4HFCA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to 2-bromo-ethanol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfcA01
2WNJA 3GUAA 3RQWA 2YMDA 4B5DA 5LXBA 4AFGA 4DBMA 4NPPA 5AFKA 2XQ7A 2YKSA 2LM2A 2XYTA 2XYSA 3UU4A 4IL4A 2UZ6A 4ZJSA 2BG9C 4ZZBA 2XNVA 2Y58A 5AFJA 4Z91A 3UU6A 4HFCA 2WZYA 4HFDA 3SQ6A 4UY2A 3WTJA 3UQ4A 3U8KA 5JMEA 3PMZA 3JAFA 2M6IA 2WNLA 4NZBA 5KE4A 5L4HA 4ILAA 4XK9A 5BRXA 5J5HA 4TWHA 2PH9A 2BG9B 5FJVA 3WTHA 2Y7YA 2M6BA 2Y57A 2XQ3A 4HFEA 3TLUA 4HFHA 5J5GA 5AFLA 4ZRUA 5CO5A 3EI0A 3TLWA 4IREA 2BYNA 3TLSA 3ZDHA 3EAMA 2XZ5A 3U8JA 5AFMA 2BG9E 2Y56A 3SQ9A 5AFHA 4LMJA 4Z90A 3UU3A 5BW2A 2BYQA 4QABA 4UXUA 3ZDGA 5CFBA 2XNUA 4PIRA 5J5FA 3UU8A 3SH1A 3U8NA 2XZ6A 3WIPA 4A98A 3JAEA 2XNTA 2XQ4A 3UU5A 3U8LA 5HEOA 4COFA 1OEDA 3C79A 2XQ5A 2W8GA 3ZKRA 5L4EA 1UW6A 4WV9A 4ZJTA 2W8FA 4TWFA 2YMEA 4FRRA 5TVCA 4QH5A 4LMKA 2YOEA 4TNWA 3WTIA 3WTMA 3EHZA 3JADA 4F8HA 4AFTA 4ILBA 2MAWA 4ALXA 5AFMB 3T4MA 5L47A 2XQ9A 2QC1B 4QH4A 3RIFA 4ZR6A 3LSVA 3WTNA 1OEDC 4TNVA 4UM1A 5KZUA 4ZZCA 4ZK4A 4BFQA 5HCMA 3IGQA 2BYPA 5AFNA 2LKHA 5HEJA 3WTLA 4HFIA 5BP0A 3RQUA 4UM3P 3RHWA 4IL9A 2Y54A 2LKGA 4QAAA 2LLYA 2KSRA 4X5TA 5HCJA 5IUXA 5J0ZA 2WN9A 5AINA 4UM3S 3TLTA 4ZK1A 4QH1A 2XQAA 5HEHA 5HEGA 3UQ7A 4HQPA 4A97A 3RI5A 3UUBA 1I9BA 2VL0A 5HEUA 3WTOA 3RIAA 2X00A 2BR7A 5SYOA 2PGZA 3WTKA 1UX2A 2BYSA 4HFBA 1OEDE 3C84A 4AFHA 2BJ0A 2ZJVA 3TLVA 2C9TA 2XQ6A 4ILCA 2WNCA 5J5IA 2BG9A 1UV6A 3PEOA 3P50A 2X00D 2ZJUA 5LG3A 2XQ8A 4EZ1A 3SIOA 3P4WA 4XHEA 4BQTA 4LMLA 4TWDA 2BR8A 2YN6A 1OEDB 2BYRA 4UM3A 3U8MA 4D01A 4QACA
chains in the Genus database with same CATH superfamily
2YEVC 5LG4A 2BS3A 4UVBB 5LXBA 5JDFA 4DBMA 5AQUB 4LF8T 2LM2A 1BR2A 3OVUA 2DHRA 4HFDA 2G0UA 4FI5A 3J9X1 1L0VA 5CB4E 2DWGA 2WDRA 1WRDA 3EI0A 3IHRA 4Z8XA 4IREA 2KT9A 4GK5E 2V26A 3WI3A 5CA0E 2BYQA 2HN1A 4UF0A 4HGAA 2W61A 4E7ZA 5LA6E 4MHCA 3C79A 3ZKRA 4WV9A 3ONJA 3I9WA 4YXDA 2EHOC 5FY1A 2V6YA 4HTEA 1KEYA 4O2BE 1XNQT 1T98A 2V1DB 3ZT7A 4I4TE 2E9XC 5ETWA 2N2NA 3MK7C 2VL8A 4KP3C 3N9PA 4AI6A 5FMNA 3LJCA 2UUAT 5C3JA 1U4QA 5C8YE 1UK5A 4UR9A 5HXRA 2RP4A 3ETVA 3RIAA 3SRZA 2V6YB 2LOSA 4CQIA 5JQGE 1O3XA 2XM2A 4CN6A 2C9TA 2VK9A 3KBTA 1FEWA 4I0UA 3RYCE 3C4XA 4LMLA 2YK0A 3AA1B 2V7IA 4LF5T 2JQKA 4EZHA 1G73A 1N32T 2JPFA 5DQVA 4TUYE 4PK5A 2Z6EA 4CI2B 3ZT5A 3QK6A 4UIGA 3KV6A 5AQMB 4EEDA 5CJ5A 4LF7T 3A8YC 3VU7H 1US7B 3ANWA 2ZM6T 2XUEA 3AVSA 2XNUA 1ZOYA 1ZKEA 2KMFA 4A98A 3RYFE 4ZXLA 3QC9A 2CBJA 2XQ5A 2EHOD 4ZJTA 2P9BA 5CA1E 4O4JE 1XNRT 3KDSE 3OBVE 3IEEA 3WTIA 4ZS2A 2IW5B 2FJDA 3UFGA 2K5BB 3OJAA 4GYRA 2E9XD 3ANWB 2QYWA 2K48A 4O4HE 2WZIA 4EAHA 3ZYMA 2WDQA 2W63A 4L9IA 5BP0A 3RHWA 3AEFA 4X5TA 5E0OA 3P4PA 4MALA 2MTQA 2W67A 4PK6A 4YTPA 3WTKA 3VRBA 2K24A 3PTRB 1HX1B 3PUVF 4TWDA 5FNVE 3DTOA 4B5DA 1KNZA 1MNEA 3M3ZB 3PUSA 4AQYT 3UT5E 1D1CA 5L3CB 3RC3A 3JCFA 3PMZA 5L4HA 2XTLA 3NRYA 1KK7A 3KVAA 2D0TA 2WCAA 2UXDT 2AE9A 4HFHA 3E22E 2YINA 3V5UA 4HN9A 1KNPA 4JBWF 3AA0B 5J5FA 2CLYB 3VRAA 3U8LA 5HWXA 1V9DA 2YMEA 4EEBA 3K3NA 1HNZT 1SHZC 4P09A 2WS3A 1IAPA 2E5LT 2LSGA 1YXRA 4BJMA 3AXJB 2VKDA 2MAWA 2X66A 5L47A 3NZQA 3EUHA 2R6GF 3KVBA 1XWMA 3PUYF 2D9DA 2JIWA 4U7IA 2JQHA 4DR5T 1FJGT 2WN9A 3DP7A 2CPTA 4H63H 5HEHA 3N9LA 1KNRA 3N2GE 5AQGB 2VL0A 4B3ST 1IZNB 4MBQA 5JR9A 4AKRB 3PEOA 2C0SA 4ZOLE 4UM3A 2XAHB 2NP9A 3I0OA 1WR0A 2OLTA 3AE6A 4IL4A 2F4VT 4ZS3A 5JMEA 3LK2B 4B3MT 1HS7A 4EIWA 2YU2A 4QKNA 3WTHA 5LXTE 1X9BA 3RLFF 5F5WA 5J5GA 4ZRUA 3CMLA 4HEAA 5CO5A 2WBLA 3CQXC 1WCRA 3NRXA 2PBIA 3GA8A 5L3FB 2Y56A 3SQ9A 5FVLA 3N2KE 2FBWA 5FXZA 1G8XA 2DL1A 2V7JA 5CFBA 4IDOA 5KXJA 3O1IA 3C4WA 5LBMA 1N36T 3N5LA 5HXCA 2NTXA 4QH5A 1NEKA 1MNDA 3CK6A 5FYMA 5JDHA 4HFVA 3C64A 2BVLA 4WW0A 3CQCB 3Q5XA 1BR0A 3RPUA 1NWMX 5L3BB 4UM3P 4PJNA 2W00A 4IL9A 5IWAT 4CXXA 4Q25A 2ZMAA 3TLTA 1HG2A 2X67A 5FY0A 4JEHB 2I6HA 3TLVA 2X00D 4X20E 2LRLA 4KUMB 2Y8DA 4HWFA 5FP3A 2OA5A 4XAXB 3F2EA 1ZHCA 4UV8B 3B13A 3HKEE 3H37A 3UU4A 5L2LA 3BQIA 2QRXA 3UU6A 2BVMA 5KE4A 3U8KA 2M6IA 5IHYA 3WAKA 4BJNA 5BRXA 1Y64B 2L8KA 1YQ4A 2GK9A 3Q5DA 4HFEA 2JQQA 5AFLA 3NWIA 2IUBA 1LVFA 3KV4A 2WWUA 3PJAA 3PUXF 4PFPA 4F6RC 4GYSA 2XZ6A 5F8PA 1SUMB 5HEOA 4EYUA 4AISA 2D5UA 4X66T 3C50A 2Q9QC 3JADA 1FMVA 2V7KA 4PAGA 4OFZA 2CXLA 3N9NA 3O4XE 3S4UA 1GQEA 5HCMA 4IDZA 3HL6A 4GOUA 4IDQA 2ZLYA 3EDVA 2H89A 5J0ZA 3H3MA 1WFDA 3CX8B 4J2CA 1I9BA 4QXBB 2BR7A 2PTFA 2W2UA 1UX2A 2KLQA 4AFHA 4YY3T 3ZYLA 2ZJVA 4DBQA 2BG9A 4KHZF 4CN4A 3ETUA 1E1HB 3VHLA 3WAJA 1FIOA 4U31A 2WAUA 3N9QA 2HH7A 4X1IE 4DV2T 3GWHA 4DBRA 4UV9B 3RX6A 2YMDA 4AFGA 4NPPA 2W4XA 4P0BA 2A72A 4JI8T 4UY2A 2XZEA 3UUXB 4JUYA 2BG9B 4EV6A 4XBFB 2BKOA 3ZMUB 3RIUC 1W0BA 2XHEB 1SE7A 3A7MA 5JH7E 2NW8A 3U8JA 1IJ6A 2C5IT 3ZYKA 3J7Yq 3PV0F 3ZDGA 1J5ET 3OTOT 4BAYB 2W66A 3JAEA 2XQ4A 3E08A 5AFUL 4LFAT 2Q9QD 5J1GA 1UW6A 3P7IA 2C5JA 4H9RC 2JMKA 5C2TA 3OYXA 4E7SA 4OHFA 3QNUA 2HN2A 2UXBT 4AKIA 3F31A 2QC1B 5LCYA 4X1YE 4LFBT 2LKHA 1HNXT 4YHHT 4O4LE 3SWHA 4GIWA 2CXFA 5ABEA 2IC6A 4QH1A 5HEGA 3BQLA 3G06A 3OKQA 3JC6C 2VKJA 3CKDA 4ZI3C 5ADXL 2DCFA 3EVYA 1VRBA 4H9PC 4PK4A 4UF0B 3ZC1A 3X1DA 4CI3B 2CRBA 2YDRA 3Q5EA 4DUZT 5M4YA 5AQHB 4P0AA 4U2YA 1E2AA 5JDNA 5EK2A 3RQWA 2XYSA 4UVAB 4ZZBA 2XNVA 3WTJA 4V1Av 1UUSA 3ZJ2A 3MACA 2KINB 1VCTA 2Y6XA 4ISSA 1QSDA 5AQSB 5BR8T 4DV0T 3K1SA 2IMLA 2YDQA 2N1GA 4ADZA 2DLRA 2QVAA 3EAMA 4JYAT 1BR4A 2CCQA 3FBZA 3ZN1B 1UX4A 1KFYA 3U8NA 5AQFB 1FMWA 4AQFC 1J1JA 2WP9A 4UXNB 5JVDE 2J4GA 1NENA 3BQKA 4LMKA 4YSYA 3CX6B 2HPJA 5FXWA 1UGOA 4QXHB 4NUUA 1UCUA 2ODUA 4NUVA 3AAEB 2VASA 4DV6T 5HEJA 5H6RB 3JC6D 1YQ3A 2KSRA 5IUXA 4ZI3D 3AB3B 4UELA 2ACZA 2DNXA 3I0QA 4AQGA 1YKEB 3LK3B 2IDOB 2KWHA 3N9MA 2LEHA 1ZP0A 3CQGB 2A3DA 4C90A 1BR1A 1W09A 1R8IA 4ZHQE 2WNJA 3NBXX 2IHR1 3AAIA 4JI6T 4KMCA 2UZ6A 5JRCA 1UURA 1D1AA 5HYAA 3FXEB 3EABA 3SFDA 4CZZB 5TAOA 2WY2A 3VKHA 1T72A 5ABFA 3ZDHA 1ZV4X 2XZ5A 3O9XA 4DO0A 3RKGA 2J1DG 3MA9A 4PJJA 4PIRA 3LDQB 2XNTA 2SPCA 1OEDA 4NXMT 3L3PA 4YTMA 2E8IA 3O1HA 3I1AA 1WYBA 4U7YA 3GN5A 3UTKA 4QH4A 4EGWA 4DR1T 2CBIA 4TNVA 1XDOA 3FBLA 3L8RA 2BYPA 2ZM8A 5ABGA 4X65T 2BKPA 3ZMVB 5AQVB 3IA3A 4MLKA 5LHHB 4DR2T 1S94A 3ONXA 3WTOA 3DJBA 4ZI2C 3GN5B 4CN1A 2OV9A 1S35A 5FL1A 4IDPA 2FJBA 4U33A 4JI4T 5AQKB 3R6NA 2PJQA 5LHIB 3GUAA 5KDMC 5KX5E 2LHNA 1HF8A 5LJMA 3P8CD 2I0MA 4HFCA 4ILAA 3ZCJA 3LBXA 2E5VA 3FZFB 4TWHA 3AEGA 4JI3T 2VURA 1IJ5A 2M6BA 3NKZA 3N9OA 4IE4A 5LYJE 2KXPB 5AQTB 3FB2A 1QLBA 4ERRA 2L3LA 3U3IA 5AQNB 3HKCE 2BS2A 1XZYA 4K0UA 1CUNA 5BW2A 5F3JA 4QX8B 3ZSTA 2CWOA 2CE7A 1SA0E 4PFOA 5JR9B 3N2OA 4I43B 4OYJA 4H9QC 1HTJF 3AE4A 4YJ3E 3W15B 3PDYA 4U74A 4TNWA 2X0YA 4AFTA 2WU5A 3C4ZA 4HWDA 4NXNT 2BBHA 3HR0A 2B76A 2JQ9A 4NIQA 4BA9A 2RA1A 5HXHA 3V5SA 3FXDB 4UM1A 1UX5A 4K0KT 3OYZA 4DR6T 2Y54A 2LLYA 2K3WA 5FXVA 4ZI2D 5EK4A 1Z8UA 3TKLB 3RI5A 5HEUA 4LF9T 4LFCT 3R84B 4CXWA 4IE5A 3KINB 4QWNB 5GONE 2XQ6A 3AE7A 3K3QC 4OYKA 3D0TA 3P4WA 3IBPA 2HHHT 2BR8A 2ES0A 2YN6A 3C98B 1JNRA 3AA6B 4DMWA 4YSZA 5AFKA 2XQ7A 4IE0A 2XAFB 3ZMTB 2WMNA 1JNZA 3TLUA 3RH3A 4DV5T 1U5PA 2CXDA 2FJEA 2LJLA 3TLWA 3P4SA 2VQET 2BDEA 2CLYC 3ZMSB 1AJ3A 5ABHA 2EHOA 5L3EB 4C91A 3RF1A 1HFAA 5LHGB 1N33T 3PUAA 2E9XA 5FXXA 2X9XA 4H9OC 2XY8B 3WTMA 4F8HA 3HA4A 3T8OA 3CX7B 5JDQA 3AE1A 4QXCB 3LSVA 2HPLA 4ZZCA 5AFNA 1IBMT 2XAQB 2E2AA 3WTLA 4HFIA 4I55E 2X68A 2H7OA 3CIRA 3RRWA 2V6XA 4QAAA 4GK0E 2E9XB 2LE8A 2CWYA 4HQPA 3M65A 3MZKB 5JREA 3AEBA 5SYOA 4LF4T 2PGZA 1W9RA 1IBKT 2IIUA 1ZEEA 2JMHA 4JI1T 4ILCA 5J5IA 5L3GB 2BBJA 4BQTA 3QB5A 4O8SA 4DV7T 5CGMA 1YD8G 5JR9C 2N9DA 3PUZF 1Z0PA 3JAFA 3KFWX 4EOZB 1HR0T 2WMOA 2Y57A 4YT0A 2L9QA 3AEAA 2BYNA 4XZCA 2BG9E 2LSIA 4QABA 2FUPA 1XMQT 3SH1A 3WIPA 5FL0A 4WYVA 1CHUA 3T1HT 5LBQB 2W62A 5L4EA 1HCIA 1WLXA 2W8FA 3HI2A 4WNKA 4YLHA 4FRRA 3ONLC 4A5XA 1EZ3A 2XM1A 4DMVA 1X79A 2NR4A 3A5XA 2XQ9A 4UVCB 1XMOT 5HXSA 4ZK4A 5LGUB 3ZMZB 3K8PC 2X51A 2J62A 2CHOA 2WM9A 1T7SA 4A56A 1OXZA 4DR4T 3PE0A 4HFBA 4JLEA 1OWAA 3SOLA 2DI4A 4U72A 1I6ZA 4QACA 2XPKA 3FHNA 3LFMA 4DIDB 3ZC0A 5JDGA 3HKBE 2UUBT 4ZJSA 4Z91A 3AE8A 2JJ9A 3Q9DA 5J5HA 2PH9A 2LRKA 2IC9A 3SFEA 3AE2A 1QUUA 4ZI7E 3AA7B 1LVKA 5HAXA 5AFHA 2LSKA 4UXUA 3ZLIA 1MIWA 3RGLA 4L0RA 5LNKA 3PURA 3UFEA 3PUGA 4X62T 4ILBA 4ALXA 3KV9A 5A1LA 4X64T 3SS1A 5KZUA 2XAGB 4BFQA 1WYCA 4LF6T 3AE5A 4B6XA 3ESLA 4DUYT 3PJAJ 3QB5K 3CVRA 5AQPB 3EDUA 4TX5A 1N34T 2YDSA 4HWCA 2X00A 3ZPOA 3P4QA 2VWAA 1D1BA 4GKKT 2BJ0A 3RC8A 4EZ4A 2WSSV 2WNCA 1H7CA 2D0UA 2XJ7A 1M7KA 1MIYA 4IGUA 2VKHA 2V5DA 3IF8B 5JDMA 2VKOA 3K3OA 2YKSA 2BG9C 2C5KT 2QGSA 3AECA 2WNLA 4B3RT 1E7PA 3RRCA 1WR6A 3F57A 5EZYE 3PU3A 3TLSA 3O1JA 3NZPA 4IDNA 5HWYA 3VR9A 2UXCT 3UU8A 1LRZA 1VCSA 3ABVA 4COFA 4IIJE 5TVCA 2V5CA 2XASB 4ILUA 4DVDA 2PFVA 4IE6A 5JRCB 4TV8E 4QX7B 2LKGA 2QA7A 5FKYA 4CI1B 2MBGA 2CEAA 1MMDA 2X9YA 2XQYA 5ABFB 4KI0F 4AXPA 3L09A 2ACXA 3RYHE 4DR7T 4GKJT 4TV9E 1OEDE 1J5WA 3P50A 4YJ2E 2XQ8A 1XDPA 4DV3T 1MMAA 4HWIB 2MPKA 1OEDB 5LMNT 2LSYA 3AXJA 2WB5A 4H9SE 3T1YT 5DQWA 2Y58A 4NZBA 4KBMB 1MIVA 3ZCIA 4XK9A 2CHNA 2H88A 4P1NA 2PG8A 4WBNE 5IYZE 2BS4A 3UUNA 2VB6A 4OX9T 3RYIE 5LMUT 3QOFA 3ZJ1A 4JI7T 3UU3A 3C51A 2Q9QA 2NWBA 3PU8A 4YTNA 1DU2A 4O4IE 3U78A 4DV4T 1HX8A 2V7MA 4G63A 3ZSSA 4ISTA 5AQJB 4O2AE 2X9WA 2JRKA 2I59A 2CM0A 3MKDA 3UULA 2V8SV 2ZM0A 4DNDA 3AEEA 4H9NC 3ZN0B 3T4MA 2XSBA 4KX6A 4ZR6A 2UXNB 2Q9QB 4EYYR 2KZ7B 3LBXB 4WZXA 5LGNB 2BZBA 2IAKA 4EB6E 3HKDE 1D0ZA 2XQAA 3UUBA 2V7LA 3E0ZA 2XSAA 3Q5WA 4OK0A 1UV6A 1D0XA 2LM9A 4JI2T 5LG3A 2K9AA 3MJXA 2X9HA 4WBOA 3KV5A 4L5GA 5FVKA 4XHEA 4YSXA 4D01A 4MFRA 1KF6A 2AXDS 3NVOA 3L39A 5AQIB 4PJLA 2NW7A 2YU1A 3RIUA 4X1KE 2XYTA 2LHRA 5HXEA 5AFJA 2CA5A 4UEMA 4ANJA 5DJQC 2LT3A 4DV1T 2A9UA 2MYSA 5FJVA 4CXYA 4KHPT 1YKHB 2Y7YA 4PJMA 2MOZA 3PUWF 2CMRA 2WZHA 1MMNA 2X0LB 4YHJA 3RKOA 4Z90A 4AKHA 1I94T 2RPAA 4FJOA 5BMVE 1HG5A 2DWKA 3P4RA 4U2ZA 4HWHA 1Y01A 4JEUB 4IE7A 5L3DB 2UU9T 4H63V 4N78D 3EHZA 4TZ4C 1D0YA 3AEDA 1W0AA 3RIFA 3AAAB 5AQRB 3WTNA 1OEDC 2ZM2A 4JI0T 3GMIA 1LKXA 3RQUA 5LP6E 2VQFT 2W0GA 3B57A 5HCJA 4QHOA 4UM3S 2KWIB 3I9YA 1M62A 5AQLB 3UQ7A 5J2TE 3ZEFB 4TN7B 2Y48B 2BYSA 2EHOB 3LK42 4PW8A 2WDVA 1VOMA 3KBUA 3FZMB 3SIOA 4EXTA 5LJNA 3H3AA 4I50E 4M1PA 5AQQB 4JV5T 2NTYA 2J47A 3VKGA 1B7TA 4PNIA 2NOXA 2WQYA 5AQOB 2WZYA 3SQ6A 3UQ4A 4AIUA 5LOVE 3AE9A 3Q2MA 2B1EA 4IHJE 2X0HA 2UUCT 5DABA 2XQ3A 4HKAA 3AVRA 1YW0A 4YFSA 4AQFA 5LB7B 4U3CA 5FY7A 5AFMA 3AE3A 3FZLB 4LMJA 4JI5T 2XAJB 4ZEYA 2NW9A 3FZHB 3PUQA 3UU5A 5JTGA 2W8GA 4TWFA 2ODVA 2YOEA 2D2SA 2VVNA 1IBLT 4B3TT 3UUMA 3QUJA 3MXZA 3CPZA 5AFMB 2VVSA 5EK3A 2FJAA 1NAFA 2WU2A 4AKGA 2H7VC 3BK9A 3IGQA 3B5MA 4HE8A 3FZKB 4G2AA 5J2UE 3ZT6A 1HNWT 2UXXB 2BKNA 5LGTB 2LSJA 3LG7A 3OPCA 5AINA 4ZK1A 3VR8A 4A97A 2M67A 1MMGA 2A2FX 5H6QB 3C84A 5KMGP 4DR3T 2LOPA 4ASKA 2H3RA 2KNDA 2ZJUA 5JDLA 4AKLA 4EZ1A 3CWZB 1T8BA 2BYRA 3U8MA 2WWVA 4IT4A
chains in the Genus database with same CATH topology
2WNJA 3GUAA 3RQWA 2YMDA 4B5DA 5LXBA 4AFGA 4DBMA 4NPPA 5AFKA 2XQ7A 2YKSA 2LM2A 2XYTA 2XYSA 3UU4A 4IL4A 2UZ6A 4ZJSA 2BG9C 4ZZBA 2XNVA 2Y58A 5AFJA 4Z91A 3UU6A 4HFCA 2WZYA 4HFDA 3SQ6A 4UY2A 3WTJA 3UQ4A 3U8KA 5JMEA 3PMZA 3JAFA 2M6IA 2WNLA 4NZBA 5KE4A 5L4HA 4ILAA 4XK9A 5BRXA 5J5HA 4TWHA 2PH9A 2BG9B 5FJVA 3WTHA 2Y7YA 2M6BA 2Y57A 2XQ3A 4HFEA 3TLUA 4HFHA 5J5GA 5AFLA 4ZRUA 5CO5A 3EI0A 3TLWA 4IREA 2BYNA 3TLSA 3ZDHA 3EAMA 2XZ5A 3U8JA 5AFMA 2BG9E 2Y56A 3SQ9A 5AFHA 4LMJA 4Z90A 3UU3A 5BW2A 2BYQA 4QABA 4UXUA 3ZDGA 5CFBA 2XNUA 4PIRA 5J5FA 3UU8A 3SH1A 3U8NA 2XZ6A 3WIPA 4A98A 3JAEA 2XNTA 2XQ4A 3UU5A 3U8LA 5HEOA 4COFA 1OEDA 3C79A 2XQ5A 2W8GA 3ZKRA 5L4EA 1UW6A 4WV9A 4ZJTA 2W8FA 4TWFA 2YMEA 4FRRA 5TVCA 4QH5A 4LMKA 2YOEA 4TNWA 3WTIA 3WTMA 3EHZA 3JADA 4F8HA 4AFTA 4ILBA 2MAWA 4ALXA 5AFMB 3T4MA 5L47A 2XQ9A 2QC1B 4QH4A 3RIFA 4ZR6A 3LSVA 3WTNA 1OEDC 4TNVA 4UM1A 5KZUA 4ZZCA 4ZK4A 4BFQA 5HCMA 3IGQA 2BYPA 5AFNA 2LKHA 5HEJA 3WTLA 4HFIA 5BP0A 3RQUA 4UM3P 3RHWA 4IL9A 2Y54A 2LKGA 4QAAA 2LLYA 2KSRA 4X5TA 5HCJA 5IUXA 5J0ZA 2WN9A 5AINA 4UM3S 3TLTA 4ZK1A 4QH1A 2XQAA 5HEHA 5HEGA 3UQ7A 4HQPA 4A97A 3RI5A 3UUBA 1I9BA 2VL0A 5HEUA 3WTOA 3RIAA 2X00A 2BR7A 5SYOA 2PGZA 3WTKA 1UX2A 2BYSA 4HFBA 1OEDE 3C84A 4AFHA 2BJ0A 2ZJVA 3TLVA 2C9TA 2XQ6A 4ILCA 2WNCA 5J5IA 2BG9A 1UV6A 3PEOA 3P50A 2X00D 2ZJUA 5LG3A 2XQ8A 4EZ1A 3SIOA 3P4WA 4XHEA 4BQTA 4LMLA 4TWDA 2BR8A 2YN6A 1OEDB 2BYRA 4UM3A 3U8MA 4D01A 4QACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNJ A;  3GUA A;  3RQW A;  2YMD A;  4B5D A;  5LXB A;  4AFG A;  4DBM A;  4NPP A;  5AFK A;  2XQ7 A;  2YKS A;  2LM2 A;  2XYT A;  2XYS A;  3UU4 A;  4IL4 A;  2UZ6 A;  4ZJS A;  2BG9 C;  4ZZB A;  2XNV A;  2Y58 A;  5AFJ A;  4Z91 A;  3UU6 A;  4HFC A;  2WZY A;  4HFD A;  3SQ6 A;  4UY2 A;  3WTJ A;  3UQ4 A;  3U8K A;  5JME A;  3PMZ A;  3JAF A;  2M6I A;  2WNL A;  4NZB A;  5KE4 A;  5L4H A;  4ILA A;  4XK9 A;  5BRX A;  5J5H A;  4TWH A;  2PH9 A;  2BG9 B;  5FJV A;  3WTH A;  2Y7Y A;  2M6B A;  2Y57 A;  2XQ3 A;  4HFE A;  3TLU A;  4HFH A;  5J5G A;  5AFL A;  4ZRU A;  5CO5 A;  3EI0 A;  3TLW A;  4IRE A;  2BYN A;  3TLS A;  3ZDH A;  3EAM A;  2XZ5 A;  3U8J A;  5AFM A;  2BG9 E;  2Y56 A;  3SQ9 A;  5AFH A;  4LMJ A;  4Z90 A;  3UU3 A;  5BW2 A;  2BYQ A;  4QAB A;  4UXU A;  3ZDG A;  5CFB A;  2XNU A;  4PIR A;  5J5F A;  3UU8 A;  3SH1 A;  3U8N A;  2XZ6 A;  3WIP A;  4A98 A;  3JAE A;  2XNT A;  2XQ4 A;  3UU5 A;  3U8L A;  5HEO A;  4COF A;  1OED A;  3C79 A;  2XQ5 A;  2W8G A;  3ZKR A;  5L4E A;  1UW6 A;  4WV9 A;  4ZJT A;  2W8F A;  4TWF A;  2YME A;  4FRR A;  5TVC A;  4QH5 A;  4LMK A;  2YOE A;  4TNW A;  3WTI A;  3WTM A;  3EHZ A;  3JAD A;  4F8H A;  4AFT A;  4ILB A;  2MAW A;  4ALX A;  5AFM B;  3T4M A;  5L47 A;  2XQ9 A;  2QC1 B;  4QH4 A;  3RIF A;  4ZR6 A;  3LSV A;  3WTN A;  1OED C;  4TNV A;  4UM1 A;  5KZU A;  4ZZC A;  4ZK4 A;  4BFQ A;  5HCM A;  3IGQ A;  2BYP A;  5AFN A;  2LKH A;  5HEJ A;  3WTL A;  4HFI A;  5BP0 A;  3RQU A;  4UM3 P;  3RHW A;  4IL9 A;  2Y54 A;  2LKG A;  4QAA A;  2LLY A;  2KSR A;  4X5T A;  5HCJ A;  5IUX A;  5J0Z A;  2WN9 A;  5AIN A;  4UM3 S;  3TLT A;  4ZK1 A;  4QH1 A;  2XQA A;  5HEH A;  5HEG A;  3UQ7 A;  4HQP A;  4A97 A;  3RI5 A;  3UUB A;  1I9B A;  2VL0 A;  5HEU A;  3WTO A;  3RIA A;  2X00 A;  2BR7 A;  5SYO A;  2PGZ A;  3WTK A;  1UX2 A;  2BYS A;  4HFB A;  1OED E;  3C84 A;  4AFH A;  2BJ0 A;  2ZJV A;  3TLV A;  2C9T A;  2XQ6 A;  4ILC A;  2WNC A;  5J5I A;  2BG9 A;  1UV6 A;  3PEO A;  3P50 A;  2X00 D;  2ZJU A;  5LG3 A;  2XQ8 A;  4EZ1 A;  3SIO A;  3P4W A;  4XHE A;  4BQT A;  4LML A;  4TWD A;  2BR8 A;  2YN6 A;  1OED B;  2BYR A;  4UM3 A;  3U8M A;  4D01 A;  4QAC A; 
#chains in the Genus database with same CATH topology
 2YEV C;  5LG4 A;  2BS3 A;  4UVB B;  5LXB A;  5JDF A;  4DBM A;  5AQU B;  4LF8 T;  2LM2 A;  1BR2 A;  3OVU A;  2DHR A;  4HFD A;  2G0U A;  4FI5 A;  3J9X 1;  1L0V A;  5CB4 E;  2DWG A;  2WDR A;  1WRD A;  3EI0 A;  3IHR A;  4Z8X A;  4IRE A;  2KT9 A;  4GK5 E;  2V26 A;  3WI3 A;  5CA0 E;  2BYQ A;  2HN1 A;  4UF0 A;  4HGA A;  2W61 A;  4E7Z A;  5LA6 E;  4MHC A;  3C79 A;  3ZKR A;  4WV9 A;  3ONJ A;  3I9W A;  4YXD A;  2EHO C;  5FY1 A;  2V6Y A;  4HTE A;  1KEY A;  4O2B E;  1XNQ T;  1T98 A;  2V1D B;  3ZT7 A;  4I4T E;  2E9X C;  5ETW A;  2N2N A;  3MK7 C;  2VL8 A;  4KP3 C;  3N9P A;  4AI6 A;  5FMN A;  3LJC A;  2UUA T;  5C3J A;  1U4Q A;  5C8Y E;  1UK5 A;  4UR9 A;  5HXR A;  2RP4 A;  3ETV A;  3RIA A;  3SRZ A;  2V6Y B;  2LOS A;  4CQI A;  5JQG E;  1O3X A;  2XM2 A;  4CN6 A;  2C9T A;  2VK9 A;  3KBT A;  1FEW A;  4I0U A;  3RYC E;  3C4X A;  4LML A;  2YK0 A;  3AA1 B;  2V7I A;  4LF5 T;  2JQK A;  4EZH A;  1G73 A;  1N32 T;  2JPF A;  5DQV A;  4TUY E;  4PK5 A;  2Z6E A;  4CI2 B;  3ZT5 A;  3QK6 A;  4UIG A;  3KV6 A;  5AQM B;  4EED A;  5CJ5 A;  4LF7 T;  3A8Y C;  3VU7 H;  1US7 B;  3ANW A;  2ZM6 T;  2XUE A;  3AVS A;  2XNU A;  1ZOY A;  1ZKE A;  2KMF A;  4A98 A;  3RYF E;  4ZXL A;  3QC9 A;  2CBJ A;  2XQ5 A;  2EHO D;  4ZJT A;  2P9B A;  5CA1 E;  4O4J E;  1XNR T;  3KDS E;  3OBV E;  3IEE A;  3WTI A;  4ZS2 A;  2IW5 B;  2FJD A;  3UFG A;  2K5B B;  3OJA A;  4GYR A;  2E9X D;  3ANW B;  2QYW A;  2K48 A;  4O4H E;  2WZI A;  4EAH A;  3ZYM A;  2WDQ A;  2W63 A;  4L9I A;  5BP0 A;  3RHW A;  3AEF A;  4X5T A;  5E0O A;  3P4P A;  4MAL A;  2MTQ A;  2W67 A;  4PK6 A;  4YTP A;  3WTK A;  3VRB A;  2K24 A;  3PTR B;  1HX1 B;  3PUV F;  4TWD A;  5FNV E;  3DTO A;  4B5D A;  1KNZ A;  1MNE A;  3M3Z B;  3PUS A;  4AQY T;  3UT5 E;  1D1C A;  5L3C B;  3RC3 A;  3JCF A;  3PMZ A;  5L4H A;  2XTL A;  3NRY A;  1KK7 A;  3KVA A;  2D0T A;  2WCA A;  2UXD T;  2AE9 A;  4HFH A;  3E22 E;  2YIN A;  3V5U A;  4HN9 A;  1KNP A;  4JBW F;  3AA0 B;  5J5F A;  2CLY B;  3VRA A;  3U8L A;  5HWX A;  1V9D A;  2YME A;  4EEB A;  3K3N A;  1HNZ T;  1SHZ C;  4P09 A;  2WS3 A;  1IAP A;  2E5L T;  2LSG A;  1YXR A;  4BJM A;  3AXJ B;  2VKD A;  2MAW A;  2X66 A;  5L47 A;  3NZQ A;  3EUH A;  2R6G F;  3KVB A;  1XWM A;  3PUY F;  2D9D A;  2JIW A;  4U7I A;  2JQH A;  4DR5 T;  1FJG T;  2WN9 A;  3DP7 A;  2CPT A;  4H63 H;  5HEH A;  3N9L A;  1KNR A;  3N2G E;  5AQG B;  2VL0 A;  4B3S T;  1IZN B;  4MBQ A;  5JR9 A;  4AKR B;  3PEO A;  2C0S A;  4ZOL E;  4UM3 A;  2XAH B;  2NP9 A;  3I0O A;  1WR0 A;  2OLT A;  3AE6 A;  4IL4 A;  2F4V T;  4ZS3 A;  5JME A;  3LK2 B;  4B3M T;  1HS7 A;  4EIW A;  2YU2 A;  4QKN A;  3WTH A;  5LXT E;  1X9B A;  3RLF F;  5F5W A;  5J5G A;  4ZRU A;  3CML A;  4HEA A;  5CO5 A;  2WBL A;  3CQX C;  1WCR A;  3NRX A;  2PBI A;  3GA8 A;  5L3F B;  2Y56 A;  3SQ9 A;  5FVL A;  3N2K E;  2FBW A;  5FXZ A;  1G8X A;  2DL1 A;  2V7J A;  5CFB A;  4IDO A;  5KXJ A;  3O1I A;  3C4W A;  5LBM A;  1N36 T;  3N5L A;  5HXC A;  2NTX A;  4QH5 A;  1NEK A;  1MND A;  3CK6 A;  5FYM A;  5JDH A;  4HFV A;  3C64 A;  2BVL A;  4WW0 A;  3CQC B;  3Q5X A;  1BR0 A;  3RPU A;  1NWM X;  5L3B B;  4UM3 P;  4PJN A;  2W00 A;  4IL9 A;  5IWA T;  4CXX A;  4Q25 A;  2ZMA A;  3TLT A;  1HG2 A;  2X67 A;  5FY0 A;  4JEH B;  2I6H A;  3TLV A;  2X00 D;  4X20 E;  2LRL A;  4KUM B;  2Y8D A;  4HWF A;  5FP3 A;  2OA5 A;  4XAX B;  3F2E A;  1ZHC A;  4UV8 B;  3B13 A;  3HKE E;  3H37 A;  3UU4 A;  5L2L A;  3BQI A;  2QRX A;  3UU6 A;  2BVM A;  5KE4 A;  3U8K A;  2M6I A;  5IHY A;  3WAK A;  4BJN A;  5BRX A;  1Y64 B;  2L8K A;  1YQ4 A;  2GK9 A;  3Q5D A;  4HFE A;  2JQQ A;  5AFL A;  3NWI A;  2IUB A;  1LVF A;  3KV4 A;  2WWU A;  3PJA A;  3PUX F;  4PFP A;  4F6R C;  4GYS A;  2XZ6 A;  5F8P A;  1SUM B;  5HEO A;  4EYU A;  4AIS A;  2D5U A;  4X66 T;  3C50 A;  2Q9Q C;  3JAD A;  1FMV A;  2V7K A;  4PAG A;  4OFZ A;  2CXL A;  3N9N A;  3O4X E;  3S4U A;  1GQE A;  5HCM A;  4IDZ A;  3HL6 A;  4GOU A;  4IDQ A;  2ZLY A;  3EDV A;  2H89 A;  5J0Z A;  3H3M A;  1WFD A;  3CX8 B;  4J2C A;  1I9B A;  4QXB B;  2BR7 A;  2PTF A;  2W2U A;  1UX2 A;  2KLQ A;  4AFH A;  4YY3 T;  3ZYL A;  2ZJV A;  4DBQ A;  2BG9 A;  4KHZ F;  4CN4 A;  3ETU A;  1E1H B;  3VHL A;  3WAJ A;  1FIO A;  4U31 A;  2WAU A;  3N9Q A;  2HH7 A;  4X1I E;  4DV2 T;  3GWH A;  4DBR A;  4UV9 B;  3RX6 A;  2YMD A;  4AFG A;  4NPP A;  2W4X A;  4P0B A;  2A72 A;  4JI8 T;  4UY2 A;  2XZE A;  3UUX B;  4JUY A;  2BG9 B;  4EV6 A;  4XBF B;  2BKO A;  3ZMU B;  3RIU C;  1W0B A;  2XHE B;  1SE7 A;  3A7M A;  5JH7 E;  2NW8 A;  3U8J A;  1IJ6 A;  2C5I T;  3ZYK A;  3J7Y q;  3PV0 F;  3ZDG A;  1J5E T;  3OTO T;  4BAY B;  2W66 A;  3JAE A;  2XQ4 A;  3E08 A;  5AFU L;  4LFA T;  2Q9Q D;  5J1G A;  1UW6 A;  3P7I A;  2C5J A;  4H9R C;  2JMK A;  5C2T A;  3OYX A;  4E7S A;  4OHF A;  3QNU A;  2HN2 A;  2UXB T;  4AKI A;  3F31 A;  2QC1 B;  5LCY A;  4X1Y E;  4LFB T;  2LKH A;  1HNX T;  4YHH T;  4O4L E;  3SWH A;  4GIW A;  2CXF A;  5ABE A;  2IC6 A;  4QH1 A;  5HEG A;  3BQL A;  3G06 A;  3OKQ A;  3JC6 C;  2VKJ A;  3CKD A;  4ZI3 C;  5ADX L;  2DCF A;  3EVY A;  1VRB A;  4H9P C;  4PK4 A;  4UF0 B;  3ZC1 A;  3X1D A;  4CI3 B;  2CRB A;  2YDR A;  3Q5E A;  4DUZ T;  5M4Y A;  5AQH B;  4P0A A;  4U2Y A;  1E2A A;  5JDN A;  5EK2 A;  3RQW A;  2XYS A;  4UVA B;  4ZZB A;  2XNV A;  3WTJ A;  4V1A v;  1UUS A;  3ZJ2 A;  3MAC A;  2KIN B;  1VCT A;  2Y6X A;  4ISS A;  1QSD A;  5AQS B;  5BR8 T;  4DV0 T;  3K1S A;  2IML A;  2YDQ A;  2N1G A;  4ADZ A;  2DLR A;  2QVA A;  3EAM A;  4JYA T;  1BR4 A;  2CCQ A;  3FBZ A;  3ZN1 B;  1UX4 A;  1KFY A;  3U8N A;  5AQF B;  1FMW A;  4AQF C;  1J1J A;  2WP9 A;  4UXN B;  5JVD E;  2J4G A;  1NEN A;  3BQK A;  4LMK A;  4YSY A;  3CX6 B;  2HPJ A;  5FXW A;  1UGO A;  4QXH B;  4NUU A;  1UCU A;  2ODU A;  4NUV A;  3AAE B;  2VAS A;  4DV6 T;  5HEJ A;  5H6R B;  3JC6 D;  1YQ3 A;  2KSR A;  5IUX A;  4ZI3 D;  3AB3 B;  4UEL A;  2ACZ A;  2DNX A;  3I0Q A;  4AQG A;  1YKE B;  3LK3 B;  2IDO B;  2KWH A;  3N9M A;  2LEH A;  1ZP0 A;  3CQG B;  2A3D A;  4C90 A;  1BR1 A;  1W09 A;  1R8I A;  4ZHQ E;  2WNJ A;  3NBX X;  2IHR 1;  3AAI A;  4JI6 T;  4KMC A;  2UZ6 A;  5JRC A;  1UUR A;  1D1A A;  5HYA A;  3FXE B;  3EAB A;  3SFD A;  4CZZ B;  5TAO A;  2WY2 A;  3VKH A;  1T72 A;  5ABF A;  3ZDH A;  1ZV4 X;  2XZ5 A;  3O9X A;  4DO0 A;  3RKG A;  2J1D G;  3MA9 A;  4PJJ A;  4PIR A;  3LDQ B;  2XNT A;  2SPC A;  1OED A;  4NXM T;  3L3P A;  4YTM A;  2E8I A;  3O1H A;  3I1A A;  1WYB A;  4U7Y A;  3GN5 A;  3UTK A;  4QH4 A;  4EGW A;  4DR1 T;  2CBI A;  4TNV A;  1XDO A;  3FBL A;  3L8R A;  2BYP A;  2ZM8 A;  5ABG A;  4X65 T;  2BKP A;  3ZMV B;  5AQV B;  3IA3 A;  4MLK A;  5LHH B;  4DR2 T;  1S94 A;  3ONX A;  3WTO A;  3DJB A;  4ZI2 C;  3GN5 B;  4CN1 A;  2OV9 A;  1S35 A;  5FL1 A;  4IDP A;  2FJB A;  4U33 A;  4JI4 T;  5AQK B;  3R6N A;  2PJQ A;  5LHI B;  3GUA A;  5KDM C;  5KX5 E;  2LHN A;  1HF8 A;  5LJM A;  3P8C D;  2I0M A;  4HFC A;  4ILA A;  3ZCJ A;  3LBX A;  2E5V A;  3FZF B;  4TWH A;  3AEG A;  4JI3 T;  2VUR A;  1IJ5 A;  2M6B A;  3NKZ A;  3N9O A;  4IE4 A;  5LYJ E;  2KXP B;  5AQT B;  3FB2 A;  1QLB A;  4ERR A;  2L3L A;  3U3I A;  5AQN B;  3HKC E;  2BS2 A;  1XZY A;  4K0U A;  1CUN A;  5BW2 A;  5F3J A;  4QX8 B;  3ZST A;  2CWO A;  2CE7 A;  1SA0 E;  4PFO A;  5JR9 B;  3N2O A;  4I43 B;  4OYJ A;  4H9Q C;  1HTJ F;  3AE4 A;  4YJ3 E;  3W15 B;  3PDY A;  4U74 A;  4TNW A;  2X0Y A;  4AFT A;  2WU5 A;  3C4Z A;  4HWD A;  4NXN T;  2BBH A;  3HR0 A;  2B76 A;  2JQ9 A;  4NIQ A;  4BA9 A;  2RA1 A;  5HXH A;  3V5S A;  3FXD B;  4UM1 A;  1UX5 A;  4K0K T;  3OYZ A;  4DR6 T;  2Y54 A;  2LLY A;  2K3W A;  5FXV A;  4ZI2 D;  5EK4 A;  1Z8U A;  3TKL B;  3RI5 A;  5HEU A;  4LF9 T;  4LFC T;  3R84 B;  4CXW A;  4IE5 A;  3KIN B;  4QWN B;  5GON E;  2XQ6 A;  3AE7 A;  3K3Q C;  4OYK A;  3D0T A;  3P4W A;  3IBP A;  2HHH T;  2BR8 A;  2ES0 A;  2YN6 A;  3C98 B;  1JNR A;  3AA6 B;  4DMW A;  4YSZ A;  5AFK A;  2XQ7 A;  4IE0 A;  2XAF B;  3ZMT B;  2WMN A;  1JNZ A;  3TLU A;  3RH3 A;  4DV5 T;  1U5P A;  2CXD A;  2FJE A;  2LJL A;  3TLW A;  3P4S A;  2VQE T;  2BDE A;  2CLY C;  3ZMS B;  1AJ3 A;  5ABH A;  2EHO A;  5L3E B;  4C91 A;  3RF1 A;  1HFA A;  5LHG B;  1N33 T;  3PUA A;  2E9X A;  5FXX A;  2X9X A;  4H9O C;  2XY8 B;  3WTM A;  4F8H A;  3HA4 A;  3T8O A;  3CX7 B;  5JDQ A;  3AE1 A;  4QXC B;  3LSV A;  2HPL A;  4ZZC A;  5AFN A;  1IBM T;  2XAQ B;  2E2A A;  3WTL A;  4HFI A;  4I55 E;  2X68 A;  2H7O A;  3CIR A;  3RRW A;  2V6X A;  4QAA A;  4GK0 E;  2E9X B;  2LE8 A;  2CWY A;  4HQP A;  3M65 A;  3MZK B;  5JRE A;  3AEB A;  5SYO A;  4LF4 T;  2PGZ A;  1W9R A;  1IBK T;  2IIU A;  1ZEE A;  2JMH A;  4JI1 T;  4ILC A;  5J5I A;  5L3G B;  2BBJ A;  4BQT A;  3QB5 A;  4O8S A;  4DV7 T;  5CGM A;  1YD8 G;  5JR9 C;  2N9D A;  3PUZ F;  1Z0P A;  3JAF A;  3KFW X;  4EOZ B;  1HR0 T;  2WMO A;  2Y57 A;  4YT0 A;  2L9Q A;  3AEA A;  2BYN A;  4XZC A;  2BG9 E;  2LSI A;  4QAB A;  2FUP A;  1XMQ T;  3SH1 A;  3WIP A;  5FL0 A;  4WYV A;  1CHU A;  3T1H T;  5LBQ B;  2W62 A;  5L4E A;  1HCI A;  1WLX A;  2W8F A;  3HI2 A;  4WNK A;  4YLH A;  4FRR A;  3ONL C;  4A5X A;  1EZ3 A;  2XM1 A;  4DMV A;  1X79 A;  2NR4 A;  3A5X A;  2XQ9 A;  4UVC B;  1XMO T;  5HXS A;  4ZK4 A;  5LGU B;  3ZMZ B;  3K8P C;  2X51 A;  2J62 A;  2CHO A;  2WM9 A;  1T7S A;  4A56 A;  1OXZ A;  4DR4 T;  3PE0 A;  4HFB A;  4JLE A;  1OWA A;  3SOL A;  2DI4 A;  4U72 A;  1I6Z A;  4QAC A;  2XPK A;  3FHN A;  3LFM A;  4DID B;  3ZC0 A;  5JDG A;  3HKB E;  2UUB T;  4ZJS A;  4Z91 A;  3AE8 A;  2JJ9 A;  3Q9D A;  5J5H A;  2PH9 A;  2LRK A;  2IC9 A;  3SFE A;  3AE2 A;  1QUU A;  4ZI7 E;  3AA7 B;  1LVK A;  5HAX A;  5AFH A;  2LSK A;  4UXU A;  3ZLI A;  1MIW A;  3RGL A;  4L0R A;  5LNK A;  3PUR A;  3UFE A;  3PUG A;  4X62 T;  4ILB A;  4ALX A;  3KV9 A;  5A1L A;  4X64 T;  3SS1 A;  5KZU A;  2XAG B;  4BFQ A;  1WYC A;  4LF6 T;  3AE5 A;  4B6X A;  3ESL A;  4DUY T;  3PJA J;  3QB5 K;  3CVR A;  5AQP B;  3EDU A;  4TX5 A;  1N34 T;  2YDS A;  4HWC A;  2X00 A;  3ZPO A;  3P4Q A;  2VWA A;  1D1B A;  4GKK T;  2BJ0 A;  3RC8 A;  4EZ4 A;  2WSS V;  2WNC A;  1H7C A;  2D0U A;  2XJ7 A;  1M7K A;  1MIY A;  4IGU A;  2VKH A;  2V5D A;  3IF8 B;  5JDM A;  2VKO A;  3K3O A;  2YKS A;  2BG9 C;  2C5K T;  2QGS A;  3AEC A;  2WNL A;  4B3R T;  1E7P A;  3RRC A;  1WR6 A;  3F57 A;  5EZY E;  3PU3 A;  3TLS A;  3O1J A;  3NZP A;  4IDN A;  5HWY A;  3VR9 A;  2UXC T;  3UU8 A;  1LRZ A;  1VCS A;  3ABV A;  4COF A;  4IIJ E;  5TVC A;  2V5C A;  2XAS B;  4ILU A;  4DVD A;  2PFV A;  4IE6 A;  5JRC B;  4TV8 E;  4QX7 B;  2LKG A;  2QA7 A;  5FKY A;  4CI1 B;  2MBG A;  2CEA A;  1MMD A;  2X9Y A;  2XQY A;  5ABF B;  4KI0 F;  4AXP A;  3L09 A;  2ACX A;  3RYH E;  4DR7 T;  4GKJ T;  4TV9 E;  1OED E;  1J5W A;  3P50 A;  4YJ2 E;  2XQ8 A;  1XDP A;  4DV3 T;  1MMA A;  4HWI B;  2MPK A;  1OED B;  5LMN T;  2LSY A;  3AXJ A;  2WB5 A;  4H9S E;  3T1Y T;  5DQW A;  2Y58 A;  4NZB A;  4KBM B;  1MIV A;  3ZCI A;  4XK9 A;  2CHN A;  2H88 A;  4P1N A;  2PG8 A;  4WBN E;  5IYZ E;  2BS4 A;  3UUN A;  2VB6 A;  4OX9 T;  3RYI E;  5LMU T;  3QOF A;  3ZJ1 A;  4JI7 T;  3UU3 A;  3C51 A;  2Q9Q A;  2NWB A;  3PU8 A;  4YTN A;  1DU2 A;  4O4I E;  3U78 A;  4DV4 T;  1HX8 A;  2V7M A;  4G63 A;  3ZSS A;  4IST A;  5AQJ B;  4O2A E;  2X9W A;  2JRK A;  2I59 A;  2CM0 A;  3MKD A;  3UUL A;  2V8S V;  2ZM0 A;  4DND A;  3AEE A;  4H9N C;  3ZN0 B;  3T4M A;  2XSB A;  4KX6 A;  4ZR6 A;  2UXN B;  2Q9Q B;  4EYY R;  2KZ7 B;  3LBX B;  4WZX A;  5LGN B;  2BZB A;  2IAK A;  4EB6 E;  3HKD E;  1D0Z A;  2XQA A;  3UUB A;  2V7L A;  3E0Z A;  2XSA A;  3Q5W A;  4OK0 A;  1UV6 A;  1D0X A;  2LM9 A;  4JI2 T;  5LG3 A;  2K9A A;  3MJX A;  2X9H A;  4WBO A;  3KV5 A;  4L5G A;  5FVK A;  4XHE A;  4YSX A;  4D01 A;  4MFR A;  1KF6 A;  2AXD S;  3NVO A;  3L39 A;  5AQI B;  4PJL A;  2NW7 A;  2YU1 A;  3RIU A;  4X1K E;  2XYT A;  2LHR A;  5HXE A;  5AFJ A;  2CA5 A;  4UEM A;  4ANJ A;  5DJQ C;  2LT3 A;  4DV1 T;  2A9U A;  2MYS A;  5FJV A;  4CXY A;  4KHP T;  1YKH B;  2Y7Y A;  4PJM A;  2MOZ A;  3PUW F;  2CMR A;  2WZH A;  1MMN A;  2X0L B;  4YHJ A;  3RKO A;  4Z90 A;  4AKH A;  1I94 T;  2RPA A;  4FJO A;  5BMV E;  1HG5 A;  2DWK A;  3P4R A;  4U2Z A;  4HWH A;  1Y01 A;  4JEU B;  4IE7 A;  5L3D B;  2UU9 T;  4H63 V;  4N78 D;  3EHZ A;  4TZ4 C;  1D0Y A;  3AED A;  1W0A A;  3RIF A;  3AAA B;  5AQR B;  3WTN A;  1OED C;  2ZM2 A;  4JI0 T;  3GMI A;  1LKX A;  3RQU A;  5LP6 E;  2VQF T;  2W0G A;  3B57 A;  5HCJ A;  4QHO A;  4UM3 S;  2KWI B;  3I9Y A;  1M62 A;  5AQL B;  3UQ7 A;  5J2T E;  3ZEF B;  4TN7 B;  2Y48 B;  2BYS A;  2EHO B;  3LK4 2;  4PW8 A;  2WDV A;  1VOM A;  3KBU A;  3FZM B;  3SIO A;  4EXT A;  5LJN A;  3H3A A;  4I50 E;  4M1P A;  5AQQ B;  4JV5 T;  2NTY A;  2J47 A;  3VKG A;  1B7T A;  4PNI A;  2NOX A;  2WQY A;  5AQO B;  2WZY A;  3SQ6 A;  3UQ4 A;  4AIU A;  5LOV E;  3AE9 A;  3Q2M A;  2B1E A;  4IHJ E;  2X0H A;  2UUC T;  5DAB A;  2XQ3 A;  4HKA A;  3AVR A;  1YW0 A;  4YFS A;  4AQF A;  5LB7 B;  4U3C A;  5FY7 A;  5AFM A;  3AE3 A;  3FZL B;  4LMJ A;  4JI5 T;  2XAJ B;  4ZEY A;  2NW9 A;  3FZH B;  3PUQ A;  3UU5 A;  5JTG A;  2W8G A;  4TWF A;  2ODV A;  2YOE A;  2D2S A;  2VVN A;  1IBL T;  4B3T T;  3UUM A;  3QUJ A;  3MXZ A;  3CPZ A;  5AFM B;  2VVS A;  5EK3 A;  2FJA A;  1NAF A;  2WU2 A;  4AKG A;  2H7V C;  3BK9 A;  3IGQ A;  3B5M A;  4HE8 A;  3FZK B;  4G2A A;  5J2U E;  3ZT6 A;  1HNW T;  2UXX B;  2BKN A;  5LGT B;  2LSJ A;  3LG7 A;  3OPC A;  5AIN A;  4ZK1 A;  3VR8 A;  4A97 A;  2M67 A;  1MMG A;  2A2F X;  5H6Q B;  3C84 A;  5KMG P;  4DR3 T;  2LOP A;  4ASK A;  2H3R A;  2KND A;  2ZJU A;  5JDL A;  4AKL A;  4EZ1 A;  3CWZ B;  1T8B A;  2BYR A;  3U8M A;  2WWV A;  4IT4 A; 
#chains in the Genus database with same CATH homology
 2WNJ A;  3GUA A;  3RQW A;  2YMD A;  4B5D A;  5LXB A;  4AFG A;  4DBM A;  4NPP A;  5AFK A;  2XQ7 A;  2YKS A;  2LM2 A;  2XYT A;  2XYS A;  3UU4 A;  4IL4 A;  2UZ6 A;  4ZJS A;  2BG9 C;  4ZZB A;  2XNV A;  2Y58 A;  5AFJ A;  4Z91 A;  3UU6 A;  4HFC A;  2WZY A;  4HFD A;  3SQ6 A;  4UY2 A;  3WTJ A;  3UQ4 A;  3U8K A;  5JME A;  3PMZ A;  3JAF A;  2M6I A;  2WNL A;  4NZB A;  5KE4 A;  5L4H A;  4ILA A;  4XK9 A;  5BRX A;  5J5H A;  4TWH A;  2PH9 A;  2BG9 B;  5FJV A;  3WTH A;  2Y7Y A;  2M6B A;  2Y57 A;  2XQ3 A;  4HFE A;  3TLU A;  4HFH A;  5J5G A;  5AFL A;  4ZRU A;  5CO5 A;  3EI0 A;  3TLW A;  4IRE A;  2BYN A;  3TLS A;  3ZDH A;  3EAM A;  2XZ5 A;  3U8J A;  5AFM A;  2BG9 E;  2Y56 A;  3SQ9 A;  5AFH A;  4LMJ A;  4Z90 A;  3UU3 A;  5BW2 A;  2BYQ A;  4QAB A;  4UXU A;  3ZDG A;  5CFB A;  2XNU A;  4PIR A;  5J5F A;  3UU8 A;  3SH1 A;  3U8N A;  2XZ6 A;  3WIP A;  4A98 A;  3JAE A;  2XNT A;  2XQ4 A;  3UU5 A;  3U8L A;  5HEO A;  4COF A;  1OED A;  3C79 A;  2XQ5 A;  2W8G A;  3ZKR A;  5L4E A;  1UW6 A;  4WV9 A;  4ZJT A;  2W8F A;  4TWF A;  2YME A;  4FRR A;  5TVC A;  4QH5 A;  4LMK A;  2YOE A;  4TNW A;  3WTI A;  3WTM A;  3EHZ A;  3JAD A;  4F8H A;  4AFT A;  4ILB A;  2MAW A;  4ALX A;  5AFM B;  3T4M A;  5L47 A;  2XQ9 A;  2QC1 B;  4QH4 A;  3RIF A;  4ZR6 A;  3LSV A;  3WTN A;  1OED C;  4TNV A;  4UM1 A;  5KZU A;  4ZZC A;  4ZK4 A;  4BFQ A;  5HCM A;  3IGQ A;  2BYP A;  5AFN A;  2LKH A;  5HEJ A;  3WTL A;  4HFI A;  5BP0 A;  3RQU A;  4UM3 P;  3RHW A;  4IL9 A;  2Y54 A;  2LKG A;  4QAA A;  2LLY A;  2KSR A;  4X5T A;  5HCJ A;  5IUX A;  5J0Z A;  2WN9 A;  5AIN A;  4UM3 S;  3TLT A;  4ZK1 A;  4QH1 A;  2XQA A;  5HEH A;  5HEG A;  3UQ7 A;  4HQP A;  4A97 A;  3RI5 A;  3UUB A;  1I9B A;  2VL0 A;  5HEU A;  3WTO A;  3RIA A;  2X00 A;  2BR7 A;  5SYO A;  2PGZ A;  3WTK A;  1UX2 A;  2BYS A;  4HFB A;  1OED E;  3C84 A;  4AFH A;  2BJ0 A;  2ZJV A;  3TLV A;  2C9T A;  2XQ6 A;  4ILC A;  2WNC A;  5J5I A;  2BG9 A;  1UV6 A;  3PEO A;  3P50 A;  2X00 D;  2ZJU A;  5LG3 A;  2XQ8 A;  4EZ1 A;  3SIO A;  3P4W A;  4XHE A;  4BQT A;  4LML A;  4TWD A;  2BR8 A;  2YN6 A;  1OED B;  2BYR A;  4UM3 A;  3U8M A;  4D01 A;  4QAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...