4HFCA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to 2-bromo-ethanol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfcA01
5AFLA 3TLTA 3TLSA 2YOEA 5AFMB 5LXBA 2ZJVA 2W8FA 5IUXA 2ZJUA 2XQ7A 4PIRA 2YN6A 5AFHA 5HEOA 4UXUA 5L4EA 4D01A 4Z91A 5BP0A 4TWDA 2Y58A 2M6BA 3RIFA 1UV6A 4F8HA 2BR8A 3WTHA 2XNTA 5AFMA 5KZUA 2XQAA 1I9BA 3GUAA 4B5DA 3U8NA 2BG9A 3WTIA 3RIAA 4ILAA 3WTNA 3WTOA 4UY2A 2BG9B 3C84A 4IL4A 4AFHA 4HFCA 2XZ6A 4AFTA 3SQ9A 3RQWA 5CO5A 4LMKA 3UQ7A 2BG9C 2BYRA 2XQ9A 2KSRA 1OEDE 5JMEA 4TWFA 3PEOA 4AFGA 5J5FA 2LKHA 4HFDA 4QH5A 5AFKA 1OEDA 4ZRUA 3C79A 5J0ZA 3EI0A 5AFJA 5HEJA 4IREA 5L47A 1UW6A 3JAEA 4TNWA 4BFQA 3UQ4A 1OEDB 5J5HA 4HFIA 3UUBA 2PH9A 2XQ3A 2LLYA 5KE4A 1OEDC 2PGZA 2BG9E 2Y56A 2QC1B 4FRRA 4A97A 4QABA 5FJVA 4DBMA 5HCJA 2BR7A 3ZKRA 5J5IA 5LG3A 3WTLA 4UM3S 4BQTA 2BYPA 4ILBA 4ZJSA 3SQ6A 2LM2A 3ZDGA 4HFBA 2WNJA 3LSVA 2M6IA 2WZYA 4XHEA 2WNLA 4IL9A 5TVCA 3UU4A 2Y57A 4ZZCA 4EZ1A 4HFEA 3UU6A 5HCMA 3PMZA 4QACA 4NPPA 4ZK4A 4ZR6A 5BW2A 3WIPA 3RHWA 2XQ6A 1UX2A 2X00A 2Y7YA 5SYOA 3U8JA 2BJ0A 4QH4A 2YMEA 2YKSA 2BYSA 5AFNA 3IGQA 3P50A 4TWHA 5HEUA 4Z90A 2LKGA 3U8MA 3SH1A 4ZZBA 3TLUA 2YMDA 5AINA 2XNUA 4LMJA 2X00D 4QH1A 3SIOA 5L4HA 2XYTA 3WTMA 3U8LA 3T4MA 4LMLA 4UM3A 4UM1A 4HFHA 4ILCA 3TLWA 2BYNA 3ZDHA 4ZK1A 2VL0A 2Y54A 4ZJTA 3EHZA 2XQ4A 4UM3P 4XK9A 3WTJA 2MAWA 5J5GA 3WTKA 2XZ5A 4ALXA 3JAFA 3UU5A 5HEHA 5CFBA 2C9TA 2BYQA 5BRXA 4WV9A 2XNVA 3JADA 4HQPA 2W8GA 3U8KA 4X5TA 4TNVA 2XYSA 3EAMA 3P4WA 3RQUA 4NZBA 4QAAA 2WN9A 3RI5A 2XQ8A 4COFA 3UU8A 4A98A 2WNCA 3TLVA 2UZ6A 2XQ5A 5HEGA 3UU3A
chains in the Genus database with same CATH superfamily
2MOZA 3OPCA 2BR8A 4MFRA 3WI3A 2UU9T 1DU2A 2E2AA 2K3WA 4ILAA 4ZHQE 2NWBA 3GN5B 5GONE 4IE5A 3N9PA 3PTRB 3I1AA 3RQWA 1CHUA 2XQ9A 2WDQA 5FXXA 5LGNB 2FJBA 5JDHA 3PEOA 5J0ZA 4IREA 4QXHB 3UT5E 4TNWA 4UIGA 3PURA 5LHGB 2VWAA 2IC9A 4DR3T 5H6RB 1HNZT 5LOVE 3NKZA 5HAXA 2VVNA 2WU5A 3FBLA 5LJMA 2UXXB 3VKHA 4YFSA 3ZN0B 5ABHA 5JR9B 3PMZA 3PUSA 3ZC0A 3HKEE 4N78D 2YU1A 4DR4T 2WY2A 3P8CD 3ZYMA 4KHZF 5H6QB 1ZHCA 4EOZB 1ZV4X 1V9DA 2FJAA 3AEGA 2Q9QD 3LK2B 3H3AA 2N9DA 4ZJTA 2HPLA 4AIUA 4PJJA 5EZYE 5BRXA 3EDUA 5L3DB 2BYQA 1HR0T 3PJAJ 3A7MA 4PW8A 4QKNA 2Q9QB 3CQXC 3TLVA 5AQOB 3PUWF 2JQ9A 5HEGA 1US7B 1GQEA 4P09A 4UEMA 2V7LA 2KMFA 1XNQT 1O3XA 5HXSA 4O4LE 4X62T 4XBFB 3V5UA 1FIOA 3GUAA 3C50A 2WDVA 3VRBA 5AQLB 4ZXLA 3W15B 4ISSA 5C8YE 2ZM2A 2BYRA 2V6YA 2X66A 3NRXA 4EAHA 4ZRUA 4U2ZA 5J5HA 4ASKA 3AEAA 3FZMB 4FRRA 3FB2A 4YTPA 2WSSV 1WRDA 4P1NA 5F5WA 4GYSA 4UXNB 1HG5A 4Q25A 3L8RA 5A1LA 2X0HA 4ZK4A 1MIWA 2P9BA 3RHWA 2NP9A 1WR0A 4L0RA 5FY7A 4NXNT 2E8IA 3B13A 3E0ZA 2NTYA 3ZMZB 2ACXA 4CN6A 2XAQB 1YD8G 2DWKA 4G2AA 2EHOB 3LJCA 3FHNA 4CXWA 2Y54A 3RGLA 3ZC1A 2XQ4A 1EZ3A 1LVKA 5J2TE 3DP7A 3VKGA 3JADA 4GIWA 2E9XD 4NZBA 2XYSA 1XDPA 2WN9A 3X1DA 2WNCA 2BBHA 2C5KT 1U5PA 5AQPB 4JLEA 1WFDA 2V6XA 1BR4A 2ZM6T 2YOEA 2W4XA 3ONXA 5E0OA 5KDMC 5AFHA 5LJNA 5HEOA 4X1KE 2K24A 2N2NA 2XQAA 4ILUA 4WBOA 4M1PA 4CI1B 5AQJB 2CA5A 2XAGB 1SUMB 3QB5A 5JMEA 4H9NC 3N9OA 1L0VA 2W0GA 3RYFE 4HFDA 1OEDA 5AFJA 3IF8B 2V5CA 2RA1A 1XNRT 3I0OA 2F4VT 2X9YA 2IHR1 4PJLA 2V8SV 3AEDA 4WNKA 4ZS3A 2WP9A 2NW7A 2IIUA 4ZJSA 3ZDGA 3BQLA 3HKBE 4IHJE 4IL9A 4JI0T 4AKHA 3ZSSA 4OK0A 2J4GA 2BKPA 4HE8A 3OVUA 3WAJA 4NIQA 4AQFA 3ZJ2A 1D0XA 3WTMA 3F31A 3C4WA 4XAXB 4AQGA 1KNZA 2H7OA 3QUJA 2VL0A 2E9XA 4DR5T 1KF6A 1M62A 4H63V 5HEHA 2J62A 3KVBA 4TNVA 2WDRA 3Q2MA 4DBRA 3O1IA 4X65T 2W63A 3NZPA 2C5IT 4LF4T 3MA9A 1E1HB 3SWHA 2MYSA 3KV4A 4KBMB 5IUXA 3SRZA 1KNRA 3ZLIA 3UTKA 1I9BA 2AE9A 3V5SA 1UX5A 5AQIB 4AFTA 2AXDS 4DV2T 3ZPOA 4CI2B 4EZHA 5CO5A 2CLYB 2V5DA 3AEFA 2RPAA 3AAEB 5AFKA 2K48A 3CKDA 5IYZE 4IT4A 2W62A 4LFBT 2XAHB 2I6HA 2XSAA 5LXTE 2W00A 4Z8XA 5EK2A 2XAJB 2XTLA 3K3NA 3WAKA 3ETUA 4ILBA 4HWFA 3LG7A 1T72A 3H37A 4HFBA 3GWHA 2SPCA 5DJQC 5FYMA 2C5JA 3RIUC 5FXWA 5JDQA 2XQ6A 3SFEA 4QXCB 1MMNA 2H89A 2DWGA 2LKGA 5L2LA 2XZEA 4IE6A 3TLUA 3MZKB 4LF7T 2JMHA 3ZDHA 2UXNB 1JNRA 2A9UA 2VB6A 3EHZA 2CE7A 5L3EB 2E5VA 4KHPT 3N2GE 2FJDA 2CHOA 3R6NA 4PK5A 5AFMA 4EGWA 3TLTA 3MACA 4A56A 2UUAT 3PE0A 4NUUA 5FP3A 4UV9B 1XDOA 5KZUA 1J5ET 3U8NA 3WTNA 5HXRA 3ZT5A 2BG9B 4AFHA 3PUQA 2XM1A 4MLKA 2JIWA 3PUYF 3PUZF 4QH5A 2XPKA 3EI0A 5HEJA 3LK42 1FMWA 2JQKA 2WQYA 4LF9T 1ZKEA 4B3TT 2LHRA 3HR0A 3KV6A 5AQSB 4TX5A 1YKHB 3ESLA 3AEEA 4YJ2E 2HN2A 4DR7T 2DCFA 2XUEA 5FVLA 1Z8UA 2L9QA 1MIYA 4IDNA 5AQQB 3P4QA 1XMQT 4LF8T 3KVAA 3AE3A 4ZR6A 3KINB 2DNXA 3ANWB 5AQRB 3QK6A 1WLXA 3K1SA 2A72A 4ZZBA 2YMDA 4JI2T 3RLFF 2VL8A 2IC6A 4MALA 3RRWA 3UUNA 2EHOC 4KP3C 4U7YA 3T1YT 4QWNB 4UVCB 3JAFA 1HNXT 2JMKA 4DR2T 3EDVA 4PJNA 3TKLB 1M7KA 3PUVF 4CXXA 1T7SA 2XAFB 1HTJF 2XY8B 3CQCB 2ZJUA 3OKQA 5AQFB 1WYCA 4E7ZA 5L4EA 3AAIA 5CB4E 2XNTA 2CBJA 1LRZA 2VURA 1J1JA 2A3DA 4L5GA 3RRCA 1MMAA 4EB6E 2XZ6A 3RH3A 4MHCA 3U3IA 3AAAB 2ACZA 3A5XA 5JDNA 1UW6A 3JAEA 3UUMA 3C98B 4DNDA 4AQYT 2LLYA 5KE4A 3RC3A 4DV4T 1MNDA 3PV0F 5JDGA 4X66T 2BR7A 2QA7A 5LYJE 4I4TE 2ES0A 4XZCA 2X0YA 3LBXA 5AQMB 2KLQA 2WNLA 5IHYA 4CN4A 5AQTB 4CQIA 2CEAA 5L3CB 2WAUA 1WCRA 1BR2A 3FXDB 4H9RC 4ZI3C 2LHNA 4DMVA 2V7JA 2KWIB 3DTOA 2W61A 3ZYLA 2LSYA 5JRCA 3ZEFB 4HN9A 3ZSTA 3ZMVB 4H63H 4IDQA 4JBWF 3ZMSB 5HXCA 4AXPA 4ISTA 5JQGE 5DABA 1MMDA 3NBXX 2N1GA 2YU2A 4X64T 1OXZA 4UF0B 5AQVB 5LXBA 2XQ7A 1D1AA 2VASA 4UXUA 4PAGA 1UV6A 4O4JE 1AJ3A 3K3OA 3GN5A 2IUBA 4TV8E 1MIVA 5AQUB 3ZMUB 1IBMT 4IL4A 2BKNA 4LMKA 4C90A 2KZ7B 2LSIA 3ZYKA 2XQYA 3AE9A 2CLYC 2LKHA 3VHLA 3RKOA 3AA1B 2M67A 2NW8A 2CHNA 2X67A 3B5MA 2BKOA 3ZKRA 3VR9A 3WTLA 4BQTA 4I43B 3CK6A 5IWAT 5JR9A 2CXLA 2YDSA 2H7VC 3WIPA 1HFAA 2CMRA 2ODVA 5JDLA 4TWHA 3RKGA 4LMJA 3OYZA 3ETVA 4ZK1A 5ETWA 2EHOD 2VKDA 4GOUA 2XHEB 3HKCE 3G06A 1MNEA 4WV9A 3ZN1B 4B3RT 3IA3A 2PG8A 2Q9QA 3EAMA 4P0BA 3RQUA 3J7Yq 3UU8A 4A98A 3L39A 3FZKB 3UU3A 1IBKT 3TLSA 1HS7A 4YSXA 4PJMA 2QGSA 2IW5B 3CMLA 2BDEA 4G63A 4J2CA 3ZJ1A 1NEKA 3RC8A 1UURA 2Y6XA 3UQ7A 2BG9C 3S4UA 3AEBA 2JRKA 3O4XE 4U72A 4TWFA 4B3ST 2NTXA 3CQGB 3O9XA 4EIWA 4BA9A 2WWVA 5CA1E 4BFQA 1W0AA 3M65A 4DVDA 3NRYA 2LEHA 4AKLA 5AQHB 2V26A 1S94A 3AE5A 4U31A 1VRBA 4WBNE 2HH7A 2IDOB 2QVAA 3O1HA 2MPKA 2LM9A 3N2KE 4EXTA 2YMEA 5FXZA 2BYSA 2BS2A 3P50A 4ZI3D 3ONLC 1U4QA 3SIOA 2EHOA 1KNPA 1IJ5A 1YKEB 4LMLA 3AVRA 1N34T 2D2SA 3J9X1 4TV9E 4DR6T 3BK9A 3PJAA 2QYWA 1UUSA 4AI6A 1D1BA 4YSYA 2D0TA 2LRLA 1B7TA 1CUNA 4B3MT 1HG2A 2LJLA 3FXEB 4D01A 2BVLA 3OJAA 2VK9A 4JI8T 2D5UA 3BQKA 4EEDA 5LP6E 4JI3T 1SE7A 4KI0F 4NUVA 2X51A 4AFGA 2CM0A 5J5FA 4DV0T 1ZP0A 5JREA 2PH9A 1ZEEA 3IHRA 1T8BA 1BR0A 3U78A 4H9OC 2H3RA 1E2AA 3ZCJA 1Y01A 4JYAT 5LCYA 3FBZA 2M6IA 3E22E 3UU4A 5HCMA 2FBWA 4UELA 4JEUB 2XJ7A 3U8JA 4QH4A 2X9HA 2YKSA 3IGQA 4IDZA 4Z90A 3D0TA 5HWXA 3PU3A 2YINA 2ZM0A 4QH1A 2NOXA 4O4HE 5AQGB 1T98A 2KNDA 5BMVE 3MK7C 2WS3A 2BBJA 1KEYA 1UX4A 3RF1A 2W8GA 3U8KA 2WCAA 5CGMA 2XQ8A 5C3JA 5EK3A 2UZ6A 2NR4A 4HWCA 4C91A 2CCQA 4YTMA 2NW9A 3RIFA 1R8IA 1G73A 3VU7H 3HL6A 2I59A 3AA7B 4X20E 3FZLB 3RX6A 3AA6B 4JV5T 3PDYA 5FXVA 2XQ3A 2BG9E 2KXPB 4YLHA 4V1Av 4QABA 4ERRA 1W9RA 3AE4A 3C51A 2QRXA 3C64A 2JQQA 3M3ZB 4YHJA 2UUBT 1YQ4A 4H9SE 4JI4T 2OV9A 4HFEA 3FZHB 1YQ3A 2WU2A 4B6XA 1JNZA 3HI2A 2VKOA 1HX1B 1UX2A 1NAFA 2Y7YA 5CJ5A 3BQIA 2ODUA 3RYIE 3N9QA 2PTFA 2C0SA 2DLRA 2E5LT 2X00D 1UK5A 4HFVA 2W67A 5L4HA 3U8LA 4GK0E 3T4MA 2L8KA 4HFHA 4UVAB 2HPJA 5ABFB 3WTJA 5J5GA 4YY3T 2X68A 2H88A 4ZS2A 3UFEA 4IDOA 3Q5XA 2LOPA 4L9IA 3AXJB 3FZFB 3N5LA 3MXZA 2BS3A 4YHHT 2W8FA 1UGOA 3ONJA 4PIRA 4JI7T 1X9BA 5FVKA 5LNKA 4LF5T 4X1YE 2BG9A 3N9LA 3K3QC 1KFYA 3QNUA 4YTNA 4UY2A 5FMNA 4ZOLE 5J1GA 1W0BA 3CX6B 4UVBB 3JCFA 2KSRA 1XMOT 5F8PA 2WBLA 2VKJA 2PJQA 4FI5A 5HCJA 2MBGA 5KMGP 3JC6C 4A5XA 3I0QA 4TUYE 2CWOA 4EYYR 5HXHA 5EK4A 3LSVA 4ZEYA 5JVDE 3CX7B 2Y57A 5LBMA 4QACA 3AE8A 3P7IA 3QC9A 3ANWA 3AA0B 2X00A 5JDMA 3OTOT 5AFNA 3EVYA 2DHRA 1NWMX 3CVRA 4YJ3E 3O1JA 4U2YA 5FY1A 4DUYT 5LBQB 2DL1A 1HF8A 2V7KA 4DBQA 5LA6E 2CRBA 2XZ5A 3UU5A 1FJGT 2R6GF 2L3LA 3Q5DA 4X5TA 4O4IE 1XZYA 4YT0A 4QXBB 2FUPA 2XQ5A 4UM3P 3N9MA 4JEHB 1I6ZA 4AKIA 5C2TA 4DO0A 3ZMTB 5HWYA 3P4RA 4PFOA 5BP0A 4PK4A 3KV5A 4KUMB 2CPTA 4IGUA 2KINB 4B5DA 2YDRA 3C84A 5ADXL 3SS1A 4HFCA 2LSJA 2V6YB 4GK5E 5FY0A 5LB7B 3UUXB 4ZI7E 4IE0A 4ANJA 1MMGA 2PGZA 3Q5EA 2QC1B 3LDQB 5CA0E 2B1EA 4HWHA 4JUYA 5FNVE 1H7CA 4EYUA 5LG3A 3SQ6A 4DV7T 2WNJA 4XHEA 3MKDA 3ABVA 5TAOA 3CX8B 3UU6A 5KXJA 3E08A 3T1HT 1Z0PA 2KT9A 3SH1A 5J2UE 2PBIA 3RIUA 3CWZB 3TLWA 4AKRB 3KFWX 4WYVA 2CWYA 3WTKA 3Q9DA 4ALXA 4AISA 2DI4A 4JI5T 2B76A 2YK0A 4KMCA 1OWAA 2VQFT 4UF0A 5LGUB 3EABA 5AFLA 3VR8A 2UXCT 4UV8B 2YN6A 1LKXA 3HA4A 1IBLT 4Z91A 4HTEA 4TWDA 2M6BA 3R84B 4YSZA 2HHHT 4U33A 1D0ZA 4CXYA 3I9WA 5L3FB 5AQNB 1N33T 4IDPA 2V7MA 1OEDE 2UUCT 5LGTB 4TZ4C 2ZLYA 4DUZT 1OEDB 4HFIA 2G0UA 1HNWT 2Y56A 1X79A 2RP4A 1IAPA 1ZOYA 3AE1A 3JC6D 5AFUL 4UM3S 2KWHA 5JTGA 5TVCA 3PU8A 1WR6A 5LMUT 4IE7A 4QHOA 2K5BB 2LE8A 4CN1A 2FJEA 2IMLA 4I55E 2CBIA 1HX8A 4BJNA 4YXDA 3PUGA 1YW0A 2E9XB 1N32T 5LMNT 3H3MA 3QOFA 4COFA 3NZQA 5KX5E 4QX8B 3RYCE 2V7IA 2ZJVA 2X0LB 3CPZA 1W09A 5DQWA 4U7IA 2I0MA 1IZNB 2XASB 4HKAA 2J1DG 3WTOA 2Y8DA 1S35A 2LSGA 2VQET 5LHHB 5HYAA 2WM9A 5L47A 1VCSA 3RYHE 3UUBA 4X1IE 2ZMAA 3Q5WA 2OLTA 5L3BB 1SA0E 2LRKA 2WMOA 2J47A 4H9QC 4MBQA 3SFDA 2X9XA 1WYBA 4EV6A 3IBPA 2D9DA 4I50E 3IEEA 5BW2A 3AB3B 4ZI2C 2D0UA 4KX6A 4EZ4A 3PUAA 2ZM8A 2BJ0A 2BS4A 5ABEA 2XM2A 4GKKT 3AE6A 4QX7B 3RPUA 5AINA 3MJXA 1QSDA 4DR1T 2XYTA 1HCIA 3UULA 4DMWA 2CXFA 2UXBT 4UM3A 4UM1A 4NXMT 4ILCA 4K0UA 3KBUA 1NENA 4XK9A 5FL0A 2C9TA 5BR8T 2BVMA 4BJMA 3C4XA 5AQKB 5AFMB 1J5WA 4GYRA 3N9NA 2MTQA 2PFVA 2GK9A 4K0KT 2WZIA 3AECA 4F8HA 3WTHA 2OA5A 4HGAA 5ABGA 4GKJT 3RIAA 1SHZC 4LFCT 3SQ9A 3AE2A 1FEWA 4CI3B 2VVSA 4DIDB 3L09A 4IIJE 4HWDA 4UR9A 3C79A 4P0AA 4O8SA 4DV3T 4DV6T 4JI6T 3F2EA 5JR9C 1Y64B 2WMNA 4O2AE 5J5IA 1E7PA 2JJ9A 3ZT7A 1XWMA 3VRAA 4OYJA 2Y48B 4OFZA 3EUHA 4OHFA 2WWUA 5SYOA 3SOLA 5HEUA 5LG4A 1D0YA 2W2UA 2UXDT 2XNUA 4LFAT 2Q9QC 4WZXA 1UCUA 3L3PA 4U74A 5DQVA 2W66A 2BYNA 2HN1A 4AKGA 2YEVC 4WW0A 1IJ6A 4PK6A 3KDSE 4TN7B 4HQPA 3CIRA 3RI5A 4OYKA 1FMVA 3NWIA 4DV1T 4QAAA 3AE7A 3B57A 1D1CA 2YDQA 3GA8A 1QLBA 2Z6EA 2WZHA 2LT3A 3ZCIA 3K8PC 2A2FX 2Y58A 3LFMA 2XSBA 4PNIA 4JI1T 3P4PA 3WTIA 4PFPA 1N36T 5HXEA 4HWIB 4HEAA 4U3CA 3I9YA 5F3JA 3T8OA 3OYXA 1I94T 3P4SA 3UQ4A 4OX9T 3NVOA 2LSKA 3KV9A 3N2OA 4LF6T 3F57A 4FJOA 1OEDC 2V1DB 4DV5T 3ZT6A 4A97A 5FJVA 4DBMA 1VCTA 4EEBA 3KBTA 4E7SA 5FL1A 3A8YC 3GMIA 4ADZA 2BYPA 4F6RC 2WB5A 2BZBA 2LM2A 3OBVE 2WZYA 3LK3B 3LBXB 4O2BE 4ZZCA 1QUUA 4EZ1A 2CXDA 4NPPA 5LHIB 4ZI2D 5JDFA 5JH7E 3AVSA 4H9PC 3U8MA 3HKDE 4I0UA 2LOSA 1YXRA 2K9AA 2VKHA 5JRCB 2IAKA 4AQFC 5ABFA 3PUXF 3UFGA 1VOMA 2MAWA 5L3GB 1BR1A 5CFBA 4CZZB 1KK7A 2XNVA 2E9XC 5M4YA 3AXJA 3P4WA 1LVFA 5FKYA 2JQHA 3C4ZA 1G8XA 4BAYB 2X9WA 3QB5K 2JPFA 3DJBA 4IE4A
chains in the Genus database with same CATH topology
5AFLA 3TLTA 3TLSA 2YOEA 5AFMB 5LXBA 2ZJVA 2W8FA 5IUXA 2ZJUA 2XQ7A 4PIRA 2YN6A 5AFHA 5HEOA 4UXUA 5L4EA 4D01A 4Z91A 5BP0A 4TWDA 2Y58A 2M6BA 3RIFA 1UV6A 4F8HA 2BR8A 3WTHA 2XNTA 5AFMA 5KZUA 2XQAA 1I9BA 3GUAA 4B5DA 3U8NA 2BG9A 3WTIA 3RIAA 4ILAA 3WTNA 3WTOA 4UY2A 2BG9B 3C84A 4IL4A 4AFHA 4HFCA 2XZ6A 4AFTA 3SQ9A 3RQWA 5CO5A 4LMKA 3UQ7A 2BG9C 2BYRA 2XQ9A 2KSRA 1OEDE 5JMEA 4TWFA 3PEOA 4AFGA 5J5FA 2LKHA 4HFDA 4QH5A 5AFKA 1OEDA 4ZRUA 3C79A 5J0ZA 3EI0A 5AFJA 5HEJA 4IREA 5L47A 1UW6A 3JAEA 4TNWA 4BFQA 3UQ4A 1OEDB 5J5HA 4HFIA 3UUBA 2PH9A 2XQ3A 2LLYA 5KE4A 1OEDC 2PGZA 2BG9E 2Y56A 2QC1B 4FRRA 4A97A 4QABA 5FJVA 4DBMA 5HCJA 2BR7A 3ZKRA 5J5IA 5LG3A 3WTLA 4UM3S 4BQTA 2BYPA 4ILBA 4ZJSA 3SQ6A 2LM2A 3ZDGA 4HFBA 2WNJA 3LSVA 2M6IA 2WZYA 4XHEA 2WNLA 4IL9A 5TVCA 3UU4A 2Y57A 4ZZCA 4EZ1A 4HFEA 3UU6A 5HCMA 3PMZA 4QACA 4NPPA 4ZK4A 4ZR6A 5BW2A 3WIPA 3RHWA 2XQ6A 1UX2A 2X00A 2Y7YA 5SYOA 3U8JA 2BJ0A 4QH4A 2YMEA 2YKSA 2BYSA 5AFNA 3IGQA 3P50A 4TWHA 5HEUA 4Z90A 2LKGA 3U8MA 3SH1A 4ZZBA 3TLUA 2YMDA 5AINA 2XNUA 4LMJA 2X00D 4QH1A 3SIOA 5L4HA 2XYTA 3WTMA 3U8LA 3T4MA 4LMLA 4UM3A 4UM1A 4HFHA 4ILCA 3TLWA 2BYNA 3ZDHA 4ZK1A 2VL0A 2Y54A 4ZJTA 3EHZA 2XQ4A 4UM3P 4XK9A 3WTJA 2MAWA 5J5GA 3WTKA 2XZ5A 4ALXA 3JAFA 3UU5A 5HEHA 5CFBA 2C9TA 2BYQA 5BRXA 4WV9A 2XNVA 3JADA 4HQPA 2W8GA 3U8KA 4X5TA 4TNVA 2XYSA 3EAMA 3P4WA 3RQUA 4NZBA 4QAAA 2WN9A 3RI5A 2XQ8A 4COFA 3UU8A 4A98A 2WNCA 3TLVA 2UZ6A 2XQ5A 5HEGA 3UU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFL A;  3TLT A;  3TLS A;  2YOE A;  5AFM B;  5LXB A;  2ZJV A;  2W8F A;  5IUX A;  2ZJU A;  2XQ7 A;  4PIR A;  2YN6 A;  5AFH A;  5HEO A;  4UXU A;  5L4E A;  4D01 A;  4Z91 A;  5BP0 A;  4TWD A;  2Y58 A;  2M6B A;  3RIF A;  1UV6 A;  4F8H A;  2BR8 A;  3WTH A;  2XNT A;  5AFM A;  5KZU A;  2XQA A;  1I9B A;  3GUA A;  4B5D A;  3U8N A;  2BG9 A;  3WTI A;  3RIA A;  4ILA A;  3WTN A;  3WTO A;  4UY2 A;  2BG9 B;  3C84 A;  4IL4 A;  4AFH A;  4HFC A;  2XZ6 A;  4AFT A;  3SQ9 A;  3RQW A;  5CO5 A;  4LMK A;  3UQ7 A;  2BG9 C;  2BYR A;  2XQ9 A;  2KSR A;  1OED E;  5JME A;  4TWF A;  3PEO A;  4AFG A;  5J5F A;  2LKH A;  4HFD A;  4QH5 A;  5AFK A;  1OED A;  4ZRU A;  3C79 A;  5J0Z A;  3EI0 A;  5AFJ A;  5HEJ A;  4IRE A;  5L47 A;  1UW6 A;  3JAE A;  4TNW A;  4BFQ A;  3UQ4 A;  1OED B;  5J5H A;  4HFI A;  3UUB A;  2PH9 A;  2XQ3 A;  2LLY A;  5KE4 A;  1OED C;  2PGZ A;  2BG9 E;  2Y56 A;  2QC1 B;  4FRR A;  4A97 A;  4QAB A;  5FJV A;  4DBM A;  5HCJ A;  2BR7 A;  3ZKR A;  5J5I A;  5LG3 A;  3WTL A;  4UM3 S;  4BQT A;  2BYP A;  4ILB A;  4ZJS A;  3SQ6 A;  2LM2 A;  3ZDG A;  4HFB A;  2WNJ A;  3LSV A;  2M6I A;  2WZY A;  4XHE A;  2WNL A;  4IL9 A;  5TVC A;  3UU4 A;  2Y57 A;  4ZZC A;  4EZ1 A;  4HFE A;  3UU6 A;  5HCM A;  3PMZ A;  4QAC A;  4NPP A;  4ZK4 A;  4ZR6 A;  5BW2 A;  3WIP A;  3RHW A;  2XQ6 A;  1UX2 A;  2X00 A;  2Y7Y A;  5SYO A;  3U8J A;  2BJ0 A;  4QH4 A;  2YME A;  2YKS A;  2BYS A;  5AFN A;  3IGQ A;  3P50 A;  4TWH A;  5HEU A;  4Z90 A;  2LKG A;  3U8M A;  3SH1 A;  4ZZB A;  3TLU A;  2YMD A;  5AIN A;  2XNU A;  4LMJ A;  2X00 D;  4QH1 A;  3SIO A;  5L4H A;  2XYT A;  3WTM A;  3U8L A;  3T4M A;  4LML A;  4UM3 A;  4UM1 A;  4HFH A;  4ILC A;  3TLW A;  2BYN A;  3ZDH A;  4ZK1 A;  2VL0 A;  2Y54 A;  4ZJT A;  3EHZ A;  2XQ4 A;  4UM3 P;  4XK9 A;  3WTJ A;  2MAW A;  5J5G A;  3WTK A;  2XZ5 A;  4ALX A;  3JAF A;  3UU5 A;  5HEH A;  5CFB A;  2C9T A;  2BYQ A;  5BRX A;  4WV9 A;  2XNV A;  3JAD A;  4HQP A;  2W8G A;  3U8K A;  4X5T A;  4TNV A;  2XYS A;  3EAM A;  3P4W A;  3RQU A;  4NZB A;  4QAA A;  2WN9 A;  3RI5 A;  2XQ8 A;  4COF A;  3UU8 A;  4A98 A;  2WNC A;  3TLV A;  2UZ6 A;  2XQ5 A;  5HEG A;  3UU3 A; 
#chains in the Genus database with same CATH topology
 2MOZ A;  3OPC A;  2BR8 A;  4MFR A;  3WI3 A;  2UU9 T;  1DU2 A;  2E2A A;  2K3W A;  4ILA A;  4ZHQ E;  2NWB A;  3GN5 B;  5GON E;  4IE5 A;  3N9P A;  3PTR B;  3I1A A;  3RQW A;  1CHU A;  2XQ9 A;  2WDQ A;  5FXX A;  5LGN B;  2FJB A;  5JDH A;  3PEO A;  5J0Z A;  4IRE A;  4QXH B;  3UT5 E;  4TNW A;  4UIG A;  3PUR A;  5LHG B;  2VWA A;  2IC9 A;  4DR3 T;  5H6R B;  1HNZ T;  5LOV E;  3NKZ A;  5HAX A;  2VVN A;  2WU5 A;  3FBL A;  5LJM A;  2UXX B;  3VKH A;  4YFS A;  3ZN0 B;  5ABH A;  5JR9 B;  3PMZ A;  3PUS A;  3ZC0 A;  3HKE E;  4N78 D;  2YU1 A;  4DR4 T;  2WY2 A;  3P8C D;  3ZYM A;  4KHZ F;  5H6Q B;  1ZHC A;  4EOZ B;  1ZV4 X;  1V9D A;  2FJA A;  3AEG A;  2Q9Q D;  3LK2 B;  3H3A A;  2N9D A;  4ZJT A;  2HPL A;  4AIU A;  4PJJ A;  5EZY E;  5BRX A;  3EDU A;  5L3D B;  2BYQ A;  1HR0 T;  3PJA J;  3A7M A;  4PW8 A;  4QKN A;  2Q9Q B;  3CQX C;  3TLV A;  5AQO B;  3PUW F;  2JQ9 A;  5HEG A;  1US7 B;  1GQE A;  4P09 A;  4UEM A;  2V7L A;  2KMF A;  1XNQ T;  1O3X A;  5HXS A;  4O4L E;  4X62 T;  4XBF B;  3V5U A;  1FIO A;  3GUA A;  3C50 A;  2WDV A;  3VRB A;  5AQL B;  4ZXL A;  3W15 B;  4ISS A;  5C8Y E;  2ZM2 A;  2BYR A;  2V6Y A;  2X66 A;  3NRX A;  4EAH A;  4ZRU A;  4U2Z A;  5J5H A;  4ASK A;  3AEA A;  3FZM B;  4FRR A;  3FB2 A;  4YTP A;  2WSS V;  1WRD A;  4P1N A;  5F5W A;  4GYS A;  4UXN B;  1HG5 A;  4Q25 A;  3L8R A;  5A1L A;  2X0H A;  4ZK4 A;  1MIW A;  2P9B A;  3RHW A;  2NP9 A;  1WR0 A;  4L0R A;  5FY7 A;  4NXN T;  2E8I A;  3B13 A;  3E0Z A;  2NTY A;  3ZMZ B;  2ACX A;  4CN6 A;  2XAQ B;  1YD8 G;  2DWK A;  4G2A A;  2EHO B;  3LJC A;  3FHN A;  4CXW A;  2Y54 A;  3RGL A;  3ZC1 A;  2XQ4 A;  1EZ3 A;  1LVK A;  5J2T E;  3DP7 A;  3VKG A;  3JAD A;  4GIW A;  2E9X D;  4NZB A;  2XYS A;  1XDP A;  2WN9 A;  3X1D A;  2WNC A;  2BBH A;  2C5K T;  1U5P A;  5AQP B;  4JLE A;  1WFD A;  2V6X A;  1BR4 A;  2ZM6 T;  2YOE A;  2W4X A;  3ONX A;  5E0O A;  5KDM C;  5AFH A;  5LJN A;  5HEO A;  4X1K E;  2K24 A;  2N2N A;  2XQA A;  4ILU A;  4WBO A;  4M1P A;  4CI1 B;  5AQJ B;  2CA5 A;  2XAG B;  1SUM B;  3QB5 A;  5JME A;  4H9N C;  3N9O A;  1L0V A;  2W0G A;  3RYF E;  4HFD A;  1OED A;  5AFJ A;  3IF8 B;  2V5C A;  2RA1 A;  1XNR T;  3I0O A;  2F4V T;  2X9Y A;  2IHR 1;  4PJL A;  2V8S V;  3AED A;  4WNK A;  4ZS3 A;  2WP9 A;  2NW7 A;  2IIU A;  4ZJS A;  3ZDG A;  3BQL A;  3HKB E;  4IHJ E;  4IL9 A;  4JI0 T;  4AKH A;  3ZSS A;  4OK0 A;  2J4G A;  2BKP A;  4HE8 A;  3OVU A;  3WAJ A;  4NIQ A;  4AQF A;  3ZJ2 A;  1D0X A;  3WTM A;  3F31 A;  3C4W A;  4XAX B;  4AQG A;  1KNZ A;  2H7O A;  3QUJ A;  2VL0 A;  2E9X A;  4DR5 T;  1KF6 A;  1M62 A;  4H63 V;  5HEH A;  2J62 A;  3KVB A;  4TNV A;  2WDR A;  3Q2M A;  4DBR A;  3O1I A;  4X65 T;  2W63 A;  3NZP A;  2C5I T;  4LF4 T;  3MA9 A;  1E1H B;  3SWH A;  2MYS A;  3KV4 A;  4KBM B;  5IUX A;  3SRZ A;  1KNR A;  3ZLI A;  3UTK A;  1I9B A;  2AE9 A;  3V5S A;  1UX5 A;  5AQI B;  4AFT A;  2AXD S;  4DV2 T;  3ZPO A;  4CI2 B;  4EZH A;  5CO5 A;  2CLY B;  2V5D A;  3AEF A;  2RPA A;  3AAE B;  5AFK A;  2K48 A;  3CKD A;  5IYZ E;  4IT4 A;  2W62 A;  4LFB T;  2XAH B;  2I6H A;  2XSA A;  5LXT E;  2W00 A;  4Z8X A;  5EK2 A;  2XAJ B;  2XTL A;  3K3N A;  3WAK A;  3ETU A;  4ILB A;  4HWF A;  3LG7 A;  1T72 A;  3H37 A;  4HFB A;  3GWH A;  2SPC A;  5DJQ C;  5FYM A;  2C5J A;  3RIU C;  5FXW A;  5JDQ A;  2XQ6 A;  3SFE A;  4QXC B;  1MMN A;  2H89 A;  2DWG A;  2LKG A;  5L2L A;  2XZE A;  4IE6 A;  3TLU A;  3MZK B;  4LF7 T;  2JMH A;  3ZDH A;  2UXN B;  1JNR A;  2A9U A;  2VB6 A;  3EHZ A;  2CE7 A;  5L3E B;  2E5V A;  4KHP T;  3N2G E;  2FJD A;  2CHO A;  3R6N A;  4PK5 A;  5AFM A;  4EGW A;  3TLT A;  3MAC A;  4A56 A;  2UUA T;  3PE0 A;  4NUU A;  5FP3 A;  4UV9 B;  1XDO A;  5KZU A;  1J5E T;  3U8N A;  3WTN A;  5HXR A;  3ZT5 A;  2BG9 B;  4AFH A;  3PUQ A;  2XM1 A;  4MLK A;  2JIW A;  3PUY F;  3PUZ F;  4QH5 A;  2XPK A;  3EI0 A;  5HEJ A;  3LK4 2;  1FMW A;  2JQK A;  2WQY A;  4LF9 T;  1ZKE A;  4B3T T;  2LHR A;  3HR0 A;  3KV6 A;  5AQS B;  4TX5 A;  1YKH B;  3ESL A;  3AEE A;  4YJ2 E;  2HN2 A;  4DR7 T;  2DCF A;  2XUE A;  5FVL A;  1Z8U A;  2L9Q A;  1MIY A;  4IDN A;  5AQQ B;  3P4Q A;  1XMQ T;  4LF8 T;  3KVA A;  3AE3 A;  4ZR6 A;  3KIN B;  2DNX A;  3ANW B;  5AQR B;  3QK6 A;  1WLX A;  3K1S A;  2A72 A;  4ZZB A;  2YMD A;  4JI2 T;  3RLF F;  2VL8 A;  2IC6 A;  4MAL A;  3RRW A;  3UUN A;  2EHO C;  4KP3 C;  4U7Y A;  3T1Y T;  4QWN B;  4UVC B;  3JAF A;  1HNX T;  2JMK A;  4DR2 T;  3EDV A;  4PJN A;  3TKL B;  1M7K A;  3PUV F;  4CXX A;  1T7S A;  2XAF B;  1HTJ F;  2XY8 B;  3CQC B;  2ZJU A;  3OKQ A;  5AQF B;  1WYC A;  4E7Z A;  5L4E A;  3AAI A;  5CB4 E;  2XNT A;  2CBJ A;  1LRZ A;  2VUR A;  1J1J A;  2A3D A;  4L5G A;  3RRC A;  1MMA A;  4EB6 E;  2XZ6 A;  3RH3 A;  4MHC A;  3U3I A;  3AAA B;  2ACZ A;  3A5X A;  5JDN A;  1UW6 A;  3JAE A;  3UUM A;  3C98 B;  4DND A;  4AQY T;  2LLY A;  5KE4 A;  3RC3 A;  4DV4 T;  1MND A;  3PV0 F;  5JDG A;  4X66 T;  2BR7 A;  2QA7 A;  5LYJ E;  4I4T E;  2ES0 A;  4XZC A;  2X0Y A;  3LBX A;  5AQM B;  2KLQ A;  2WNL A;  5IHY A;  4CN4 A;  5AQT B;  4CQI A;  2CEA A;  5L3C B;  2WAU A;  1WCR A;  1BR2 A;  3FXD B;  4H9R C;  4ZI3 C;  2LHN A;  4DMV A;  2V7J A;  2KWI B;  3DTO A;  2W61 A;  3ZYL A;  2LSY A;  5JRC A;  3ZEF B;  4HN9 A;  3ZST A;  3ZMV B;  4H63 H;  4IDQ A;  4JBW F;  3ZMS B;  5HXC A;  4AXP A;  4IST A;  5JQG E;  5DAB A;  1MMD A;  3NBX X;  2N1G A;  2YU2 A;  4X64 T;  1OXZ A;  4UF0 B;  5AQV B;  5LXB A;  2XQ7 A;  1D1A A;  2VAS A;  4UXU A;  4PAG A;  1UV6 A;  4O4J E;  1AJ3 A;  3K3O A;  3GN5 A;  2IUB A;  4TV8 E;  1MIV A;  5AQU B;  3ZMU B;  1IBM T;  4IL4 A;  2BKN A;  4LMK A;  4C90 A;  2KZ7 B;  2LSI A;  3ZYK A;  2XQY A;  3AE9 A;  2CLY C;  2LKH A;  3VHL A;  3RKO A;  3AA1 B;  2M67 A;  2NW8 A;  2CHN A;  2X67 A;  3B5M A;  2BKO A;  3ZKR A;  3VR9 A;  3WTL A;  4BQT A;  4I43 B;  3CK6 A;  5IWA T;  5JR9 A;  2CXL A;  2YDS A;  2H7V C;  3WIP A;  1HFA A;  2CMR A;  2ODV A;  5JDL A;  4TWH A;  3RKG A;  4LMJ A;  3OYZ A;  3ETV A;  4ZK1 A;  5ETW A;  2EHO D;  2VKD A;  4GOU A;  2XHE B;  3HKC E;  3G06 A;  1MNE A;  4WV9 A;  3ZN1 B;  4B3R T;  3IA3 A;  2PG8 A;  2Q9Q A;  3EAM A;  4P0B A;  3RQU A;  3J7Y q;  3UU8 A;  4A98 A;  3L39 A;  3FZK B;  3UU3 A;  1IBK T;  3TLS A;  1HS7 A;  4YSX A;  4PJM A;  2QGS A;  2IW5 B;  3CML A;  2BDE A;  4G63 A;  4J2C A;  3ZJ1 A;  1NEK A;  3RC8 A;  1UUR A;  2Y6X A;  3UQ7 A;  2BG9 C;  3S4U A;  3AEB A;  2JRK A;  3O4X E;  4U72 A;  4TWF A;  4B3S T;  2NTX A;  3CQG B;  3O9X A;  4EIW A;  4BA9 A;  2WWV A;  5CA1 E;  4BFQ A;  1W0A A;  3M65 A;  4DVD A;  3NRY A;  2LEH A;  4AKL A;  5AQH B;  2V26 A;  1S94 A;  3AE5 A;  4U31 A;  1VRB A;  4WBN E;  2HH7 A;  2IDO B;  2QVA A;  3O1H A;  2MPK A;  2LM9 A;  3N2K E;  4EXT A;  2YME A;  5FXZ A;  2BYS A;  2BS2 A;  3P50 A;  4ZI3 D;  3ONL C;  1U4Q A;  3SIO A;  2EHO A;  1KNP A;  1IJ5 A;  1YKE B;  4LML A;  3AVR A;  1N34 T;  2D2S A;  3J9X 1;  4TV9 E;  4DR6 T;  3BK9 A;  3PJA A;  2QYW A;  1UUS A;  4AI6 A;  1D1B A;  4YSY A;  2D0T A;  2LRL A;  1B7T A;  1CUN A;  4B3M T;  1HG2 A;  2LJL A;  3FXE B;  4D01 A;  2BVL A;  3OJA A;  2VK9 A;  4JI8 T;  2D5U A;  3BQK A;  4EED A;  5LP6 E;  4JI3 T;  1SE7 A;  4KI0 F;  4NUV A;  2X51 A;  4AFG A;  2CM0 A;  5J5F A;  4DV0 T;  1ZP0 A;  5JRE A;  2PH9 A;  1ZEE A;  3IHR A;  1T8B A;  1BR0 A;  3U78 A;  4H9O C;  2H3R A;  1E2A A;  3ZCJ A;  1Y01 A;  4JYA T;  5LCY A;  3FBZ A;  2M6I A;  3E22 E;  3UU4 A;  5HCM A;  2FBW A;  4UEL A;  4JEU B;  2XJ7 A;  3U8J A;  4QH4 A;  2X9H A;  2YKS A;  3IGQ A;  4IDZ A;  4Z90 A;  3D0T A;  5HWX A;  3PU3 A;  2YIN A;  2ZM0 A;  4QH1 A;  2NOX A;  4O4H E;  5AQG B;  1T98 A;  2KND A;  5BMV E;  3MK7 C;  2WS3 A;  2BBJ A;  1KEY A;  1UX4 A;  3RF1 A;  2W8G A;  3U8K A;  2WCA A;  5CGM A;  2XQ8 A;  5C3J A;  5EK3 A;  2UZ6 A;  2NR4 A;  4HWC A;  4C91 A;  2CCQ A;  4YTM A;  2NW9 A;  3RIF A;  1R8I A;  1G73 A;  3VU7 H;  3HL6 A;  2I59 A;  3AA7 B;  4X20 E;  3FZL B;  3RX6 A;  3AA6 B;  4JV5 T;  3PDY A;  5FXV A;  2XQ3 A;  2BG9 E;  2KXP B;  4YLH A;  4V1A v;  4QAB A;  4ERR A;  1W9R A;  3AE4 A;  3C51 A;  2QRX A;  3C64 A;  2JQQ A;  3M3Z B;  4YHJ A;  2UUB T;  1YQ4 A;  4H9S E;  4JI4 T;  2OV9 A;  4HFE A;  3FZH B;  1YQ3 A;  2WU2 A;  4B6X A;  1JNZ A;  3HI2 A;  2VKO A;  1HX1 B;  1UX2 A;  1NAF A;  2Y7Y A;  5CJ5 A;  3BQI A;  2ODU A;  3RYI E;  3N9Q A;  2PTF A;  2C0S A;  2DLR A;  2E5L T;  2X00 D;  1UK5 A;  4HFV A;  2W67 A;  5L4H A;  3U8L A;  4GK0 E;  3T4M A;  2L8K A;  4HFH A;  4UVA B;  2HPJ A;  5ABF B;  3WTJ A;  5J5G A;  4YY3 T;  2X68 A;  2H88 A;  4ZS2 A;  3UFE A;  4IDO A;  3Q5X A;  2LOP A;  4L9I A;  3AXJ B;  3FZF B;  3N5L A;  3MXZ A;  2BS3 A;  4YHH T;  2W8F A;  1UGO A;  3ONJ A;  4PIR A;  4JI7 T;  1X9B A;  5FVK A;  5LNK A;  4LF5 T;  4X1Y E;  2BG9 A;  3N9L A;  3K3Q C;  1KFY A;  3QNU A;  4YTN A;  4UY2 A;  5FMN A;  4ZOL E;  5J1G A;  1W0B A;  3CX6 B;  4UVB B;  3JCF A;  2KSR A;  1XMO T;  5F8P A;  2WBL A;  2VKJ A;  2PJQ A;  4FI5 A;  5HCJ A;  2MBG A;  5KMG P;  3JC6 C;  4A5X A;  3I0Q A;  4TUY E;  2CWO A;  4EYY R;  5HXH A;  5EK4 A;  3LSV A;  4ZEY A;  5JVD E;  3CX7 B;  2Y57 A;  5LBM A;  4QAC A;  3AE8 A;  3P7I A;  3QC9 A;  3ANW A;  3AA0 B;  2X00 A;  5JDM A;  3OTO T;  5AFN A;  3EVY A;  2DHR A;  1NWM X;  3CVR A;  4YJ3 E;  3O1J A;  4U2Y A;  5FY1 A;  4DUY T;  5LBQ B;  2DL1 A;  1HF8 A;  2V7K A;  4DBQ A;  5LA6 E;  2CRB A;  2XZ5 A;  3UU5 A;  1FJG T;  2R6G F;  2L3L A;  3Q5D A;  4X5T A;  4O4I E;  1XZY A;  4YT0 A;  4QXB B;  2FUP A;  2XQ5 A;  4UM3 P;  3N9M A;  4JEH B;  1I6Z A;  4AKI A;  5C2T A;  4DO0 A;  3ZMT B;  5HWY A;  3P4R A;  4PFO A;  5BP0 A;  4PK4 A;  3KV5 A;  4KUM B;  2CPT A;  4IGU A;  2KIN B;  4B5D A;  2YDR A;  3C84 A;  5ADX L;  3SS1 A;  4HFC A;  2LSJ A;  2V6Y B;  4GK5 E;  5FY0 A;  5LB7 B;  3UUX B;  4ZI7 E;  4IE0 A;  4ANJ A;  1MMG A;  2PGZ A;  3Q5E A;  2QC1 B;  3LDQ B;  5CA0 E;  2B1E A;  4HWH A;  4JUY A;  5FNV E;  1H7C A;  4EYU A;  5LG3 A;  3SQ6 A;  4DV7 T;  2WNJ A;  4XHE A;  3MKD A;  3ABV A;  5TAO A;  3CX8 B;  3UU6 A;  5KXJ A;  3E08 A;  3T1H T;  1Z0P A;  2KT9 A;  3SH1 A;  5J2U E;  2PBI A;  3RIU A;  3CWZ B;  3TLW A;  4AKR B;  3KFW X;  4WYV A;  2CWY A;  3WTK A;  3Q9D A;  4ALX A;  4AIS A;  2DI4 A;  4JI5 T;  2B76 A;  2YK0 A;  4KMC A;  1OWA A;  2VQF T;  4UF0 A;  5LGU B;  3EAB A;  5AFL A;  3VR8 A;  2UXC T;  4UV8 B;  2YN6 A;  1LKX A;  3HA4 A;  1IBL T;  4Z91 A;  4HTE A;  4TWD A;  2M6B A;  3R84 B;  4YSZ A;  2HHH T;  4U33 A;  1D0Z A;  4CXY A;  3I9W A;  5L3F B;  5AQN B;  1N33 T;  4IDP A;  2V7M A;  1OED E;  2UUC T;  5LGT B;  4TZ4 C;  2ZLY A;  4DUZ T;  1OED B;  4HFI A;  2G0U A;  1HNW T;  2Y56 A;  1X79 A;  2RP4 A;  1IAP A;  1ZOY A;  3AE1 A;  3JC6 D;  5AFU L;  4UM3 S;  2KWH A;  5JTG A;  5TVC A;  3PU8 A;  1WR6 A;  5LMU T;  4IE7 A;  4QHO A;  2K5B B;  2LE8 A;  4CN1 A;  2FJE A;  2IML A;  4I55 E;  2CBI A;  1HX8 A;  4BJN A;  4YXD A;  3PUG A;  1YW0 A;  2E9X B;  1N32 T;  5LMN T;  3H3M A;  3QOF A;  4COF A;  3NZQ A;  5KX5 E;  4QX8 B;  3RYC E;  2V7I A;  2ZJV A;  2X0L B;  3CPZ A;  1W09 A;  5DQW A;  4U7I A;  2I0M A;  1IZN B;  2XAS B;  4HKA A;  2J1D G;  3WTO A;  2Y8D A;  1S35 A;  2LSG A;  2VQE T;  5LHH B;  5HYA A;  2WM9 A;  5L47 A;  1VCS A;  3RYH E;  3UUB A;  4X1I E;  2ZMA A;  3Q5W A;  2OLT A;  5L3B B;  1SA0 E;  2LRK A;  2WMO A;  2J47 A;  4H9Q C;  4MBQ A;  3SFD A;  2X9X A;  1WYB A;  4EV6 A;  3IBP A;  2D9D A;  4I50 E;  3IEE A;  5BW2 A;  3AB3 B;  4ZI2 C;  2D0U A;  4KX6 A;  4EZ4 A;  3PUA A;  2ZM8 A;  2BJ0 A;  2BS4 A;  5ABE A;  2XM2 A;  4GKK T;  3AE6 A;  4QX7 B;  3RPU A;  5AIN A;  3MJX A;  1QSD A;  4DR1 T;  2XYT A;  1HCI A;  3UUL A;  4DMW A;  2CXF A;  2UXB T;  4UM3 A;  4UM1 A;  4NXM T;  4ILC A;  4K0U A;  3KBU A;  1NEN A;  4XK9 A;  5FL0 A;  2C9T A;  5BR8 T;  2BVM A;  4BJM A;  3C4X A;  5AQK B;  5AFM B;  1J5W A;  4GYR A;  3N9N A;  2MTQ A;  2PFV A;  2GK9 A;  4K0K T;  2WZI A;  3AEC A;  4F8H A;  3WTH A;  2OA5 A;  4HGA A;  5ABG A;  4GKJ T;  3RIA A;  1SHZ C;  4LFC T;  3SQ9 A;  3AE2 A;  1FEW A;  4CI3 B;  2VVS A;  4DID B;  3L09 A;  4IIJ E;  4HWD A;  4UR9 A;  3C79 A;  4P0A A;  4O8S A;  4DV3 T;  4DV6 T;  4JI6 T;  3F2E A;  5JR9 C;  1Y64 B;  2WMN A;  4O2A E;  5J5I A;  1E7P A;  2JJ9 A;  3ZT7 A;  1XWM A;  3VRA A;  4OYJ A;  2Y48 B;  4OFZ A;  3EUH A;  4OHF A;  2WWU A;  5SYO A;  3SOL A;  5HEU A;  5LG4 A;  1D0Y A;  2W2U A;  2UXD T;  2XNU A;  4LFA T;  2Q9Q C;  4WZX A;  1UCU A;  3L3P A;  4U74 A;  5DQV A;  2W66 A;  2BYN A;  2HN1 A;  4AKG A;  2YEV C;  4WW0 A;  1IJ6 A;  4PK6 A;  3KDS E;  4TN7 B;  4HQP A;  3CIR A;  3RI5 A;  4OYK A;  1FMV A;  3NWI A;  4DV1 T;  4QAA A;  3AE7 A;  3B57 A;  1D1C A;  2YDQ A;  3GA8 A;  1QLB A;  2Z6E A;  2WZH A;  2LT3 A;  3ZCI A;  3K8P C;  2A2F X;  2Y58 A;  3LFM A;  2XSB A;  4PNI A;  4JI1 T;  3P4P A;  3WTI A;  4PFP A;  1N36 T;  5HXE A;  4HWI B;  4HEA A;  4U3C A;  3I9Y A;  5F3J A;  3T8O A;  3OYX A;  1I94 T;  3P4S A;  3UQ4 A;  4OX9 T;  3NVO A;  2LSK A;  3KV9 A;  3N2O A;  4LF6 T;  3F57 A;  4FJO A;  1OED C;  2V1D B;  4DV5 T;  3ZT6 A;  4A97 A;  5FJV A;  4DBM A;  1VCT A;  4EEB A;  3KBT A;  4E7S A;  5FL1 A;  3A8Y C;  3GMI A;  4ADZ A;  2BYP A;  4F6R C;  2WB5 A;  2BZB A;  2LM2 A;  3OBV E;  2WZY A;  3LK3 B;  3LBX B;  4O2B E;  4ZZC A;  1QUU A;  4EZ1 A;  2CXD A;  4NPP A;  5LHI B;  4ZI2 D;  5JDF A;  5JH7 E;  3AVS A;  4H9P C;  3U8M A;  3HKD E;  4I0U A;  2LOS A;  1YXR A;  2K9A A;  2VKH A;  5JRC B;  2IAK A;  4AQF C;  5ABF A;  3PUX F;  3UFG A;  1VOM A;  2MAW A;  5L3G B;  1BR1 A;  5CFB A;  4CZZ B;  1KK7 A;  2XNV A;  2E9X C;  5M4Y A;  3AXJ A;  3P4W A;  1LVF A;  5FKY A;  2JQH A;  3C4Z A;  1G8X A;  4BAY B;  2X9W A;  3QB5 K;  2JPF A;  3DJB A;  4IE4 A; 
#chains in the Genus database with same CATH homology
 5AFL A;  3TLT A;  3TLS A;  2YOE A;  5AFM B;  5LXB A;  2ZJV A;  2W8F A;  5IUX A;  2ZJU A;  2XQ7 A;  4PIR A;  2YN6 A;  5AFH A;  5HEO A;  4UXU A;  5L4E A;  4D01 A;  4Z91 A;  5BP0 A;  4TWD A;  2Y58 A;  2M6B A;  3RIF A;  1UV6 A;  4F8H A;  2BR8 A;  3WTH A;  2XNT A;  5AFM A;  5KZU A;  2XQA A;  1I9B A;  3GUA A;  4B5D A;  3U8N A;  2BG9 A;  3WTI A;  3RIA A;  4ILA A;  3WTN A;  3WTO A;  4UY2 A;  2BG9 B;  3C84 A;  4IL4 A;  4AFH A;  4HFC A;  2XZ6 A;  4AFT A;  3SQ9 A;  3RQW A;  5CO5 A;  4LMK A;  3UQ7 A;  2BG9 C;  2BYR A;  2XQ9 A;  2KSR A;  1OED E;  5JME A;  4TWF A;  3PEO A;  4AFG A;  5J5F A;  2LKH A;  4HFD A;  4QH5 A;  5AFK A;  1OED A;  4ZRU A;  3C79 A;  5J0Z A;  3EI0 A;  5AFJ A;  5HEJ A;  4IRE A;  5L47 A;  1UW6 A;  3JAE A;  4TNW A;  4BFQ A;  3UQ4 A;  1OED B;  5J5H A;  4HFI A;  3UUB A;  2PH9 A;  2XQ3 A;  2LLY A;  5KE4 A;  1OED C;  2PGZ A;  2BG9 E;  2Y56 A;  2QC1 B;  4FRR A;  4A97 A;  4QAB A;  5FJV A;  4DBM A;  5HCJ A;  2BR7 A;  3ZKR A;  5J5I A;  5LG3 A;  3WTL A;  4UM3 S;  4BQT A;  2BYP A;  4ILB A;  4ZJS A;  3SQ6 A;  2LM2 A;  3ZDG A;  4HFB A;  2WNJ A;  3LSV A;  2M6I A;  2WZY A;  4XHE A;  2WNL A;  4IL9 A;  5TVC A;  3UU4 A;  2Y57 A;  4ZZC A;  4EZ1 A;  4HFE A;  3UU6 A;  5HCM A;  3PMZ A;  4QAC A;  4NPP A;  4ZK4 A;  4ZR6 A;  5BW2 A;  3WIP A;  3RHW A;  2XQ6 A;  1UX2 A;  2X00 A;  2Y7Y A;  5SYO A;  3U8J A;  2BJ0 A;  4QH4 A;  2YME A;  2YKS A;  2BYS A;  5AFN A;  3IGQ A;  3P50 A;  4TWH A;  5HEU A;  4Z90 A;  2LKG A;  3U8M A;  3SH1 A;  4ZZB A;  3TLU A;  2YMD A;  5AIN A;  2XNU A;  4LMJ A;  2X00 D;  4QH1 A;  3SIO A;  5L4H A;  2XYT A;  3WTM A;  3U8L A;  3T4M A;  4LML A;  4UM3 A;  4UM1 A;  4HFH A;  4ILC A;  3TLW A;  2BYN A;  3ZDH A;  4ZK1 A;  2VL0 A;  2Y54 A;  4ZJT A;  3EHZ A;  2XQ4 A;  4UM3 P;  4XK9 A;  3WTJ A;  2MAW A;  5J5G A;  3WTK A;  2XZ5 A;  4ALX A;  3JAF A;  3UU5 A;  5HEH A;  5CFB A;  2C9T A;  2BYQ A;  5BRX A;  4WV9 A;  2XNV A;  3JAD A;  4HQP A;  2W8G A;  3U8K A;  4X5T A;  4TNV A;  2XYS A;  3EAM A;  3P4W A;  3RQU A;  4NZB A;  4QAA A;  2WN9 A;  3RI5 A;  2XQ8 A;  4COF A;  3UU8 A;  4A98 A;  2WNC A;  3TLV A;  2UZ6 A;  2XQ5 A;  5HEG A;  3UU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...