 5J5FA 4UM3A 5BW2A 3UU6A 4HQPA 3UQ4A 4BFQA 5HEJA 5AFLA 4EZ1A 3TLUA 5J0ZA 4BQTA 1UV6A 2BJ0A 2BG9C 2XNUA 1I9BA 1UW6A 2YKSA 3UU4A 3LSVA 4QAAA 3WTIA 2XQAA 2XZ5A 3U8LA 5AFHA 3WTLA 3P4WA 5AFMB 4F8HA 1UX2A 3SQ9A 4TWDA 3ZDHA 3U8NA 4HFHA 1OEDA 5AINA 2XZ6A 3IGQA 4D01A 2X00D 4LMLA 4ZJTA 2XNVA 4ZJSA 5BP0A 4ALXA 4A98A 4AFTA 4Z91A 4ZRUA 5L4HA 4IREA 4Z90A 4QH1A 5L47A 2ZJUA 2LKGA 2Y56A 5L4EA 2BYQA 3JADA 4PIRA 3WTOA 4HFIA 4WV9A 2BG9E 5AFJA 2Y54A 3RIFA 4X5TA 4UM1A 5CO5A 3WTMA 5AFNA 2VL0A 3RQWA 5HEOA 2BR7A 4TWHA 5LXBA 2LKHA 5HEUA 5HEHA 2UZ6A 2PH9A 4A97A 5TVCA 3ZKRA 4TNVA 3UU8A 3SQ6A 5LG3A 1OEDB 5HCJA 2WNCA 4IL9A 2X00A 5CFBA 4XHEA 3WTNA
chains in the Genus database with same CATH superfamily
4OFZA 2XQ5A 1M62A 3UU5A 4KP3C 2XUEA 4DR2T 4QH5A 4P09A 4DIDB 5FVLA 4ZOLE 1IBMT 3U8MA 4ILBA 2W61A 2UXNB 1UX4A 2AXDS 3EVYA 1OXZA 3W15B 3ZYMA 3OBVE 3ANWB 3ZMZB 4IL4A 3E08A 3K3QC 3RC3A 3FZFB 2PJQA 4DBRA 2XNTA 4U2YA 4EEBA 5CJ5A 3ETVA 1VCSA 2EHOD 3R6NA 2K3WA 1YW0A 1HNWT 2E5LT 4YHHT 3UFGA 1BR0A 2CWYA 3L09A 3NVOA 5JR9A 4UV8B 3P4WA 2X9XA 1SHZC 3ZDHA 2WP9A 3IHRA 1UGOA 4P0AA 5AINA 2X00D 2WMOA 4U72A 4EIWA 3C4WA 2JIWA 5LJNA 1QUUA 4QHOA 3NZPA 1YQ3A 3RIFA 4MBQA 3J7Yq 5HEOA 3U78A 3RRWA 2X9WA 4DV1T 4J2CA 3VRAA 5ABHA 3VRBA 3LG7A 2WZIA 4WBNE 2PGZA 4DR4T 3NBXX 3AE1A 5LJMA 2E9XD 4QABA 2HHHT 1U5PA 3WTJA 1OWAA 4CXXA 2XQ3A 3WAJA 4B3ST 1KNRA 4DR1T 4V1Av 5LB7B 5CGMA 3AE7A 3N9NA 4JI3T 4F6RC 5J5GA 1T72A 2ODUA 3UUBA 3HKBE 5H6RB 4ZXLA 1MMAA 5FYMA 2D2SA 4EZ4A 3CQCB 3FZHB 3KBUA 3P4RA 3Q5EA 2C5KT 2MOZA 2ODVA 2JPFA 2BYPA 3AEBA 3PUYF 3WTHA 3O4XE 2BVLA 3LBXB 1MNEA 4AIUA 3F57A 2XAGB 3QOFA 5AFLA 1XWMA 5HXHA 4JI1T 2FUPA 4WYVA 4TWDA 3UUMA 4H9SE 2LRKA 2CM0A 4LMLA 2WMNA 4XBFB 4QH1A 3A8YC 2VQFT 2BKPA 3JADA 3FZLB 4PJNA 2LOPA 3WTMA 2E8IA 4KUMB 1UUSA 2WBLA 1OEDB 4IL9A 4JI5T 5FL0A 2IDOB 3A5XA 3M65A 3ZDGA 4WBOA 1N34T 1HX1B 2QC1B 3ZSSA 2BG9A 5LHHB 4DV0T 4DBMA 2CHNA 3O9XA 1FMWA 2YMDA 5AQTB 1T98A 4E7ZA 3SFEA 5BRXA 3TLVA 3TLTA 2X9HA 2CLYC 5AQHB 4TV8E 2M67A 3H37A 3HI2A 2BYRA 2V7IA 3HR0A 3CMLA 3ZN0B 3FXDB 3UQ4A 2Y48B 2BJ0A 2WDQA 3I1AA 4IDPA 5JREA 1BR1A 1D0ZA 2CBJA 3ONJA 4I43B 3VKGA 3SQ9A 4U33A 4HE8A 4TV9E 2XNVA 4DV7T 1S94A 5L4HA 3AE3A 4IREA 2LJLA 4HWIB 4X1KE 2K5BB 2N9DA 3ZJ2A 1LVKA 2BG9E 4JI8T 2Y54A 2IW5B 4G2AA 2LKHA 4U2ZA 3PURA 2E5VA 4LFBT 2WB5A 3ZCIA 2VWAA 4XHEA 2MYSA 4XK9A 2VKHA 1ZOYA 5LMNT 2BR8A 2W66A 4QKNA 2H88A 3SWHA 2Y6XA 2F4VT 5DQVA 4ILCA 3PUZF 2FJEA 4JEHB 4H9QC 3TLSA 3QC9A 3FXEB 4O4LE 4HGAA 3GN5A 4X1YE 4AFGA 4GYRA 3NRXA 5AQGB 3UULA 4ZS2A 5LHGB 2C5IT 4PJJA 1NEKA 4FI5A 4B6XA 5JQGE 2ACXA 3WTKA 3EDUA 4IT4A 1IBLT 3X1DA 2Q9QC 2WAUA 3UUNA 2V26A 1HF8A 2XM2A 2UXBT 5FP3A 2N1GA 5LYJE 2XSBA 5LGTB 1KNZA 2X51A 4C91A 2L3LA 4HEAA 2J1DG 3SS1A 3ZMVB 3WTLA 2LSYA 2LHNA 1D1AA 1T7SA 3U8NA 4ILUA 4DVDA 3RYHE 4GKJT 2XASB 3FB2A 2XZ6A 3PUWF 4JEUB 4OYKA 3AE4A 2Y56A 3ZMTB 2BYQA 1NENA 4LF4T 3WTOA 4JI2T 5JR9B 1IZNB 3AVRA 5J2TE 1IJ5A 3VR9A 3ZPOA 2VKDA 4CI3B 1WFDA 2WY2A 5LGUB 1ZV4X 1VRBA 2VB6A 3BQIA 2OV9A 5AQRB 3RH3A 3P4QA 4H9PC 4QX8B 2MAWA 4DBQA 2YDQA 3G06A 3KVBA 4EB6E 2PG8A 1XZYA 2XYTA 4GYSA 5LG4A 1JNZA 3I9YA 3Q5WA 4QXHB 4NUVA 3RQUA 3CQXC 1L0VA 2V6YA 3AEGA 3ZT7A 5HYAA 2J62A 5J5HA 4UXUA 3SFDA 4COFA 2JQ9A 2NWBA 1D1CA 4EYYR 2HH7A 3Q5XA 2KZ7B 4DV4T 2A3DA 3AA1B 5HEJA 2JQHA 4EZ1A 4EOZB 4BQTA 2DL1A 5ABEA 5F8PA 1E2AA 3NRYA 1I9BA 2IC6A 1WR0A 2KMFA 3ZMUB 1UX2A 2K24A 2PTFA 5AQPB 1O3XA 5FXWA 3RGLA 4ZJTA 3VR8A 4O2AE 4Z90A 3N9OA 5FMNA 3KV5A 2Y8DA 4TWHA 4ANJA 3QK6A 5HEUA 4ZI3D 1LVFA 2PH9A 2YK0A 2I59A 1X9BA 2NW8A 3CPZA 3RRCA 4MFRA 3VKHA 3F31A 3CK6A 3RIAA 4Z8XA 3ZLIA 2XQ9A 2GK9A 3ESLA 2WNJA 3U8KA 5HXRA 3PUGA 2MBGA 4NUUA 4TZ4C 4KHPT 5E0OA 4ZK4A 2IAKA 2M6BA 2ZLYA 4IHJE 4NPPA 4QACA 4P0BA 1D0XA 3SH1A 3EI0A 4H9NC 2DNXA 2A9UA 4MHCA 2BG9B 4AI6A 2WZYA 4TN7B 2ZM8A 1N33T 3JAFA 3SIOA 5JDQA 2A2FX 4LMKA 2JQKA 3PMZA 4ZI7E 4IE4A 5JRCA 1HTJF 4EEDA 3N2KE 5FY7A 3OVUA 3E0ZA 3DP7A 3JC6D 3HKDE 1D0YA 1UURA 3RYIE 2BVMA 3LSVA 5ADXL 1I6ZA 1HCIA 3WTIA 4JYAT 2V7LA 2AE9A 3EDVA 3AXJB 2HN2A 4WZXA 3C4XA 4ZJSA 3AEDA 4U7IA 2J47A 4AQYT 2XAHB 3T8OA 2BKNA 1W0AA 2LSGA 5LXBA 2PBIA 1FMVA 2UZ6A 5HCJA 2WNCA 2BKOA 3ABVA 4DMWA 2XHEB 4PNIA 4X62T 5CA1E 4DV3T 3LJCA 5HXEA 2Z6EA 3ETUA 3AE5A 4GKKT 2EHOC 3AE8A 4IDNA 2CWOA 2NTYA 4HWCA 2W8FA 5ETWA 5AQKB 1Z8UA 4AQGA 1WCRA 4GK0E 4A5XA 4QX7B 2WQYA 3EAMA 3MKDA 3WI3A 4UELA 1CUNA 3GN5B 2VKJA 5LOVE 4LFAT 2JMKA 4OYJA 3N9MA 3AVSA 4O4HE 1NAFA 2D0UA 4X65T 4AKGA 3E22E 2UUAT 5BP0A 1UX5A 2NTXA 4ASKA 2E9XC 1BR2A 2LKGA 2V1DB 3BQLA 5LCYA 3PUAA 3SOLA 1GQEA 3ZYKA 5L3DB 5AFNA 2VL0A 3CWZB 4KMCA 1LKXA 4EGWA 2NW9A 2WM9A 4JI4T 2Q9QA 4UVCB 4NIQA 1MMGA 3VU7H 2IIUA 1HR0T 5H6QB 4E7SA 4HN9A 5CA0E 3PU8A 2QGSA 1Y64B 2LT3A 3KINB 5BMVE 2R6GF 5AQJB 5L3EB 2Y7YA 2IUBA 2CRBA 4UM3S 4I50E 3CX7B 3LFMA 5FXVA 1VOMA 3H3AA 2P9BA 3K3NA 1XNQT 1FJGT 4IE0A 1KF6A 4ZEYA 3P4PA 4LMJA 4YTNA 1XMQT 2OLTA 5IWAT 3TLUA 1IJ6A 3BK9A 3CKDA 5EZYE 3C50A 2V6YB 2WS3A 1FEWA 3RX6A 2CXDA 5KMGP 4HFHA 2WDVA 2UXXB 1N32T 4P1NA 4ALXA 4A98A 2CCQA 3O1JA 3Q2MA 2V6XA 4L5GA 3C51A 3JCFA 5L47A 2ZJUA 4BA9A 3F2EA 1MMNA 2UUBT 2C5JA 4JBWF 5CB4E 4A97A 4OK0A 4CN1A 5TAOA 5CFBA 3M3ZB 4TX5A 1HS7A 3WIPA 4DUYT 2XQ7A 3QB5A 2XAJB 3ONLC 4JI0T 1KNPA 4H63V 3RHWA 2X0HA 1H7CA 3KDSE 2CMRA 4PK4A 4OX9T 5F3JA 2DWGA 3ZC1A 3CIRA 4XAXB 4K0KT 2VASA 2W8GA 3O1IA 1ZKEA 5DABA 4IGUA 5J2UE 4AKHA 4ADZA 2X0LB 3NWIA 3ZMSB 4HFDA 5JMEA 1MIVA 2BDEA 2BYSA 2H7VC 4UF0A 4AQFC 3EUHA 3NKZA 1SA0E 3S4UA 1QSDA 1HG5A 3GA8A 2W0GA 4IE6A 2UUCT 2XNUA 1CHUA 4QAAA 2FBWA 2NW7A 2IC9A 3AEFA 5JRCB 4JI7T 2X66A 2YDRA 3HL6A 3P8CD 4LF7T 4O4JE 2B1EA 4L9IA 1MMDA 3AA0B 4DV6T 4WV9A 5AQFB 3KV9A 3ZEFB 4I4TE 5FXXA 4HKAA 1UK5A 4YJ2E 4AKIA 3RIUC 5FJVA 2KNDA 4DMVA 4ISTA 4NXMT 3OYZA 5M4YA 4ERRA 5AQLB 2CLYB 5FY0A 4JI6T 2BS4A 3KV6A 4BAYB 5EK2A 2C9TA 2JRKA 5JDNA 4ZI2D 2L8KA 2YMEA 3C79A 3OYXA 2VVSA 3ZC0A 4DO0A 5JDLA 4TNWA 2WU5A 2BBHA 5L3BB 2VURA 4N78D 4AFHA 5DQWA 2X9YA 5AQVB 2BZBA 4ILAA 2W63A 3K1SA 2Y58A 2CXLA 5JDMA 3QUJA 1WRDA 2ZM6T 4JV5T 5HAXA 3AAIA 3LK2B 5FVKA 4KX6A 2RP4A 2H3RA 4O2BE 4CN4A 4H63H 3OPCA 2EHOA 3IBPA 5KDMC 2CE7A 5AQNB 3PE0A 5C8YE 3TKLB 4YTMA 4YT0A 5HXCA 4X5TA 4MLKA 4M1PA 3FBZA 2H7OA 2FJDA 2D5UA 4EAHA 2X00A 4PK5A 4IDQA 3WTNA 4EXTA 2UU9T 2LM2A 3AE6A 2HPLA 1YD8G 5KE4A 4X64T 4XZCA 2LM9A 2I0MA 3U8JA 4UVAB 2LHRA 3C64A 1Z0PA 4AISA 1EZ3A 3UTKA 2QYWA 3N9QA 3ZN1B 3PU3A 4WNKA 2E9XA 4FJOA 1XDPA 2C0SA 3KBTA 3TLWA 2XZEA 3R84B 5A1LA 5AFMA 5AQIB 2DHRA 4ZR6A 3P7IA 1X79A 3IA3A 4X1IE 5BW2A 3LK42 2CPTA 3MA9A 4KI0F 4UV9B 1S35A 4ZI3C 3FZKB 4U31A 5AQUB 3ZYLA 4DUZT 5AQOB 3B5MA 3MXZA 5AFHA 2VVNA 3L39A 4I55E 5HXSA 5C3JA 5L3GB 4GOUA 4U3CA 2H89A 4H9OC 3VHLA 4AFTA 4Z91A 3I0OA 2DLRA 4PIRA 2CA5A 3P4SA 5LA6E 5CO5A 2XJ7A 2YINA 2KT9A 2QA7A 5LBQB 3RKGA 5HEHA 3OJAA 3LDQB 4CXYA 3UUXB 4H9RC 3C84A 3K8PC 3PV0F 5KZUA 2X67A 4YFSA 2UXDT 3RLFF 2XSAA 3D0TA 1E1HB 1OEDC 3N2GE 5HEGA 4UY2A 3JC6C 5LMUT 4ZK1A 2LE8A 5FKYA 2LRLA 3U3IA 3V5SA 3FBLA 4IDOA 3GWHA 2DI4A 2KWHA 1B7TA 1YXRA 3I9WA 3UT5E 2JJ9A 1U4QA 1DU2A 2KSRA 3DTOA 1SUMB 1BR4A 3C98B 2JMHA 4ZZBA 4LF5T 3CX8B 3AAAB 5J5IA 3L3PA 1IAPA 3AA7B 3QNUA 2QRXA 5J0ZA 4B3RT 4YLHA 2HPJA 3UU4A 3V5UA 2XM1A 1AJ3A 2VL8A 4JUYA 2IMLA 2XAQB 3AE9A 2WDRA 3PUQA 4UF0B 4D01A 4GK5E 2A72A 1W09A 4EYUA 1HNZT 5JDGA 2V7JA 5L4EA 4WW0A 1KEYA 4AKRB 1W0BA 1I94T 4A56A 4PJMA 5C2TA 2NOXA 5AFUL 4TNVA 4HWDA 4TUYE 5EK4A 5JDHA 5ABFA 2V5CA 4CN6A 2N2NA 4AQFA 1HFAA 2MPKA 4HWFA 2XAFB 4PFOA 3AEEA 4DR7T 1VCTA 2NP9A 2YDSA 4QWNB 3HKEE 4FRRA 5AFKA 4Q25A 4QXCB 1UCUA 1NWMX 3MK7C 2YN6A 4EV6A 1XDOA 4QXBB 1V9DA 4YSYA 3T4MA 3PJAA 5AQQB 5LXTE 2V7MA 2KXPB 3OTOT 1MIWA 3GUAA 4CI1B 1M7KA 1J5ET 4O4IE 2ZJVA 1ZHCA 3PUXF 3RYCE 5KX5E 2ZMAA 2XQ4A 3ZCJA 1US7B 3QB5K 5J5FA 3RIUA 3T1HT 1J1JA 3MACA 4ZS3A 4IE7A 4BFQA 4L0RA 5FY1A 3ZT5A 1UV6A 3K3OA 5FNVE 4LF9T 4HFVA 2W62A 5HWXA 2BS2A 2VQET 3Q9DA 3AEAA 4ZHQE 1JNRA 2DCFA 4YSZA 4DR6T 4UR9A 1HNXT 3RF1A 2WSSV 2B76A 5LP6E 4C90A 4HFIA 2MTQA 4UXNB 3HA4A 2LSJA 4UVBB 1D1BA 3O1HA 2YEVC 4UIGA 2OA5A 4CQIA 2JQQA 1R8IA 5GONE 2EHOB 5EK3A 5IHYA 3UFEA 5L2LA 3GMIA 4HFBA 1XNRT 3KFWX 1HG2A 1Y01A 3ANWA 5JR9C 5J1GA 2X68A 2V8SV 1KFYA 4K0UA 3NZQA 4EZHA 3PUSA 3RPUA 3IF8B 2WU2A 4HFCA 5KXJA 2E2AA 2WWVA 3AXJA 2YOEA 3KV4A 2BYNA 3RI5A 3I0QA 2WN9A 3UQ7A 3OKQA 2LEHA 5IUXA 2M6IA 4ISSA 2CXFA 2FJBA 5HCMA 5HWYA 4PJLA 4YY3T 2LLYA 2WCAA 3AE2A 4LFCT 2XQ8A 5JDFA 2XQYA 2WNLA 3C4ZA 3T1YT 3KVAA 3A7MA 2K48A 3PDYA 4DV2T 1KK7A 2KWIB 2E9XB 1WR6A 2G0UA 1G8XA 2V7KA 2V5DA 1J5WA 5AFMB 4GIWA 3J9X1 2Q9QD 3IGQA 2DWKA 5AQMB 3MJXA 2W2UA 3RKOA 2QVAA 1QLBA 3N2OA 3SRZA 2ES0A 4DNDA 2IHR1 4CI2B 2D0TA 2XPKA 3N9LA 4UM1A 2W67A 2BR7A 5TVCA 3SQ6A 3IEEA 4AXPA 3H3MA 4KHZF 4NZBA 4DV5T 2XQ6A 4YTPA 2VKOA 1MIYA 2WZHA 4KBMB 4U74A 3Q5DA 2CBIA 4CZZB 3FZMB 4X66T 3PTRB 3N5LA 3JAEA 4U7YA 3ZSTA 4PFPA 3LBXA 3MZKB 4AKLA 4IE5A 3N9PA 4QH4A 3L8RA 3EHZA 4YJ3E 4BJNA 1SE7A 4BJMA 2BS3A 4O8SA 4TWFA 4ZZCA 1E7PA 4LF8T 3ONXA 3PEOA 1ZEEA 1FIOA 2KINB 3RC8A 4DR3T 1G73A 2W00A 1ZP0A 3B57A 4UM3A 3PUVF 2CEAA 4HQPA 4B3TT 2D9DA 3WAKA 2BG9C 4YHJA 1UW6A 5AQSB 5BR8T 1XMOT 3CX6B 4G63A 1OEDA 3LK3B 2BBJA 1N36T 5LNKA 2K9AA 1WYBA 3AAEB 4ZRUA 2LSIA 4MALA 2YU2A 2I6HA 4HWHA 2LSKA 5AFJA 5L3FB 4ZI2C 5IYZE 2ACZA 3UU8A 3ZKRA 5JH7E 2WWUA 5LG3A 2RPAA 5JTGA 4HFEA 4YXDA 4CXWA 2NR4A 4JLEA 5LGNB 1LRZA 2VK9A 3AECA 4OHFA 5LBMA 5FXZA 4NXNT 5SYOA 2ZM0A 3B13A 5L3CB 1IBKT 1YKEB 3P50A 2XYSA 2XTLA 4YSXA 2KLQA 5ABFB 3EABA 4PAGA 3CVRA 2Y57A 4UM3P 2W4XA 2HN1A 3AB3B 2XY8B 1W9RA 2YU1A 4PW8A 3DJBA 5LHIB 4DR5T 5JVDE 1OEDE 3UU3A 4B5DA 5ABGA 4LF6T 3ZT6A 2Q9QB 4UEMA 3CQGB 2X0YA 1YKHB 2J4GA 2L9QA 3AA6B 3UU6A 2RA1A 3BQKA 4HTEA 3PJAJ 5DJQC 1T8BA 2YKSA 2FJAA 4IIJE 1HX8A 2XQAA 2XZ5A 3U8LA 3FHNA 4F8HA 1MNDA 5FL1A 5F5WA 2ZM2A 4IDZA 4B3MT 4PK6A 1WLXA 2CHOA 3ZJ1A 4X20E 3HKCE 2SPCA 2LOSA 3RQWA 2UXCT 2PFVA 3RYFE 1WYCA 4I0UA 1YQ4A
chains in the Genus database with same CATH topology
4NZBA 4XK9A 5FJVA 4HFEA 2XQ5A 4HFBA 2PGZA 3UU5A 3WIPA 2XQ6A 2BR8A 2LM2A 2XQ7A 3ZDGA 3RIAA 3C84A 4QABA 4QH5A 2XQ9A 3WTJA 2WNJA 5KE4A 2MAWA 2QC1B 5KZUA 3RHWA 4FRRA 3U8KA 2XQ3A 5AFKA 2BG9A 3U8MA 4ILBA 5SYOA 4DBMA 2C9TA 3U8JA 4HFCA 4ILCA 2YMDA 1OEDC 2YN6A 2YOEA 3P50A 2Y7YA 3JAEA 3TLSA 2BYNA 2XYTA 2XYSA 4ZK4A 4AFGA 5HEGA 4UM3S 3RI5A 2W8FA 2M6BA 2WN9A 4UY2A 2YMEA 3UQ7A 5J5GA 5BRXA 4QH4A 3T4MA 5IUXA 3TLVA 2M6IA 3TLTA 3C79A 2W8GA 4ZK1A 3UUBA 2Y57A 4NPPA 3EHZA 5HCMA 4QACA 4UM3P 3RQUA 3SH1A 4IL4A 3GUAA 3EI0A 2LLYA 3TLWA 4TNWA 3WTKA 4TWFA 2BG9B 3EAMA 2XQ8A 4ZZCA 2WZYA 2ZJVA 2BYPA 2WNLA 2KSRA 3PEOA 4AFHA 5AFMA 3WTHA 5JMEA 4HFDA 1OEDE 3JAFA 3UU3A 4LMJA 2BYSA 2BYRA 4UXUA 4B5DA 3SIOA 5J5HA 4ZZBA 4LMKA 4COFA 2XNTA 4ILAA 3PMZA 2XQ4A 4ZR6A 5J5IA 2Y58A 5J5FA 4UM3A 5BW2A 3UU6A 4HQPA 3UQ4A 4BFQA 5HEJA 5AFLA 4EZ1A 3TLUA 5J0ZA 4BQTA 1UV6A 2BJ0A 2BG9C 2XNUA 1I9BA 1UW6A 2YKSA 3UU4A 3LSVA 4QAAA 3WTIA 2XQAA 2XZ5A 3U8LA 5AFHA 3WTLA 3P4WA 5AFMB 4F8HA 1UX2A 3SQ9A 4TWDA 3ZDHA 3U8NA 4HFHA 1OEDA 5AINA 2XZ6A 3IGQA 4D01A 2X00D 4LMLA 4ZJTA 2XNVA 4ZJSA 5BP0A 4ALXA 4A98A 4AFTA 4Z91A 4ZRUA 5L4HA 4IREA 4Z90A 4QH1A 5L47A 2ZJUA 2LKGA 2Y56A 5L4EA 2BYQA 3JADA 4PIRA 3WTOA 4HFIA 4WV9A 2BG9E 5AFJA 2Y54A 3RIFA 4X5TA 4UM1A 5CO5A 3WTMA 5AFNA 2VL0A 3RQWA 5HEOA 2BR7A 4TWHA 5LXBA 2LKHA 5HEUA 5HEHA 2UZ6A 2PH9A 4A97A 5TVCA 3ZKRA 4TNVA 3UU8A 3SQ6A 5LG3A 1OEDB 5HCJA 2WNCA 4IL9A 2X00A 5CFBA 4XHEA 3WTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NZB A;  4XK9 A;  5FJV A;  4HFE A;  2XQ5 A;  4HFB A;  2PGZ A;  3UU5 A;  3WIP A;  2XQ6 A;  2BR8 A;  2LM2 A;  2XQ7 A;  3ZDG A;  3RIA A;  3C84 A;  4QAB A;  4QH5 A;  2XQ9 A;  3WTJ A;  2WNJ A;  5KE4 A;  2MAW A;  2QC1 B;  5KZU A;  3RHW A;  4FRR A;  3U8K A;  2XQ3 A;  5AFK A;  2BG9 A;  3U8M A;  4ILB A;  5SYO A;  4DBM A;  2C9T A;  3U8J A;  4HFC A;  4ILC A;  2YMD A;  1OED C;  2YN6 A;  2YOE A;  3P50 A;  2Y7Y A;  3JAE A;  3TLS A;  2BYN A;  2XYT A;  2XYS A;  4ZK4 A;  4AFG A;  5HEG A;  4UM3 S;  3RI5 A;  2W8F A;  2M6B A;  2WN9 A;  4UY2 A;  2YME A;  3UQ7 A;  5J5G A;  5BRX A;  4QH4 A;  3T4M A;  5IUX A;  3TLV A;  2M6I A;  3TLT A;  3C79 A;  2W8G A;  4ZK1 A;  3UUB A;  2Y57 A;  4NPP A;  3EHZ A;  5HCM A;  4QAC A;  4UM3 P;  3RQU A;  3SH1 A;  4IL4 A;  3GUA A;  3EI0 A;  2LLY A;  3TLW A;  4TNW A;  3WTK A;  4TWF A;  2BG9 B;  3EAM A;  2XQ8 A;  4ZZC A;  2WZY A;  2ZJV A;  2BYP A;  2WNL A;  2KSR A;  3PEO A;  4AFH A;  5AFM A;  3WTH A;  5JME A;  4HFD A;  1OED E;  3JAF A;  3UU3 A;  4LMJ A;  2BYS A;  2BYR A;  4UXU A;  4B5D A;  3SIO A;  5J5H A;  4ZZB A;  4LMK A;  4COF A;  2XNT A;  4ILA A;  3PMZ A;  2XQ4 A;  4ZR6 A;  5J5I A;  2Y58 A;  5J5F A;  4UM3 A;  5BW2 A;  3UU6 A;  4HQP A;  3UQ4 A;  4BFQ A;  5HEJ A;  5AFL A;  4EZ1 A;  3TLU A;  5J0Z A;  4BQT A;  1UV6 A;  2BJ0 A;  2BG9 C;  2XNU A;  1I9B A;  1UW6 A;  2YKS A;  3UU4 A;  3LSV A;  4QAA A;  3WTI A;  2XQA A;  2XZ5 A;  3U8L A;  5AFH A;  3WTL A;  3P4W A;  5AFM B;  4F8H A;  1UX2 A;  3SQ9 A;  4TWD A;  3ZDH A;  3U8N A;  4HFH A;  1OED A;  5AIN A;  2XZ6 A;  3IGQ A;  4D01 A;  2X00 D;  4LML A;  4ZJT A;  2XNV A;  4ZJS A;  5BP0 A;  4ALX A;  4A98 A;  4AFT A;  4Z91 A;  4ZRU A;  5L4H A;  4IRE A;  4Z90 A;  4QH1 A;  5L47 A;  2ZJU A;  2LKG A;  2Y56 A;  5L4E A;  2BYQ A;  3JAD A;  4PIR A;  3WTO A;  4HFI A;  4WV9 A;  2BG9 E;  5AFJ A;  2Y54 A;  3RIF A;  4X5T A;  4UM1 A;  5CO5 A;  3WTM A;  5AFN A;  2VL0 A;  3RQW A;  5HEO A;  2BR7 A;  4TWH A;  5LXB A;  2LKH A;  5HEU A;  5HEH A;  2UZ6 A;  2PH9 A;  4A97 A;  5TVC A;  3ZKR A;  4TNV A;  3UU8 A;  3SQ6 A;  5LG3 A;  1OED B;  5HCJ A;  2WNC A;  4IL9 A;  2X00 A;  5CFB A;  4XHE A;  3WTN A; 
#chains in the Genus database with same CATH topology
 4OFZ A;  2XQ5 A;  1M62 A;  3UU5 A;  4KP3 C;  2XUE A;  4DR2 T;  4QH5 A;  4P09 A;  4DID B;  5FVL A;  4ZOL E;  1IBM T;  3U8M A;  4ILB A;  2W61 A;  2UXN B;  1UX4 A;  2AXD S;  3EVY A;  1OXZ A;  3W15 B;  3ZYM A;  3OBV E;  3ANW B;  3ZMZ B;  4IL4 A;  3E08 A;  3K3Q C;  3RC3 A;  3FZF B;  2PJQ A;  4DBR A;  2XNT A;  4U2Y A;  4EEB A;  5CJ5 A;  3ETV A;  1VCS A;  2EHO D;  3R6N A;  2K3W A;  1YW0 A;  1HNW T;  2E5L T;  4YHH T;  3UFG A;  1BR0 A;  2CWY A;  3L09 A;  3NVO A;  5JR9 A;  4UV8 B;  3P4W A;  2X9X A;  1SHZ C;  3ZDH A;  2WP9 A;  3IHR A;  1UGO A;  4P0A A;  5AIN A;  2X00 D;  2WMO A;  4U72 A;  4EIW A;  3C4W A;  2JIW A;  5LJN A;  1QUU A;  4QHO A;  3NZP A;  1YQ3 A;  3RIF A;  4MBQ A;  3J7Y q;  5HEO A;  3U78 A;  3RRW A;  2X9W A;  4DV1 T;  4J2C A;  3VRA A;  5ABH A;  3VRB A;  3LG7 A;  2WZI A;  4WBN E;  2PGZ A;  4DR4 T;  3NBX X;  3AE1 A;  5LJM A;  2E9X D;  4QAB A;  2HHH T;  1U5P A;  3WTJ A;  1OWA A;  4CXX A;  2XQ3 A;  3WAJ A;  4B3S T;  1KNR A;  4DR1 T;  4V1A v;  5LB7 B;  5CGM A;  3AE7 A;  3N9N A;  4JI3 T;  4F6R C;  5J5G A;  1T72 A;  2ODU A;  3UUB A;  3HKB E;  5H6R B;  4ZXL A;  1MMA A;  5FYM A;  2D2S A;  4EZ4 A;  3CQC B;  3FZH B;  3KBU A;  3P4R A;  3Q5E A;  2C5K T;  2MOZ A;  2ODV A;  2JPF A;  2BYP A;  3AEB A;  3PUY F;  3WTH A;  3O4X E;  2BVL A;  3LBX B;  1MNE A;  4AIU A;  3F57 A;  2XAG B;  3QOF A;  5AFL A;  1XWM A;  5HXH A;  4JI1 T;  2FUP A;  4WYV A;  4TWD A;  3UUM A;  4H9S E;  2LRK A;  2CM0 A;  4LML A;  2WMN A;  4XBF B;  4QH1 A;  3A8Y C;  2VQF T;  2BKP A;  3JAD A;  3FZL B;  4PJN A;  2LOP A;  3WTM A;  2E8I A;  4KUM B;  1UUS A;  2WBL A;  1OED B;  4IL9 A;  4JI5 T;  5FL0 A;  2IDO B;  3A5X A;  3M65 A;  3ZDG A;  4WBO A;  1N34 T;  1HX1 B;  2QC1 B;  3ZSS A;  2BG9 A;  5LHH B;  4DV0 T;  4DBM A;  2CHN A;  3O9X A;  1FMW A;  2YMD A;  5AQT B;  1T98 A;  4E7Z A;  3SFE A;  5BRX A;  3TLV A;  3TLT A;  2X9H A;  2CLY C;  5AQH B;  4TV8 E;  2M67 A;  3H37 A;  3HI2 A;  2BYR A;  2V7I A;  3HR0 A;  3CML A;  3ZN0 B;  3FXD B;  3UQ4 A;  2Y48 B;  2BJ0 A;  2WDQ A;  3I1A A;  4IDP A;  5JRE A;  1BR1 A;  1D0Z A;  2CBJ A;  3ONJ A;  4I43 B;  3VKG A;  3SQ9 A;  4U33 A;  4HE8 A;  4TV9 E;  2XNV A;  4DV7 T;  1S94 A;  5L4H A;  3AE3 A;  4IRE A;  2LJL A;  4HWI B;  4X1K E;  2K5B B;  2N9D A;  3ZJ2 A;  1LVK A;  2BG9 E;  4JI8 T;  2Y54 A;  2IW5 B;  4G2A A;  2LKH A;  4U2Z A;  3PUR A;  2E5V A;  4LFB T;  2WB5 A;  3ZCI A;  2VWA A;  4XHE A;  2MYS A;  4XK9 A;  2VKH A;  1ZOY A;  5LMN T;  2BR8 A;  2W66 A;  4QKN A;  2H88 A;  3SWH A;  2Y6X A;  2F4V T;  5DQV A;  4ILC A;  3PUZ F;  2FJE A;  4JEH B;  4H9Q C;  3TLS A;  3QC9 A;  3FXE B;  4O4L E;  4HGA A;  3GN5 A;  4X1Y E;  4AFG A;  4GYR A;  3NRX A;  5AQG B;  3UUL A;  4ZS2 A;  5LHG B;  2C5I T;  4PJJ A;  1NEK A;  4FI5 A;  4B6X A;  5JQG E;  2ACX A;  3WTK A;  3EDU A;  4IT4 A;  1IBL T;  3X1D A;  2Q9Q C;  2WAU A;  3UUN A;  2V26 A;  1HF8 A;  2XM2 A;  2UXB T;  5FP3 A;  2N1G A;  5LYJ E;  2XSB A;  5LGT B;  1KNZ A;  2X51 A;  4C91 A;  2L3L A;  4HEA A;  2J1D G;  3SS1 A;  3ZMV B;  3WTL A;  2LSY A;  2LHN A;  1D1A A;  1T7S A;  3U8N A;  4ILU A;  4DVD A;  3RYH E;  4GKJ T;  2XAS B;  3FB2 A;  2XZ6 A;  3PUW F;  4JEU B;  4OYK A;  3AE4 A;  2Y56 A;  3ZMT B;  2BYQ A;  1NEN A;  4LF4 T;  3WTO A;  4JI2 T;  5JR9 B;  1IZN B;  3AVR A;  5J2T E;  1IJ5 A;  3VR9 A;  3ZPO A;  2VKD A;  4CI3 B;  1WFD A;  2WY2 A;  5LGU B;  1ZV4 X;  1VRB A;  2VB6 A;  3BQI A;  2OV9 A;  5AQR B;  3RH3 A;  3P4Q A;  4H9P C;  4QX8 B;  2MAW A;  4DBQ A;  2YDQ A;  3G06 A;  3KVB A;  4EB6 E;  2PG8 A;  1XZY A;  2XYT A;  4GYS A;  5LG4 A;  1JNZ A;  3I9Y A;  3Q5W A;  4QXH B;  4NUV A;  3RQU A;  3CQX C;  1L0V A;  2V6Y A;  3AEG A;  3ZT7 A;  5HYA A;  2J62 A;  5J5H A;  4UXU A;  3SFD A;  4COF A;  2JQ9 A;  2NWB A;  1D1C A;  4EYY R;  2HH7 A;  3Q5X A;  2KZ7 B;  4DV4 T;  2A3D A;  3AA1 B;  5HEJ A;  2JQH A;  4EZ1 A;  4EOZ B;  4BQT A;  2DL1 A;  5ABE A;  5F8P A;  1E2A A;  3NRY A;  1I9B A;  2IC6 A;  1WR0 A;  2KMF A;  3ZMU B;  1UX2 A;  2K24 A;  2PTF A;  5AQP B;  1O3X A;  5FXW A;  3RGL A;  4ZJT A;  3VR8 A;  4O2A E;  4Z90 A;  3N9O A;  5FMN A;  3KV5 A;  2Y8D A;  4TWH A;  4ANJ A;  3QK6 A;  5HEU A;  4ZI3 D;  1LVF A;  2PH9 A;  2YK0 A;  2I59 A;  1X9B A;  2NW8 A;  3CPZ A;  3RRC A;  4MFR A;  3VKH A;  3F31 A;  3CK6 A;  3RIA A;  4Z8X A;  3ZLI A;  2XQ9 A;  2GK9 A;  3ESL A;  2WNJ A;  3U8K A;  5HXR A;  3PUG A;  2MBG A;  4NUU A;  4TZ4 C;  4KHP T;  5E0O A;  4ZK4 A;  2IAK A;  2M6B A;  2ZLY A;  4IHJ E;  4NPP A;  4QAC A;  4P0B A;  1D0X A;  3SH1 A;  3EI0 A;  4H9N C;  2DNX A;  2A9U A;  4MHC A;  2BG9 B;  4AI6 A;  2WZY A;  4TN7 B;  2ZM8 A;  1N33 T;  3JAF A;  3SIO A;  5JDQ A;  2A2F X;  4LMK A;  2JQK A;  3PMZ A;  4ZI7 E;  4IE4 A;  5JRC A;  1HTJ F;  4EED A;  3N2K E;  5FY7 A;  3OVU A;  3E0Z A;  3DP7 A;  3JC6 D;  3HKD E;  1D0Y A;  1UUR A;  3RYI E;  2BVM A;  3LSV A;  5ADX L;  1I6Z A;  1HCI A;  3WTI A;  4JYA T;  2V7L A;  2AE9 A;  3EDV A;  3AXJ B;  2HN2 A;  4WZX A;  3C4X A;  4ZJS A;  3AED A;  4U7I A;  2J47 A;  4AQY T;  2XAH B;  3T8O A;  2BKN A;  1W0A A;  2LSG A;  5LXB A;  2PBI A;  1FMV A;  2UZ6 A;  5HCJ A;  2WNC A;  2BKO A;  3ABV A;  4DMW A;  2XHE B;  4PNI A;  4X62 T;  5CA1 E;  4DV3 T;  3LJC A;  5HXE A;  2Z6E A;  3ETU A;  3AE5 A;  4GKK T;  2EHO C;  3AE8 A;  4IDN A;  2CWO A;  2NTY A;  4HWC A;  2W8F A;  5ETW A;  5AQK B;  1Z8U A;  4AQG A;  1WCR A;  4GK0 E;  4A5X A;  4QX7 B;  2WQY A;  3EAM A;  3MKD A;  3WI3 A;  4UEL A;  1CUN A;  3GN5 B;  2VKJ A;  5LOV E;  4LFA T;  2JMK A;  4OYJ A;  3N9M A;  3AVS A;  4O4H E;  1NAF A;  2D0U A;  4X65 T;  4AKG A;  3E22 E;  2UUA T;  5BP0 A;  1UX5 A;  2NTX A;  4ASK A;  2E9X C;  1BR2 A;  2LKG A;  2V1D B;  3BQL A;  5LCY A;  3PUA A;  3SOL A;  1GQE A;  3ZYK A;  5L3D B;  5AFN A;  2VL0 A;  3CWZ B;  4KMC A;  1LKX A;  4EGW A;  2NW9 A;  2WM9 A;  4JI4 T;  2Q9Q A;  4UVC B;  4NIQ A;  1MMG A;  3VU7 H;  2IIU A;  1HR0 T;  5H6Q B;  4E7S A;  4HN9 A;  5CA0 E;  3PU8 A;  2QGS A;  1Y64 B;  2LT3 A;  3KIN B;  5BMV E;  2R6G F;  5AQJ B;  5L3E B;  2Y7Y A;  2IUB A;  2CRB A;  4UM3 S;  4I50 E;  3CX7 B;  3LFM A;  5FXV A;  1VOM A;  3H3A A;  2P9B A;  3K3N A;  1XNQ T;  1FJG T;  4IE0 A;  1KF6 A;  4ZEY A;  3P4P A;  4LMJ A;  4YTN A;  1XMQ T;  2OLT A;  5IWA T;  3TLU A;  1IJ6 A;  3BK9 A;  3CKD A;  5EZY E;  3C50 A;  2V6Y B;  2WS3 A;  1FEW A;  3RX6 A;  2CXD A;  5KMG P;  4HFH A;  2WDV A;  2UXX B;  1N32 T;  4P1N A;  4ALX A;  4A98 A;  2CCQ A;  3O1J A;  3Q2M A;  2V6X A;  4L5G A;  3C51 A;  3JCF A;  5L47 A;  2ZJU A;  4BA9 A;  3F2E A;  1MMN A;  2UUB T;  2C5J A;  4JBW F;  5CB4 E;  4A97 A;  4OK0 A;  4CN1 A;  5TAO A;  5CFB A;  3M3Z B;  4TX5 A;  1HS7 A;  3WIP A;  4DUY T;  2XQ7 A;  3QB5 A;  2XAJ B;  3ONL C;  4JI0 T;  1KNP A;  4H63 V;  3RHW A;  2X0H A;  1H7C A;  3KDS E;  2CMR A;  4PK4 A;  4OX9 T;  5F3J A;  2DWG A;  3ZC1 A;  3CIR A;  4XAX B;  4K0K T;  2VAS A;  2W8G A;  3O1I A;  1ZKE A;  5DAB A;  4IGU A;  5J2U E;  4AKH A;  4ADZ A;  2X0L B;  3NWI A;  3ZMS B;  4HFD A;  5JME A;  1MIV A;  2BDE A;  2BYS A;  2H7V C;  4UF0 A;  4AQF C;  3EUH A;  3NKZ A;  1SA0 E;  3S4U A;  1QSD A;  1HG5 A;  3GA8 A;  2W0G A;  4IE6 A;  2UUC T;  2XNU A;  1CHU A;  4QAA A;  2FBW A;  2NW7 A;  2IC9 A;  3AEF A;  5JRC B;  4JI7 T;  2X66 A;  2YDR A;  3HL6 A;  3P8C D;  4LF7 T;  4O4J E;  2B1E A;  4L9I A;  1MMD A;  3AA0 B;  4DV6 T;  4WV9 A;  5AQF B;  3KV9 A;  3ZEF B;  4I4T E;  5FXX A;  4HKA A;  1UK5 A;  4YJ2 E;  4AKI A;  3RIU C;  5FJV A;  2KND A;  4DMV A;  4IST A;  4NXM T;  3OYZ A;  5M4Y A;  4ERR A;  5AQL B;  2CLY B;  5FY0 A;  4JI6 T;  2BS4 A;  3KV6 A;  4BAY B;  5EK2 A;  2C9T A;  2JRK A;  5JDN A;  4ZI2 D;  2L8K A;  2YME A;  3C79 A;  3OYX A;  2VVS A;  3ZC0 A;  4DO0 A;  5JDL A;  4TNW A;  2WU5 A;  2BBH A;  5L3B B;  2VUR A;  4N78 D;  4AFH A;  5DQW A;  2X9Y A;  5AQV B;  2BZB A;  4ILA A;  2W63 A;  3K1S A;  2Y58 A;  2CXL A;  5JDM A;  3QUJ A;  1WRD A;  2ZM6 T;  4JV5 T;  5HAX A;  3AAI A;  3LK2 B;  5FVK A;  4KX6 A;  2RP4 A;  2H3R A;  4O2B E;  4CN4 A;  4H63 H;  3OPC A;  2EHO A;  3IBP A;  5KDM C;  2CE7 A;  5AQN B;  3PE0 A;  5C8Y E;  3TKL B;  4YTM A;  4YT0 A;  5HXC A;  4X5T A;  4MLK A;  4M1P A;  3FBZ A;  2H7O A;  2FJD A;  2D5U A;  4EAH A;  2X00 A;  4PK5 A;  4IDQ A;  3WTN A;  4EXT A;  2UU9 T;  2LM2 A;  3AE6 A;  2HPL A;  1YD8 G;  5KE4 A;  4X64 T;  4XZC A;  2LM9 A;  2I0M A;  3U8J A;  4UVA B;  2LHR A;  3C64 A;  1Z0P A;  4AIS A;  1EZ3 A;  3UTK A;  2QYW A;  3N9Q A;  3ZN1 B;  3PU3 A;  4WNK A;  2E9X A;  4FJO A;  1XDP A;  2C0S A;  3KBT A;  3TLW A;  2XZE A;  3R84 B;  5A1L A;  5AFM A;  5AQI B;  2DHR A;  4ZR6 A;  3P7I A;  1X79 A;  3IA3 A;  4X1I E;  5BW2 A;  3LK4 2;  2CPT A;  3MA9 A;  4KI0 F;  4UV9 B;  1S35 A;  4ZI3 C;  3FZK B;  4U31 A;  5AQU B;  3ZYL A;  4DUZ T;  5AQO B;  3B5M A;  3MXZ A;  5AFH A;  2VVN A;  3L39 A;  4I55 E;  5HXS A;  5C3J A;  5L3G B;  4GOU A;  4U3C A;  2H89 A;  4H9O C;  3VHL A;  4AFT A;  4Z91 A;  3I0O A;  2DLR A;  4PIR A;  2CA5 A;  3P4S A;  5LA6 E;  5CO5 A;  2XJ7 A;  2YIN A;  2KT9 A;  2QA7 A;  5LBQ B;  3RKG A;  5HEH A;  3OJA A;  3LDQ B;  4CXY A;  3UUX B;  4H9R C;  3C84 A;  3K8P C;  3PV0 F;  5KZU A;  2X67 A;  4YFS A;  2UXD T;  3RLF F;  2XSA A;  3D0T A;  1E1H B;  1OED C;  3N2G E;  5HEG A;  4UY2 A;  3JC6 C;  5LMU T;  4ZK1 A;  2LE8 A;  5FKY A;  2LRL A;  3U3I A;  3V5S A;  3FBL A;  4IDO A;  3GWH A;  2DI4 A;  2KWH A;  1B7T A;  1YXR A;  3I9W A;  3UT5 E;  2JJ9 A;  1U4Q A;  1DU2 A;  2KSR A;  3DTO A;  1SUM B;  1BR4 A;  3C98 B;  2JMH A;  4ZZB A;  4LF5 T;  3CX8 B;  3AAA B;  5J5I A;  3L3P A;  1IAP A;  3AA7 B;  3QNU A;  2QRX A;  5J0Z A;  4B3R T;  4YLH A;  2HPJ A;  3UU4 A;  3V5U A;  2XM1 A;  1AJ3 A;  2VL8 A;  4JUY A;  2IML A;  2XAQ B;  3AE9 A;  2WDR A;  3PUQ A;  4UF0 B;  4D01 A;  4GK5 E;  2A72 A;  1W09 A;  4EYU A;  1HNZ T;  5JDG A;  2V7J A;  5L4E A;  4WW0 A;  1KEY A;  4AKR B;  1W0B A;  1I94 T;  4A56 A;  4PJM A;  5C2T A;  2NOX A;  5AFU L;  4TNV A;  4HWD A;  4TUY E;  5EK4 A;  5JDH A;  5ABF A;  2V5C A;  4CN6 A;  2N2N A;  4AQF A;  1HFA A;  2MPK A;  4HWF A;  2XAF B;  4PFO A;  3AEE A;  4DR7 T;  1VCT A;  2NP9 A;  2YDS A;  4QWN B;  3HKE E;  4FRR A;  5AFK A;  4Q25 A;  4QXC B;  1UCU A;  1NWM X;  3MK7 C;  2YN6 A;  4EV6 A;  1XDO A;  4QXB B;  1V9D A;  4YSY A;  3T4M A;  3PJA A;  5AQQ B;  5LXT E;  2V7M A;  2KXP B;  3OTO T;  1MIW A;  3GUA A;  4CI1 B;  1M7K A;  1J5E T;  4O4I E;  2ZJV A;  1ZHC A;  3PUX F;  3RYC E;  5KX5 E;  2ZMA A;  2XQ4 A;  3ZCJ A;  1US7 B;  3QB5 K;  5J5F A;  3RIU A;  3T1H T;  1J1J A;  3MAC A;  4ZS3 A;  4IE7 A;  4BFQ A;  4L0R A;  5FY1 A;  3ZT5 A;  1UV6 A;  3K3O A;  5FNV E;  4LF9 T;  4HFV A;  2W62 A;  5HWX A;  2BS2 A;  2VQE T;  3Q9D A;  3AEA A;  4ZHQ E;  1JNR A;  2DCF A;  4YSZ A;  4DR6 T;  4UR9 A;  1HNX T;  3RF1 A;  2WSS V;  2B76 A;  5LP6 E;  4C90 A;  4HFI A;  2MTQ A;  4UXN B;  3HA4 A;  2LSJ A;  4UVB B;  1D1B A;  3O1H A;  2YEV C;  4UIG A;  2OA5 A;  4CQI A;  2JQQ A;  1R8I A;  5GON E;  2EHO B;  5EK3 A;  5IHY A;  3UFE A;  5L2L A;  3GMI A;  4HFB A;  1XNR T;  3KFW X;  1HG2 A;  1Y01 A;  3ANW A;  5JR9 C;  5J1G A;  2X68 A;  2V8S V;  1KFY A;  4K0U A;  3NZQ A;  4EZH A;  3PUS A;  3RPU A;  3IF8 B;  2WU2 A;  4HFC A;  5KXJ A;  2E2A A;  2WWV A;  3AXJ A;  2YOE A;  3KV4 A;  2BYN A;  3RI5 A;  3I0Q A;  2WN9 A;  3UQ7 A;  3OKQ A;  2LEH A;  5IUX A;  2M6I A;  4ISS A;  2CXF A;  2FJB A;  5HCM A;  5HWY A;  4PJL A;  4YY3 T;  2LLY A;  2WCA A;  3AE2 A;  4LFC T;  2XQ8 A;  5JDF A;  2XQY A;  2WNL A;  3C4Z A;  3T1Y T;  3KVA A;  3A7M A;  2K48 A;  3PDY A;  4DV2 T;  1KK7 A;  2KWI B;  2E9X B;  1WR6 A;  2G0U A;  1G8X A;  2V7K A;  2V5D A;  1J5W A;  5AFM B;  4GIW A;  3J9X 1;  2Q9Q D;  3IGQ A;  2DWK A;  5AQM B;  3MJX A;  2W2U A;  3RKO A;  2QVA A;  1QLB A;  3N2O A;  3SRZ A;  2ES0 A;  4DND A;  2IHR 1;  4CI2 B;  2D0T A;  2XPK A;  3N9L A;  4UM1 A;  2W67 A;  2BR7 A;  5TVC A;  3SQ6 A;  3IEE A;  4AXP A;  3H3M A;  4KHZ F;  4NZB A;  4DV5 T;  2XQ6 A;  4YTP A;  2VKO A;  1MIY A;  2WZH A;  4KBM B;  4U74 A;  3Q5D A;  2CBI A;  4CZZ B;  3FZM B;  4X66 T;  3PTR B;  3N5L A;  3JAE A;  4U7Y A;  3ZST A;  4PFP A;  3LBX A;  3MZK B;  4AKL A;  4IE5 A;  3N9P A;  4QH4 A;  3L8R A;  3EHZ A;  4YJ3 E;  4BJN A;  1SE7 A;  4BJM A;  2BS3 A;  4O8S A;  4TWF A;  4ZZC A;  1E7P A;  4LF8 T;  3ONX A;  3PEO A;  1ZEE A;  1FIO A;  2KIN B;  3RC8 A;  4DR3 T;  1G73 A;  2W00 A;  1ZP0 A;  3B57 A;  4UM3 A;  3PUV F;  2CEA A;  4HQP A;  4B3T T;  2D9D A;  3WAK A;  2BG9 C;  4YHJ A;  1UW6 A;  5AQS B;  5BR8 T;  1XMO T;  3CX6 B;  4G63 A;  1OED A;  3LK3 B;  2BBJ A;  1N36 T;  5LNK A;  2K9A A;  1WYB A;  3AAE B;  4ZRU A;  2LSI A;  4MAL A;  2YU2 A;  2I6H A;  4HWH A;  2LSK A;  5AFJ A;  5L3F B;  4ZI2 C;  5IYZ E;  2ACZ A;  3UU8 A;  3ZKR A;  5JH7 E;  2WWU A;  5LG3 A;  2RPA A;  5JTG A;  4HFE A;  4YXD A;  4CXW A;  2NR4 A;  4JLE A;  5LGN B;  1LRZ A;  2VK9 A;  3AEC A;  4OHF A;  5LBM A;  5FXZ A;  4NXN T;  5SYO A;  2ZM0 A;  3B13 A;  5L3C B;  1IBK T;  1YKE B;  3P50 A;  2XYS A;  2XTL A;  4YSX A;  2KLQ A;  5ABF B;  3EAB A;  4PAG A;  3CVR A;  2Y57 A;  4UM3 P;  2W4X A;  2HN1 A;  3AB3 B;  2XY8 B;  1W9R A;  2YU1 A;  4PW8 A;  3DJB A;  5LHI B;  4DR5 T;  5JVD E;  1OED E;  3UU3 A;  4B5D A;  5ABG A;  4LF6 T;  3ZT6 A;  2Q9Q B;  4UEM A;  3CQG B;  2X0Y A;  1YKH B;  2J4G A;  2L9Q A;  3AA6 B;  3UU6 A;  2RA1 A;  3BQK A;  4HTE A;  3PJA J;  5DJQ C;  1T8B A;  2YKS A;  2FJA A;  4IIJ E;  1HX8 A;  2XQA A;  2XZ5 A;  3U8L A;  3FHN A;  4F8H A;  1MND A;  5FL1 A;  5F5W A;  2ZM2 A;  4IDZ A;  4B3M T;  4PK6 A;  1WLX A;  2CHO A;  3ZJ1 A;  4X20 E;  3HKC E;  2SPC A;  2LOS A;  3RQW A;  2UXC T;  2PFV A;  3RYF E;  1WYC A;  4I0U A;  1YQ4 A; 
#chains in the Genus database with same CATH homology
 4NZB A;  4XK9 A;  5FJV A;  4HFE A;  2XQ5 A;  4HFB A;  2PGZ A;  3UU5 A;  3WIP A;  2XQ6 A;  2BR8 A;  2LM2 A;  2XQ7 A;  3ZDG A;  3RIA A;  3C84 A;  4QAB A;  4QH5 A;  2XQ9 A;  3WTJ A;  2WNJ A;  5KE4 A;  2MAW A;  2QC1 B;  5KZU A;  3RHW A;  4FRR A;  3U8K A;  2XQ3 A;  5AFK A;  2BG9 A;  3U8M A;  4ILB A;  5SYO A;  4DBM A;  2C9T A;  3U8J A;  4HFC A;  4ILC A;  2YMD A;  1OED C;  2YN6 A;  2YOE A;  3P50 A;  2Y7Y A;  3JAE A;  3TLS A;  2BYN A;  2XYT A;  2XYS A;  4ZK4 A;  4AFG A;  5HEG A;  4UM3 S;  3RI5 A;  2W8F A;  2M6B A;  2WN9 A;  4UY2 A;  2YME A;  3UQ7 A;  5J5G A;  5BRX A;  4QH4 A;  3T4M A;  5IUX A;  3TLV A;  2M6I A;  3TLT A;  3C79 A;  2W8G A;  4ZK1 A;  3UUB A;  2Y57 A;  4NPP A;  3EHZ A;  5HCM A;  4QAC A;  4UM3 P;  3RQU A;  3SH1 A;  4IL4 A;  3GUA A;  3EI0 A;  2LLY A;  3TLW A;  4TNW A;  3WTK A;  4TWF A;  2BG9 B;  3EAM A;  2XQ8 A;  4ZZC A;  2WZY A;  2ZJV A;  2BYP A;  2WNL A;  2KSR A;  3PEO A;  4AFH A;  5AFM A;  3WTH A;  5JME A;  4HFD A;  1OED E;  3JAF A;  3UU3 A;  4LMJ A;  2BYS A;  2BYR A;  4UXU A;  4B5D A;  3SIO A;  5J5H A;  4ZZB A;  4LMK A;  4COF A;  2XNT A;  4ILA A;  3PMZ A;  2XQ4 A;  4ZR6 A;  5J5I A;  2Y58 A;  5J5F A;  4UM3 A;  5BW2 A;  3UU6 A;  4HQP A;  3UQ4 A;  4BFQ A;  5HEJ A;  5AFL A;  4EZ1 A;  3TLU A;  5J0Z A;  4BQT A;  1UV6 A;  2BJ0 A;  2BG9 C;  2XNU A;  1I9B A;  1UW6 A;  2YKS A;  3UU4 A;  3LSV A;  4QAA A;  3WTI A;  2XQA A;  2XZ5 A;  3U8L A;  5AFH A;  3WTL A;  3P4W A;  5AFM B;  4F8H A;  1UX2 A;  3SQ9 A;  4TWD A;  3ZDH A;  3U8N A;  4HFH A;  1OED A;  5AIN A;  2XZ6 A;  3IGQ A;  4D01 A;  2X00 D;  4LML A;  4ZJT A;  2XNV A;  4ZJS A;  5BP0 A;  4ALX A;  4A98 A;  4AFT A;  4Z91 A;  4ZRU A;  5L4H A;  4IRE A;  4Z90 A;  4QH1 A;  5L47 A;  2ZJU A;  2LKG A;  2Y56 A;  5L4E A;  2BYQ A;  3JAD A;  4PIR A;  3WTO A;  4HFI A;  4WV9 A;  2BG9 E;  5AFJ A;  2Y54 A;  3RIF A;  4X5T A;  4UM1 A;  5CO5 A;  3WTM A;  5AFN A;  2VL0 A;  3RQW A;  5HEO A;  2BR7 A;  4TWH A;  5LXB A;  2LKH A;  5HEU A;  5HEH A;  2UZ6 A;  2PH9 A;  4A97 A;  5TVC A;  3ZKR A;  4TNV A;  3UU8 A;  3SQ6 A;  5LG3 A;  1OED B;  5HCJ A;  2WNC A;  4IL9 A;  2X00 A;  5CFB A;  4XHE A;  3WTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...