4HFCA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to 2-bromo-ethanol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfcA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfcA01
5J5IA 2BYRA 4AFGA 5KZUA 1OEDB 2XNTA 3EI0A 3WTHA 3U8LA 2YMEA 4UM3S 4ZZBA 5IUXA 4LMKA 2Y58A 2YKSA 2LKGA 5HEGA 1UW6A 4WV9A 3WTKA 5HEOA 4TWFA 2WNJA 2WNLA 3UQ7A 2W8GA 3U8KA 4NZBA 2BG9E 3JAFA 4TWHA 3UU3A 5AFMB 4BQTA 3RIFA 1I9BA 2LM2A 4AFHA 2WNCA 3JADA 4UM3A 4QH4A 2XYSA 2Y7YA 4HFEA 5AINA 4COFA 4AFTA 4LMLA 3IGQA 3P4WA 2C9TA 3JAEA 4UXUA 1OEDA 3UU5A 3UUBA 2ZJUA 3WTMA 3TLSA 5J5HA 5L4EA 5FJVA 3EAMA 4QAAA 2BG9A 5J5GA 5CFBA 5AFHA 4XHEA 4ZK1A 4ZJSA 3P50A 2BG9C 5HEUA 5J0ZA 4HFBA 3SIOA 2XQ3A 2VL0A 1OEDE 2BR7A 3C79A 5TVCA 5KE4A 4UM1A 3TLVA 3UU4A 3TLUA 4IREA 3TLWA 3TLTA 2YMDA 5J5FA 4QABA 3WTNA 3SH1A 4QH1A 5BW2A 4LMJA 3ZDHA 2PH9A 2UZ6A 4IL9A 2YN6A 2XZ5A 3GUAA 4TNVA 3PMZA 2XQ8A 2XQ9A 5SYOA 3WTIA 4HFCA 4HFDA 4A97A 2XYTA 4ILAA 2ZJVA 4UM3P 5AFNA 4ILBA 3WIPA 4EZ1A 4ALXA 4PIRA 2M6IA 3T4MA 1OEDC 1UX2A 3RI5A 3WTOA 3ZDGA 2M6BA 2Y56A 4ZZCA 4HFIA 3RHWA 3WTLA 5AFMA 2XNUA 2XQ4A 2BYNA 5HCJA 4TNWA 2KSRA 2XQ5A 4A98A 3SQ9A 3ZKRA 3U8MA 2Y57A 4D01A 3SQ6A 5LG3A 2PGZA 5AFJA 3UU8A 3UQ4A 4BFQA 2LLYA 2LKHA 4F8HA 4HFHA 2BR8A 5HEJA 2BYPA 4ILCA 5AFLA 5BRXA 4QACA 5LXBA 4TWDA 4NPPA 3RQUA 4Z90A 3U8JA 3RQWA 4X5TA 5AFKA 4Z91A 2BG9B 5L47A 2X00A 3WTJA 4HQPA 2BJ0A 2Y54A 3UU6A 2BYQA 2X00D 2WZYA 2XQ6A 2YOEA 3PEOA 2MAWA 2XQAA 2WN9A 2QC1B 2BYSA 4FRRA 5CO5A 3LSVA 2XZ6A 4ZRUA 1UV6A 4ZK4A 3RIAA 5L4HA 2W8FA 4ZJTA 4B5DA 5BP0A 3C84A 4QH5A 4DBMA 4IL4A 2XNVA 4UY2A 4ZR6A 5JMEA 2XQ7A 5HCMA 5HEHA 3EHZA 4XK9A 3U8NA
chains in the Genus database with same CATH superfamily
1YW0A 3P4RA 1OEDB 3WTHA 4LMKA 4JYAT 2PBIA 2LRLA 3PUAA 5AFMB 5AQNB 2LM2A 1HNXT 3K3NA 2HPLA 4B3MT 4QHOA 5J5HA 5HWXA 2UXBT 4QKNA 5JDGA 4LF4T 2WP9A 4MALA 4UM1A 1E2AA 5LGUB 3WI3A 5JR9B 5BW2A 2PH9A 3RYFE 4H9PC 4KHZF 2BKPA 3PUSA 2DLRA 3RI5A 2M6BA 5HXEA 4TN7B 2OV9A 4HWFA 3PUXF 2XQ4A 4YLHA 3KINB 3L8RA 3ANWB 3RH3A 2NR4A 2NP9A 4QX7B 2XSBA 4HE8A 5H6QB 2XUEA 3I9YA 3T1HT 1VCTA 2KZ7B 4X5TA 3KVAA 4HQPA 5FP3A 3UU6A 2ODUA 2QGSA 1MMAA 4FRRA 4G2AA 2MBGA 4PJJA 4O2AE 1KNPA 4OX9T 5BP0A 3ZMUB 2XQYA 3NWIA 2XNVA 5FL0A 3ZT7A 2H3RA 4AFGA 4PAGA 2CBIA 4DV1T 1UW6A 1FIOA 3MXZA 2WNJA 1MMNA 4KX6A 3UQ7A 2V26A 4NZBA 2BG9E 2YU2A 5ADXL 3JAFA 2CWOA 3UU3A 4IDZA 4DV4T 4LFCT 4AFTA 4ZOLE 2JMKA 3RX6A 1FMWA 5FXWA 5LYJE 2B76A 4I0UA 2VWAA 2IIUA 2CMRA 1UX4A 4ILUA 2G0UA 2VKDA 2A72A 5IWAT 2LE8A 4IREA 2M67A 3MK7C 3BK9A 3WTIA 4O4IE 4A5XA 2WMOA 4ZXLA 4ALXA 1ZOYA 3AVRA 2ZLYA 3ABVA 1HNWT 1J5ET 4EIWA 1IJ5A 4H9RC 4ZZCA 4HFIA 4NXNT 1OXZA 5LMNT 3U8MA 3D0TA 5DABA 4BFQA 1CUNA 4F8HA 3PUYF 3FZKB 2E9XA 2V6YA 3C51A 1UK5A 3PV0F 5J1GA 4EXTA 2E9XC 1KEYA 2CE7A 5AQFB 2X68A 4ZJTA 5FMNA 4IL4A 2CLYB 4DR5T 3O4XE 5HCMA 3EHZA 3HKDE 1MIVA 2ZMAA 5KZUA 2V7JA 2PFVA 3AE1A 4TV8E 3ZSTA 2XAJB 1D0XA 5A1LA 2W8GA 4TWHA 4DR4T 2N9DA 4AQFA 3UUBA 4DR1T 3FBZA 4AQFC 1BR1A 4IE5A 4HFBA 3RYHE 4AKGA 3X1DA 2AE9A 1YQ4A 1S35A 4WBNE 3ETVA 2XJ7A 5SYOA 3AE4A 5FKYA 3ZN0B 2BBJA 2XYTA 1QSDA 4YTPA 1OEDC 2Y56A 4H9NC 4U7YA 1UGOA 2Y6XA 4UIGA 1ZP0A 4M1PA 5AFMA 4IIJE 2WAUA 4BAYB 2Y57A 4JI5T 2I0MA 3RGLA 4U72A 1HNZT 4TWDA 3B5MA 3AVSA 2WZHA 4HWCA 4Z91A 3WTJA 4UELA 4BJMA 3CVRA 2BYQA 2XQAA 4GIWA 4DR3T 4JI8T 4PJLA 5JR9A 4LF6T 2H7VC 5FXVA 2CPTA 3C64A 2JQ9A 2A2FX 4C91A 5C2TA 3SOLA 2NTYA 3RIFA 3ANWA 4O4HE 4HWHA 4ADZA 3P4PA 4I55E 1SA0E 1LRZA 5AQIB 2CHNA 4COFA 2XM2A 4X1YE 3P4WA 1YKEB 2EHOA 2JPFA 1MMGA 4ZK1A 1IBLT 5TVCA 1IBMT 3F31A 3TLTA 4H9OC 2BVLA 3PUQA 3I0OA 2WMNA 2IW5B 4O2BE 3PMZA 1OWAA 2XQ9A 4CI2B 4BJNA 4ASKA 3ETUA 3T4MA 2J4GA 4U2ZA 3ZDGA 1ZEEA 1MIWA 3MJXA 2LM9A 2XAQB 3NVOA 2KSRA 2JMHA 4A98A 3UU8A 3OVUA 1N33T 3SFEA 2WCAA 1L0VA 4AIUA 4X62T 2DI4A 4WYVA 3VKHA 5FY0A 1KFYA 1LVFA 3TKLB 3AXJB 4Z8XA 4X65T 4GKJT 3BQKA 3RIAA 3P7IA 4YHJA 3Q9DA 3AE6A 3K8PC 3SWHA 1XNRT 4XK9A 2HHHT 5LNKA 3EI0A 2C0SA 2UUBT 5FNVE 3RKOA 3ZT6A 2B1EA 2K9AA 3T1YT 4IE4A 4QH4A 4EEDA 2VK9A 5FL1A 2KXPB 3HKEE 3RPUA 5L4EA 3L39A 3P50A 2XQ3A 3C79A 5KE4A 1NWMX 1W9RA 4IGUA 3SH1A 1UX5A 1T98A 2XZ5A 3N9OA 4HEAA 2CLYC 1WYBA 4ILAA 3UUXB 2M6IA 1XNQT 4OYKA 2UXCT 3RRCA 3WTLA 3N2KE 2IAKA 5AQRB 5AQLB 3SQ6A 3K3OA 2UXDT 3MKDA 3VHLA 2VQET 5JQGE 3FZMB 2IC9A 3GN5B 3IEEA 2LHNA 5JTGA 3AE3A 2GK9A 2WN9A 5F5WA 5CO5A 1WCRA 5L4HA 1T8BA 3UULA 4QH5A 5ABHA 3HI2A 4JI4T 1SHZC 1ZKEA 2NOXA 3F57A 3QK6A 3SS1A 4KMCA 3WTKA 4JBWF 2BVMA 2LJLA 2VQFT 4DR2T 5ETWA 5KXJA 2DWKA 4ZS2A 4IE0A 1FMVA 1E7PA 4AQYT 5AQMB 2IMLA 1I6ZA 3AEFA 5EK3A 5HXRA 3NZQA 2DWGA 5AFHA 5E0OA 3JC6C 4IE6A 2VL0A 1OEDE 2UUCT 3AAAB 3EUHA 4JLEA 5J5FA 3FB2A 4JV5T 3H3AA 2ODVA 3PU8A 2C5JA 2XQ8A 3J7Yq 4KHPT 4AI6A 2WWUA 5JDFA 1IZNB 3PJAA 5LHHB 3C4WA 2FJBA 3ZCIA 2X0LB 3I1AA 4UF0A 4CN4A 3U3IA 4TV9E 1HX1B 1J5WA 4K0UA 4YXDA 2ZM0A 3SQ9A 2J62A 4E7SA 1IBKT 3RC8A 2NW9A 3KDSE 5AFJA 3N5LA 5HEJA 4ILCA 2WU2A 4JI7T 2Q9QD 1VCSA 3SRZA 3O9XA 4H9QC 4PNIA 3LJCA 5L47A 2BJ0A 2FUPA 4ZI3C 4UXNB 1U4QA 3ONXA 4GOUA 4ZI7E 3OBVE 2P9BA 1WYCA 3KV5A 2CA5A 3AAIA 3VKGA 5C3JA 2XTLA 3IF8B 5C8YE 1FEWA 1Z0PA 3HR0A 4PW8A 4XAXB 2EHOB 5JDMA 4WV9A 2NW7A 2XZEA 3U8KA 4IDOA 5AQPB 3MACA 3C50A 2A3DA 1G73A 3RF1A 4AFHA 4MLKA 3ZN1B 2Y7YA 3A7MA 1WR6A 2W61A 1YKHB 5ABGA 2ZJUA 2ZM6T 3OYZA 3AXJA 4EYUA 1UURA 4CXXA 5AQGB 3PTRB 4DUYT 4DBRA 5EZYE 2OA5A 2N1GA 4CQIA 4J2CA 4NUVA 4ZI3D 2CEAA 4O8SA 1AJ3A 1M7KA 1MIYA 2RP4A 3JCFA 3HL6A 4YY3T 2PJQA 2KINB 3OKQA 3ZJ1A 1KF6A 4UEMA 4ZI2C 3B57A 2YINA 3AA7B 2BZBA 4DV2T 3RQWA 2IC6A 4OFZA 2CXLA 3ZEFB 2WWVA 4IDNA 4ZRUA 4XZCA 3VR8A 4UVAB 3R84B 4UY2A 5FVLA 2J47A 2QVAA 4YSXA 2WY2A 3N9LA 2JJ9A 3AA1B 2UU9T 1R8IA 3RLFF 2F4VT 1US7B 1XMOT 4H9SE 1S94A 3HA4A 2HPJA 2WNCA 5L3EB 4CXYA 1GQEA 2ZM8A 3AAEB 3BQIA 2DHRA 3GN5A 5CA0E 3ZCJA 5CFBA 1D1BA 2RPAA 4AISA 3F2EA 4PK6A 3E08A 2SPCA 4WNKA 1SE7A 3ZDHA 4O4LE 3A5XA 3PUVF 4KP3C 2H7OA 2WM9A 3LG7A 3WIPA 1NENA 2W67A 4PK4A 3WTOA 2K24A 2V6XA 4CI1B 2YK0A 2XQ5A 2E8IA 4B3RT 4DMVA 1W0BA 2WB5A 3RQUA 2LSKA 4DVDA 3AECA 1JNZA 1HG2A 2E9XD 5LGNB 2E5VA 1UV6A 2NTXA 5JDQA 4ZK4A 5DQWA 1LVKA 2YU1A 1N34T 4XBFB 4O4JE 2WSSV 3AA6B 1HG5A 3ZLIA 5JDNA 3U8LA 2YKSA 2UXNB 4JEUB 3IHRA 5AQHB 3E22E 3UFGA 5JR9C 2UUAT 5FJVA 1Z8UA 3EAMA 2HN2A 1NEKA 4ZJSA 3RKGA 4IE7A 4Q25A 5L2LA 4LFBT 3N9PA 4UF0B 3TLWA 4LMJA 2L3LA 4IL9A 4TNVA 3UTKA 2ZJVA 4A97A 4EEBA 4X64T 4UM3P 2CWYA 4ILBA 4GYRA 2EHOC 2ES0A 5LHGB 4DV5T 3AEBA 3RHWA 2AXDS 3VRBA 5AQSB 4B6XA 4DBQA 2W62A 3ZKRA 2BKNA 4UR9A 4P0BA 3M3ZB 5TAOA 3CX8B 4OHFA 2JQQA 1D1AA 5IYZE 5LXBA 2LSJA 4IDPA 2CM0A 4YFSA 3GA8A 4HN9A 2Y54A 2QRXA 2BYSA 3LSVA 4YJ3E 4B5DA 2L8KA 1XDOA 2K48A 3LK2B 2NW8A 3EDVA 5JVDE 2WZIA 1B7TA 4UM3S 5CGMA 4ZZBA 2CCQA 2Y58A 2LKGA 1BR0A 3ZT5A 1LKXA 5HYAA 2XAFB 4QWNB 2W4XA 4BQTA 2XYSA 3AE8A 4HFEA 4DMWA 2KMFA 3TLSA 4CI3B 2X0YA 4U31A 2VKOA 2KNDA 1ZV4X 1BR2A 4OK0A 3TLVA 2V5CA 4F6RC 2IHR1 2LSGA 4AKHA 1SUMB 3GUAA 2YN6A 3AEGA 3WAKA 3B13A 1N32T 3NRXA 4YSZA 2H88A 1KK7A 5CJ5A 4X1IE 2D2SA 2X67A 5H6RB 2XNUA 2YDSA 2V7IA 5FY7A 5HXHA 2CRBA 3PURA 3ZYLA 5BRXA 1ZHCA 4JI6T 3S4UA 2X00A 1HF8A 4P0AA 3FHNA 2W63A 2QC1B 1Y01A 2E5LT 4I43B 1YXRA 3N2OA 2X51A 4UV9B 4U7IA 4HKAA 4DBMA 2VKJA 1XDPA 3ZMZB 4PFOA 3AE2A 3U8NA 3UUMA 5JDLA 4KBMB 3N9MA 4QXBB 3U78A 5HEOA 2D5UA 3FZHB 2BKOA 3VU7H 2WNLA 3GWHA 4PK5A 4ZEYA 4U33A 1G8XA 4DNDA 5AINA 3UU5A 2D0UA 3RRWA 3BQLA 4XHEA 4B3ST 2LOSA 3SIOA 4JI2T 2BS3A 3Q5WA 5IHYA 2VVNA 5JREA 1M62A 3FZLB 3WTNA 3CPZA 2MTQA 3M65A 4QH1A 4DO0A 4GK5E 3OYXA 5DQVA 2Q9QA 4HFCA 4QX8B 1WLXA 4AXPA 3Q5EA 2BYNA 5HCJA 5LJNA 2XY8B 4ISTA 5CA1E 2LLYA 2JQHA 4HFHA 2BR8A 3AE7A 3O1JA 2LSIA 3I9WA 5LGTB 3CX7B 4L5GA 3LDQB 4GYSA 1HFAA 3PUWF 5LOVE 2XQ6A 3ZMTB 1Y64B 2DNXA 3C84A 5F8PA 4GK0E 4ZR6A 2J1DG 5HEHA 3Q5XA 3AEDA 3QB5K 2BBHA 2LEHA 3IBPA 2KWHA 1D0YA 2XASB 4TWFA 3MA9A 2UXXB 3FXEB 5ABEA 4YT0A 4DIDB 2K5BB 1YQ3A 1QUUA 5AQVB 1MMDA 5AQKB 5LG4A 2DL1A 3CK6A 5ABFA 2DCFA 1XWMA 2C5IT 3EABA 2X9YA 3AE5A 3EVYA 5J2UE 4LF7T 3LBXA 5J5GA 2H89A 3A8YC 4L9IA 4YSYA 2Y48B 1IAPA 3CQGB 3JC6D 3RYCE 2BR7A 1V9DA 1X79A 3TLUA 3QNUA 2V8SV 4EOZB 3CMLA 3QUJA 2HH7A 3I0QA 1NAFA 2VASA 5CB4E 2W66A 4LF8T 5LCYA 4FI5A 4P1NA 4PFPA 2WDVA 2FJEA 3H3MA 5BMVE 3E0ZA 2WDRA 1QLBA 4AKRB 2W00A 2CHOA 5LG3A 2LKHA 2V1DB 3O1IA 2LHRA 4QXCB 5AFLA 1WRDA 4Z90A 3U8JA 3NRYA 4UV8B 3ZMSB 2BG9B 1H7CA 3FBLA 1VOMA 1O3XA 3KV4A 2W8FA 2IUBA 4TX5A 4DV3T 2WQYA 3QC9A 1E1HB 5JMEA 2XQ7A 3ZC0A 3ONJA 3ZSSA 1HS7A 3H37A 5KX5E 5LB7B 5LMUT 3PDYA 1XMQT 3VR9A 3C98B 5LHIB 4HFVA 5HXCA 3N9QA 5L3CB 5L3FB 4X20E 4UM3A 2CBJA 5LXTE 5AQOB 4YJ2E 1J1JA 3UUNA 2JRKA 4H63H 5L3DB 4DV0T 3UT5E 5J0ZA 5HAXA 4ERRA 5L3GB 2ACXA 3UU4A 1HX8A 3P8CD 1XZYA 3FZFB 4IHJE 3J9X1 2X9WA 2VURA 4KI0F 3K3QC 3RYIE 2UZ6A 3N9NA 2BS2A 2WS3A 4TUYE 4ZS3A 4TZ4C 3KBUA 4QXHB 5M4YA 5LJMA 2XPKA 4HFDA 3DP7A 3Q5DA 2A9UA 1D0ZA 2BDEA 3T8OA 4ZI2D 1W09A 4MHCA 2I59A 3PE0A 3UQ4A 4UVBB 5KDMC 4YTMA 4MBQA 1JNRA 4ISSA 3PJAJ 4ANJA 2XAHB 3FXDB 2W0GA 5LA6E 3OJAA 3PEOA 5FY1A 4I4TE 5KMGP 4ZHQE 2WDQA 4WW0A 5LP6E 5JRCB 5L3BB 2ZM2A 2LOPA 5AQJB 3AEEA 3ONLC 2I6HA 4P09A 4JI3T 2C5KT 3CKDA 3NBXX 2FBWA 4JI1T 5F3JA 1T7SA 1YD8G 2YMEA 5HEGA 3PU3A 3KBTA 3MZKB 2QYWA 3QB5A 2VL8A 3V5SA 2X66A 4U74A 4LMLA 2VKHA 3ZJ2A 5AFUL 4FJOA 2C9TA 1CHUA 1OEDA 2Q9QB 5AQUB 2KWIB 5HEUA 3AE9A 3RIUA 2Y8DA 4EGWA 4AKLA 4MFRA 3RIUC 4DR7T 3O1HA 3OPCA 3AEAA 3WAJA 3KFWX 2CXDA 5AFNA 2VB6A 4JUYA 4PIRA 2FJDA 5BR8T 5AQQB 2V7LA 2YEVC 2V7MA 3SFDA 2HN1A 3AB3B 4TNWA 3PUGA 3ZC1A 4D01A 2PGZA 3G06A 4EYYR 3Q2MA 2KT9A 5FXZA 2IDOB 4YHHT 4NPPA 4AQGA 2JIWA 3P4QA 4IT4A 1T72A 3PUZF 3LK3B 1WFDA 1DU2A 2E2AA 3LK42 4NUUA 3ZMVB 2X9HA 5DJQC 1HTJF 1BR4A 4KUMB 4LF5T 2PG8A 3L09A 4HTEA 4WZXA 5ABFB 5J5IA 2BYRA 1UCUA 4DV7T 3CWZB 4CN6A 4LFAT 4EZHA 3LBXB 5IUXA 3ZYKA 3ZYMA 4BA9A 4HWDA 1UUSA 4PJNA 1I94T 1I9BA 1HCIA 4HWIB 4G63A 4JEHB 4UVCB 5HWYA 2XAGB 4U3CA 3JAEA 4UXUA 5LBMA 3WTMA 2CXFA 4QAAA 2BG9A 4DR6T 4B3TT 3KV6A 2BG9C 4X66T 3HKBE 3DJBA 1KNZA 5LBQB 2RA1A 4U2YA 5HXSA 4HGAA 2YMDA 2YDRA 4AKIA 2Z6EA 3K1SA 4X1KE 2V5DA 1N36T 1W0AA 1HR0T 2V7KA 1UX2A 3N2GE 2EHOD 2OLTA 3NKZA 5GONE 3EDUA 3AA0B 3KV9A 4L0RA 1MNEA 2KLQA 5FVKA 3CX6B 4OYJA 3IA3A 2LSYA 4CN1A 4QACA 4E7ZA 2NWBA 2W2UA 4EV6A 2XM1A 2XHEB 2YOEA 2MAWA 1IJ6A 4PJMA 2X0HA 2XZ6A 2MPKA 1EZ3A 5EK4A 3V5UA 3RC3A 3CIRA 3P4SA 1VRBA 4I50E 3QOFA 4H63V 3OTOT 3ESLA 2XNTA 2L9QA 3HKCE 1KNRA 2K3WA 5JH7E 4V1Av 3JADA 4C90A 5FXXA 3NZPA 4YTNA 3IGQA 2VVSA 5EK2A 4CXWA 4LF9T 2E9XB 2V6YB 4DUZT 3LFMA 5JRCA 4WBOA 4GKKT 4JI0T 2PTFA 2D9DA 2WU5A 4QABA 5FYMA 1FJGT 1MNDA 3UFEA 3ZPOA 1U5PA 4NXMT 3C4XA 4EZ1A 5J2TE 3L3PA 2JQKA 2WBLA 2QA7A 2LRKA 1WR0A 4N78D 2ACZA 4EB6E 2X9XA 3GMIA 4A56A 2BYPA 2R6GF 5JDHA 1D1CA 2D0TA 3VRAA 2FJAA 3C4ZA 2MYSA 2Q9QC 5AFKA 4EZ4A 2BS4A 2YDQA 2X00D 2MOZA 2WZYA 2LT3A 4DV6T 4K0KT 3W15B 3KVBA 3DTOA 1X9BA 4CZZB 3R6NA 3CQXC 3CQCB 4IDQA 4EAHA 4NIQA 2XSAA 2N2NA 5AQTB
chains in the Genus database with same CATH topology
5J5IA 2BYRA 4AFGA 5KZUA 1OEDB 2XNTA 3EI0A 3WTHA 3U8LA 2YMEA 4UM3S 4ZZBA 5IUXA 4LMKA 2Y58A 2YKSA 2LKGA 5HEGA 1UW6A 4WV9A 3WTKA 5HEOA 4TWFA 2WNJA 2WNLA 3UQ7A 2W8GA 3U8KA 4NZBA 2BG9E 3JAFA 4TWHA 3UU3A 5AFMB 4BQTA 3RIFA 1I9BA 2LM2A 4AFHA 2WNCA 3JADA 4UM3A 4QH4A 2XYSA 2Y7YA 4HFEA 5AINA 4COFA 4AFTA 4LMLA 3IGQA 3P4WA 2C9TA 3JAEA 4UXUA 1OEDA 3UU5A 3UUBA 2ZJUA 3WTMA 3TLSA 5J5HA 5L4EA 5FJVA 3EAMA 4QAAA 2BG9A 5J5GA 5CFBA 5AFHA 4XHEA 4ZK1A 4ZJSA 3P50A 2BG9C 5HEUA 5J0ZA 4HFBA 3SIOA 2XQ3A 2VL0A 1OEDE 2BR7A 3C79A 5TVCA 5KE4A 4UM1A 3TLVA 3UU4A 3TLUA 4IREA 3TLWA 3TLTA 2YMDA 5J5FA 4QABA 3WTNA 3SH1A 4QH1A 5BW2A 4LMJA 3ZDHA 2PH9A 2UZ6A 4IL9A 2YN6A 2XZ5A 3GUAA 4TNVA 3PMZA 2XQ8A 2XQ9A 5SYOA 3WTIA 4HFCA 4HFDA 4A97A 2XYTA 4ILAA 2ZJVA 4UM3P 5AFNA 4ILBA 3WIPA 4EZ1A 4ALXA 4PIRA 2M6IA 3T4MA 1OEDC 1UX2A 3RI5A 3WTOA 3ZDGA 2M6BA 2Y56A 4ZZCA 4HFIA 3RHWA 3WTLA 5AFMA 2XNUA 2XQ4A 2BYNA 5HCJA 4TNWA 2KSRA 2XQ5A 4A98A 3SQ9A 3ZKRA 3U8MA 2Y57A 4D01A 3SQ6A 5LG3A 2PGZA 5AFJA 3UU8A 3UQ4A 4BFQA 2LLYA 2LKHA 4F8HA 4HFHA 2BR8A 5HEJA 2BYPA 4ILCA 5AFLA 5BRXA 4QACA 5LXBA 4TWDA 4NPPA 3RQUA 4Z90A 3U8JA 3RQWA 4X5TA 5AFKA 4Z91A 2BG9B 5L47A 2X00A 3WTJA 4HQPA 2BJ0A 2Y54A 3UU6A 2BYQA 2X00D 2WZYA 2XQ6A 2YOEA 3PEOA 2MAWA 2XQAA 2WN9A 2QC1B 2BYSA 4FRRA 5CO5A 3LSVA 2XZ6A 4ZRUA 1UV6A 4ZK4A 3RIAA 5L4HA 2W8FA 4ZJTA 4B5DA 5BP0A 3C84A 4QH5A 4DBMA 4IL4A 2XNVA 4UY2A 4ZR6A 5JMEA 2XQ7A 5HCMA 5HEHA 3EHZA 4XK9A 3U8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J5I A;  2BYR A;  4AFG A;  5KZU A;  1OED B;  2XNT A;  3EI0 A;  3WTH A;  3U8L A;  2YME A;  4UM3 S;  4ZZB A;  5IUX A;  4LMK A;  2Y58 A;  2YKS A;  2LKG A;  5HEG A;  1UW6 A;  4WV9 A;  3WTK A;  5HEO A;  4TWF A;  2WNJ A;  2WNL A;  3UQ7 A;  2W8G A;  3U8K A;  4NZB A;  2BG9 E;  3JAF A;  4TWH A;  3UU3 A;  5AFM B;  4BQT A;  3RIF A;  1I9B A;  2LM2 A;  4AFH A;  2WNC A;  3JAD A;  4UM3 A;  4QH4 A;  2XYS A;  2Y7Y A;  4HFE A;  5AIN A;  4COF A;  4AFT A;  4LML A;  3IGQ A;  3P4W A;  2C9T A;  3JAE A;  4UXU A;  1OED A;  3UU5 A;  3UUB A;  2ZJU A;  3WTM A;  3TLS A;  5J5H A;  5L4E A;  5FJV A;  3EAM A;  4QAA A;  2BG9 A;  5J5G A;  5CFB A;  5AFH A;  4XHE A;  4ZK1 A;  4ZJS A;  3P50 A;  2BG9 C;  5HEU A;  5J0Z A;  4HFB A;  3SIO A;  2XQ3 A;  2VL0 A;  1OED E;  2BR7 A;  3C79 A;  5TVC A;  5KE4 A;  4UM1 A;  3TLV A;  3UU4 A;  3TLU A;  4IRE A;  3TLW A;  3TLT A;  2YMD A;  5J5F A;  4QAB A;  3WTN A;  3SH1 A;  4QH1 A;  5BW2 A;  4LMJ A;  3ZDH A;  2PH9 A;  2UZ6 A;  4IL9 A;  2YN6 A;  2XZ5 A;  3GUA A;  4TNV A;  3PMZ A;  2XQ8 A;  2XQ9 A;  5SYO A;  3WTI A;  4HFC A;  4HFD A;  4A97 A;  2XYT A;  4ILA A;  2ZJV A;  4UM3 P;  5AFN A;  4ILB A;  3WIP A;  4EZ1 A;  4ALX A;  4PIR A;  2M6I A;  3T4M A;  1OED C;  1UX2 A;  3RI5 A;  3WTO A;  3ZDG A;  2M6B A;  2Y56 A;  4ZZC A;  4HFI A;  3RHW A;  3WTL A;  5AFM A;  2XNU A;  2XQ4 A;  2BYN A;  5HCJ A;  4TNW A;  2KSR A;  2XQ5 A;  4A98 A;  3SQ9 A;  3ZKR A;  3U8M A;  2Y57 A;  4D01 A;  3SQ6 A;  5LG3 A;  2PGZ A;  5AFJ A;  3UU8 A;  3UQ4 A;  4BFQ A;  2LLY A;  2LKH A;  4F8H A;  4HFH A;  2BR8 A;  5HEJ A;  2BYP A;  4ILC A;  5AFL A;  5BRX A;  4QAC A;  5LXB A;  4TWD A;  4NPP A;  3RQU A;  4Z90 A;  3U8J A;  3RQW A;  4X5T A;  5AFK A;  4Z91 A;  2BG9 B;  5L47 A;  2X00 A;  3WTJ A;  4HQP A;  2BJ0 A;  2Y54 A;  3UU6 A;  2BYQ A;  2X00 D;  2WZY A;  2XQ6 A;  2YOE A;  3PEO A;  2MAW A;  2XQA A;  2WN9 A;  2QC1 B;  2BYS A;  4FRR A;  5CO5 A;  3LSV A;  2XZ6 A;  4ZRU A;  1UV6 A;  4ZK4 A;  3RIA A;  5L4H A;  2W8F A;  4ZJT A;  4B5D A;  5BP0 A;  3C84 A;  4QH5 A;  4DBM A;  4IL4 A;  2XNV A;  4UY2 A;  4ZR6 A;  5JME A;  2XQ7 A;  5HCM A;  5HEH A;  3EHZ A;  4XK9 A;  3U8N A; 
#chains in the Genus database with same CATH topology
 1YW0 A;  3P4R A;  1OED B;  3WTH A;  4LMK A;  4JYA T;  2PBI A;  2LRL A;  3PUA A;  5AFM B;  5AQN B;  2LM2 A;  1HNX T;  3K3N A;  2HPL A;  4B3M T;  4QHO A;  5J5H A;  5HWX A;  2UXB T;  4QKN A;  5JDG A;  4LF4 T;  2WP9 A;  4MAL A;  4UM1 A;  1E2A A;  5LGU B;  3WI3 A;  5JR9 B;  5BW2 A;  2PH9 A;  3RYF E;  4H9P C;  4KHZ F;  2BKP A;  3PUS A;  2DLR A;  3RI5 A;  2M6B A;  5HXE A;  4TN7 B;  2OV9 A;  4HWF A;  3PUX F;  2XQ4 A;  4YLH A;  3KIN B;  3L8R A;  3ANW B;  3RH3 A;  2NR4 A;  2NP9 A;  4QX7 B;  2XSB A;  4HE8 A;  5H6Q B;  2XUE A;  3I9Y A;  3T1H T;  1VCT A;  2KZ7 B;  4X5T A;  3KVA A;  4HQP A;  5FP3 A;  3UU6 A;  2ODU A;  2QGS A;  1MMA A;  4FRR A;  4G2A A;  2MBG A;  4PJJ A;  4O2A E;  1KNP A;  4OX9 T;  5BP0 A;  3ZMU B;  2XQY A;  3NWI A;  2XNV A;  5FL0 A;  3ZT7 A;  2H3R A;  4AFG A;  4PAG A;  2CBI A;  4DV1 T;  1UW6 A;  1FIO A;  3MXZ A;  2WNJ A;  1MMN A;  4KX6 A;  3UQ7 A;  2V26 A;  4NZB A;  2BG9 E;  2YU2 A;  5ADX L;  3JAF A;  2CWO A;  3UU3 A;  4IDZ A;  4DV4 T;  4LFC T;  4AFT A;  4ZOL E;  2JMK A;  3RX6 A;  1FMW A;  5FXW A;  5LYJ E;  2B76 A;  4I0U A;  2VWA A;  2IIU A;  2CMR A;  1UX4 A;  4ILU A;  2G0U A;  2VKD A;  2A72 A;  5IWA T;  2LE8 A;  4IRE A;  2M67 A;  3MK7 C;  3BK9 A;  3WTI A;  4O4I E;  4A5X A;  2WMO A;  4ZXL A;  4ALX A;  1ZOY A;  3AVR A;  2ZLY A;  3ABV A;  1HNW T;  1J5E T;  4EIW A;  1IJ5 A;  4H9R C;  4ZZC A;  4HFI A;  4NXN T;  1OXZ A;  5LMN T;  3U8M A;  3D0T A;  5DAB A;  4BFQ A;  1CUN A;  4F8H A;  3PUY F;  3FZK B;  2E9X A;  2V6Y A;  3C51 A;  1UK5 A;  3PV0 F;  5J1G A;  4EXT A;  2E9X C;  1KEY A;  2CE7 A;  5AQF B;  2X68 A;  4ZJT A;  5FMN A;  4IL4 A;  2CLY B;  4DR5 T;  3O4X E;  5HCM A;  3EHZ A;  3HKD E;  1MIV A;  2ZMA A;  5KZU A;  2V7J A;  2PFV A;  3AE1 A;  4TV8 E;  3ZST A;  2XAJ B;  1D0X A;  5A1L A;  2W8G A;  4TWH A;  4DR4 T;  2N9D A;  4AQF A;  3UUB A;  4DR1 T;  3FBZ A;  4AQF C;  1BR1 A;  4IE5 A;  4HFB A;  3RYH E;  4AKG A;  3X1D A;  2AE9 A;  1YQ4 A;  1S35 A;  4WBN E;  3ETV A;  2XJ7 A;  5SYO A;  3AE4 A;  5FKY A;  3ZN0 B;  2BBJ A;  2XYT A;  1QSD A;  4YTP A;  1OED C;  2Y56 A;  4H9N C;  4U7Y A;  1UGO A;  2Y6X A;  4UIG A;  1ZP0 A;  4M1P A;  5AFM A;  4IIJ E;  2WAU A;  4BAY B;  2Y57 A;  4JI5 T;  2I0M A;  3RGL A;  4U72 A;  1HNZ T;  4TWD A;  3B5M A;  3AVS A;  2WZH A;  4HWC A;  4Z91 A;  3WTJ A;  4UEL A;  4BJM A;  3CVR A;  2BYQ A;  2XQA A;  4GIW A;  4DR3 T;  4JI8 T;  4PJL A;  5JR9 A;  4LF6 T;  2H7V C;  5FXV A;  2CPT A;  3C64 A;  2JQ9 A;  2A2F X;  4C91 A;  5C2T A;  3SOL A;  2NTY A;  3RIF A;  3ANW A;  4O4H E;  4HWH A;  4ADZ A;  3P4P A;  4I55 E;  1SA0 E;  1LRZ A;  5AQI B;  2CHN A;  4COF A;  2XM2 A;  4X1Y E;  3P4W A;  1YKE B;  2EHO A;  2JPF A;  1MMG A;  4ZK1 A;  1IBL T;  5TVC A;  1IBM T;  3F31 A;  3TLT A;  4H9O C;  2BVL A;  3PUQ A;  3I0O A;  2WMN A;  2IW5 B;  4O2B E;  3PMZ A;  1OWA A;  2XQ9 A;  4CI2 B;  4BJN A;  4ASK A;  3ETU A;  3T4M A;  2J4G A;  4U2Z A;  3ZDG A;  1ZEE A;  1MIW A;  3MJX A;  2LM9 A;  2XAQ B;  3NVO A;  2KSR A;  2JMH A;  4A98 A;  3UU8 A;  3OVU A;  1N33 T;  3SFE A;  2WCA A;  1L0V A;  4AIU A;  4X62 T;  2DI4 A;  4WYV A;  3VKH A;  5FY0 A;  1KFY A;  1LVF A;  3TKL B;  3AXJ B;  4Z8X A;  4X65 T;  4GKJ T;  3BQK A;  3RIA A;  3P7I A;  4YHJ A;  3Q9D A;  3AE6 A;  3K8P C;  3SWH A;  1XNR T;  4XK9 A;  2HHH T;  5LNK A;  3EI0 A;  2C0S A;  2UUB T;  5FNV E;  3RKO A;  3ZT6 A;  2B1E A;  2K9A A;  3T1Y T;  4IE4 A;  4QH4 A;  4EED A;  2VK9 A;  5FL1 A;  2KXP B;  3HKE E;  3RPU A;  5L4E A;  3L39 A;  3P50 A;  2XQ3 A;  3C79 A;  5KE4 A;  1NWM X;  1W9R A;  4IGU A;  3SH1 A;  1UX5 A;  1T98 A;  2XZ5 A;  3N9O A;  4HEA A;  2CLY C;  1WYB A;  4ILA A;  3UUX B;  2M6I A;  1XNQ T;  4OYK A;  2UXC T;  3RRC A;  3WTL A;  3N2K E;  2IAK A;  5AQR B;  5AQL B;  3SQ6 A;  3K3O A;  2UXD T;  3MKD A;  3VHL A;  2VQE T;  5JQG E;  3FZM B;  2IC9 A;  3GN5 B;  3IEE A;  2LHN A;  5JTG A;  3AE3 A;  2GK9 A;  2WN9 A;  5F5W A;  5CO5 A;  1WCR A;  5L4H A;  1T8B A;  3UUL A;  4QH5 A;  5ABH A;  3HI2 A;  4JI4 T;  1SHZ C;  1ZKE A;  2NOX A;  3F57 A;  3QK6 A;  3SS1 A;  4KMC A;  3WTK A;  4JBW F;  2BVM A;  2LJL A;  2VQF T;  4DR2 T;  5ETW A;  5KXJ A;  2DWK A;  4ZS2 A;  4IE0 A;  1FMV A;  1E7P A;  4AQY T;  5AQM B;  2IML A;  1I6Z A;  3AEF A;  5EK3 A;  5HXR A;  3NZQ A;  2DWG A;  5AFH A;  5E0O A;  3JC6 C;  4IE6 A;  2VL0 A;  1OED E;  2UUC T;  3AAA B;  3EUH A;  4JLE A;  5J5F A;  3FB2 A;  4JV5 T;  3H3A A;  2ODV A;  3PU8 A;  2C5J A;  2XQ8 A;  3J7Y q;  4KHP T;  4AI6 A;  2WWU A;  5JDF A;  1IZN B;  3PJA A;  5LHH B;  3C4W A;  2FJB A;  3ZCI A;  2X0L B;  3I1A A;  4UF0 A;  4CN4 A;  3U3I A;  4TV9 E;  1HX1 B;  1J5W A;  4K0U A;  4YXD A;  2ZM0 A;  3SQ9 A;  2J62 A;  4E7S A;  1IBK T;  3RC8 A;  2NW9 A;  3KDS E;  5AFJ A;  3N5L A;  5HEJ A;  4ILC A;  2WU2 A;  4JI7 T;  2Q9Q D;  1VCS A;  3SRZ A;  3O9X A;  4H9Q C;  4PNI A;  3LJC A;  5L47 A;  2BJ0 A;  2FUP A;  4ZI3 C;  4UXN B;  1U4Q A;  3ONX A;  4GOU A;  4ZI7 E;  3OBV E;  2P9B A;  1WYC A;  3KV5 A;  2CA5 A;  3AAI A;  3VKG A;  5C3J A;  2XTL A;  3IF8 B;  5C8Y E;  1FEW A;  1Z0P A;  3HR0 A;  4PW8 A;  4XAX B;  2EHO B;  5JDM A;  4WV9 A;  2NW7 A;  2XZE A;  3U8K A;  4IDO A;  5AQP B;  3MAC A;  3C50 A;  2A3D A;  1G73 A;  3RF1 A;  4AFH A;  4MLK A;  3ZN1 B;  2Y7Y A;  3A7M A;  1WR6 A;  2W61 A;  1YKH B;  5ABG A;  2ZJU A;  2ZM6 T;  3OYZ A;  3AXJ A;  4EYU A;  1UUR A;  4CXX A;  5AQG B;  3PTR B;  4DUY T;  4DBR A;  5EZY E;  2OA5 A;  2N1G A;  4CQI A;  4J2C A;  4NUV A;  4ZI3 D;  2CEA A;  4O8S A;  1AJ3 A;  1M7K A;  1MIY A;  2RP4 A;  3JCF A;  3HL6 A;  4YY3 T;  2PJQ A;  2KIN B;  3OKQ A;  3ZJ1 A;  1KF6 A;  4UEM A;  4ZI2 C;  3B57 A;  2YIN A;  3AA7 B;  2BZB A;  4DV2 T;  3RQW A;  2IC6 A;  4OFZ A;  2CXL A;  3ZEF B;  2WWV A;  4IDN A;  4ZRU A;  4XZC A;  3VR8 A;  4UVA B;  3R84 B;  4UY2 A;  5FVL A;  2J47 A;  2QVA A;  4YSX A;  2WY2 A;  3N9L A;  2JJ9 A;  3AA1 B;  2UU9 T;  1R8I A;  3RLF F;  2F4V T;  1US7 B;  1XMO T;  4H9S E;  1S94 A;  3HA4 A;  2HPJ A;  2WNC A;  5L3E B;  4CXY A;  1GQE A;  2ZM8 A;  3AAE B;  3BQI A;  2DHR A;  3GN5 A;  5CA0 E;  3ZCJ A;  5CFB A;  1D1B A;  2RPA A;  4AIS A;  3F2E A;  4PK6 A;  3E08 A;  2SPC A;  4WNK A;  1SE7 A;  3ZDH A;  4O4L E;  3A5X A;  3PUV F;  4KP3 C;  2H7O A;  2WM9 A;  3LG7 A;  3WIP A;  1NEN A;  2W67 A;  4PK4 A;  3WTO A;  2K24 A;  2V6X A;  4CI1 B;  2YK0 A;  2XQ5 A;  2E8I A;  4B3R T;  4DMV A;  1W0B A;  2WB5 A;  3RQU A;  2LSK A;  4DVD A;  3AEC A;  1JNZ A;  1HG2 A;  2E9X D;  5LGN B;  2E5V A;  1UV6 A;  2NTX A;  5JDQ A;  4ZK4 A;  5DQW A;  1LVK A;  2YU1 A;  1N34 T;  4XBF B;  4O4J E;  2WSS V;  3AA6 B;  1HG5 A;  3ZLI A;  5JDN A;  3U8L A;  2YKS A;  2UXN B;  4JEU B;  3IHR A;  5AQH B;  3E22 E;  3UFG A;  5JR9 C;  2UUA T;  5FJV A;  1Z8U A;  3EAM A;  2HN2 A;  1NEK A;  4ZJS A;  3RKG A;  4IE7 A;  4Q25 A;  5L2L A;  4LFB T;  3N9P A;  4UF0 B;  3TLW A;  4LMJ A;  2L3L A;  4IL9 A;  4TNV A;  3UTK A;  2ZJV A;  4A97 A;  4EEB A;  4X64 T;  4UM3 P;  2CWY A;  4ILB A;  4GYR A;  2EHO C;  2ES0 A;  5LHG B;  4DV5 T;  3AEB A;  3RHW A;  2AXD S;  3VRB A;  5AQS B;  4B6X A;  4DBQ A;  2W62 A;  3ZKR A;  2BKN A;  4UR9 A;  4P0B A;  3M3Z B;  5TAO A;  3CX8 B;  4OHF A;  2JQQ A;  1D1A A;  5IYZ E;  5LXB A;  2LSJ A;  4IDP A;  2CM0 A;  4YFS A;  3GA8 A;  4HN9 A;  2Y54 A;  2QRX A;  2BYS A;  3LSV A;  4YJ3 E;  4B5D A;  2L8K A;  1XDO A;  2K48 A;  3LK2 B;  2NW8 A;  3EDV A;  5JVD E;  2WZI A;  1B7T A;  4UM3 S;  5CGM A;  4ZZB A;  2CCQ A;  2Y58 A;  2LKG A;  1BR0 A;  3ZT5 A;  1LKX A;  5HYA A;  2XAF B;  4QWN B;  2W4X A;  4BQT A;  2XYS A;  3AE8 A;  4HFE A;  4DMW A;  2KMF A;  3TLS A;  4CI3 B;  2X0Y A;  4U31 A;  2VKO A;  2KND A;  1ZV4 X;  1BR2 A;  4OK0 A;  3TLV A;  2V5C A;  4F6R C;  2IHR 1;  2LSG A;  4AKH A;  1SUM B;  3GUA A;  2YN6 A;  3AEG A;  3WAK A;  3B13 A;  1N32 T;  3NRX A;  4YSZ A;  2H88 A;  1KK7 A;  5CJ5 A;  4X1I E;  2D2S A;  2X67 A;  5H6R B;  2XNU A;  2YDS A;  2V7I A;  5FY7 A;  5HXH A;  2CRB A;  3PUR A;  3ZYL A;  5BRX A;  1ZHC A;  4JI6 T;  3S4U A;  2X00 A;  1HF8 A;  4P0A A;  3FHN A;  2W63 A;  2QC1 B;  1Y01 A;  2E5L T;  4I43 B;  1YXR A;  3N2O A;  2X51 A;  4UV9 B;  4U7I A;  4HKA A;  4DBM A;  2VKJ A;  1XDP A;  3ZMZ B;  4PFO A;  3AE2 A;  3U8N A;  3UUM A;  5JDL A;  4KBM B;  3N9M A;  4QXB B;  3U78 A;  5HEO A;  2D5U A;  3FZH B;  2BKO A;  3VU7 H;  2WNL A;  3GWH A;  4PK5 A;  4ZEY A;  4U33 A;  1G8X A;  4DND A;  5AIN A;  3UU5 A;  2D0U A;  3RRW A;  3BQL A;  4XHE A;  4B3S T;  2LOS A;  3SIO A;  4JI2 T;  2BS3 A;  3Q5W A;  5IHY A;  2VVN A;  5JRE A;  1M62 A;  3FZL B;  3WTN A;  3CPZ A;  2MTQ A;  3M65 A;  4QH1 A;  4DO0 A;  4GK5 E;  3OYX A;  5DQV A;  2Q9Q A;  4HFC A;  4QX8 B;  1WLX A;  4AXP A;  3Q5E A;  2BYN A;  5HCJ A;  5LJN A;  2XY8 B;  4IST A;  5CA1 E;  2LLY A;  2JQH A;  4HFH A;  2BR8 A;  3AE7 A;  3O1J A;  2LSI A;  3I9W A;  5LGT B;  3CX7 B;  4L5G A;  3LDQ B;  4GYS A;  1HFA A;  3PUW F;  5LOV E;  2XQ6 A;  3ZMT B;  1Y64 B;  2DNX A;  3C84 A;  5F8P A;  4GK0 E;  4ZR6 A;  2J1D G;  5HEH A;  3Q5X A;  3AED A;  3QB5 K;  2BBH A;  2LEH A;  3IBP A;  2KWH A;  1D0Y A;  2XAS B;  4TWF A;  3MA9 A;  2UXX B;  3FXE B;  5ABE A;  4YT0 A;  4DID B;  2K5B B;  1YQ3 A;  1QUU A;  5AQV B;  1MMD A;  5AQK B;  5LG4 A;  2DL1 A;  3CK6 A;  5ABF A;  2DCF A;  1XWM A;  2C5I T;  3EAB A;  2X9Y A;  3AE5 A;  3EVY A;  5J2U E;  4LF7 T;  3LBX A;  5J5G A;  2H89 A;  3A8Y C;  4L9I A;  4YSY A;  2Y48 B;  1IAP A;  3CQG B;  3JC6 D;  3RYC E;  2BR7 A;  1V9D A;  1X79 A;  3TLU A;  3QNU A;  2V8S V;  4EOZ B;  3CML A;  3QUJ A;  2HH7 A;  3I0Q A;  1NAF A;  2VAS A;  5CB4 E;  2W66 A;  4LF8 T;  5LCY A;  4FI5 A;  4P1N A;  4PFP A;  2WDV A;  2FJE A;  3H3M A;  5BMV E;  3E0Z A;  2WDR A;  1QLB A;  4AKR B;  2W00 A;  2CHO A;  5LG3 A;  2LKH A;  2V1D B;  3O1I A;  2LHR A;  4QXC B;  5AFL A;  1WRD A;  4Z90 A;  3U8J A;  3NRY A;  4UV8 B;  3ZMS B;  2BG9 B;  1H7C A;  3FBL A;  1VOM A;  1O3X A;  3KV4 A;  2W8F A;  2IUB A;  4TX5 A;  4DV3 T;  2WQY A;  3QC9 A;  1E1H B;  5JME A;  2XQ7 A;  3ZC0 A;  3ONJ A;  3ZSS A;  1HS7 A;  3H37 A;  5KX5 E;  5LB7 B;  5LMU T;  3PDY A;  1XMQ T;  3VR9 A;  3C98 B;  5LHI B;  4HFV A;  5HXC A;  3N9Q A;  5L3C B;  5L3F B;  4X20 E;  4UM3 A;  2CBJ A;  5LXT E;  5AQO B;  4YJ2 E;  1J1J A;  3UUN A;  2JRK A;  4H63 H;  5L3D B;  4DV0 T;  3UT5 E;  5J0Z A;  5HAX A;  4ERR A;  5L3G B;  2ACX A;  3UU4 A;  1HX8 A;  3P8C D;  1XZY A;  3FZF B;  4IHJ E;  3J9X 1;  2X9W A;  2VUR A;  4KI0 F;  3K3Q C;  3RYI E;  2UZ6 A;  3N9N A;  2BS2 A;  2WS3 A;  4TUY E;  4ZS3 A;  4TZ4 C;  3KBU A;  4QXH B;  5M4Y A;  5LJM A;  2XPK A;  4HFD A;  3DP7 A;  3Q5D A;  2A9U A;  1D0Z A;  2BDE A;  3T8O A;  4ZI2 D;  1W09 A;  4MHC A;  2I59 A;  3PE0 A;  3UQ4 A;  4UVB B;  5KDM C;  4YTM A;  4MBQ A;  1JNR A;  4ISS A;  3PJA J;  4ANJ A;  2XAH B;  3FXD B;  2W0G A;  5LA6 E;  3OJA A;  3PEO A;  5FY1 A;  4I4T E;  5KMG P;  4ZHQ E;  2WDQ A;  4WW0 A;  5LP6 E;  5JRC B;  5L3B B;  2ZM2 A;  2LOP A;  5AQJ B;  3AEE A;  3ONL C;  2I6H A;  4P09 A;  4JI3 T;  2C5K T;  3CKD A;  3NBX X;  2FBW A;  4JI1 T;  5F3J A;  1T7S A;  1YD8 G;  2YME A;  5HEG A;  3PU3 A;  3KBT A;  3MZK B;  2QYW A;  3QB5 A;  2VL8 A;  3V5S A;  2X66 A;  4U74 A;  4LML A;  2VKH A;  3ZJ2 A;  5AFU L;  4FJO A;  2C9T A;  1CHU A;  1OED A;  2Q9Q B;  5AQU B;  2KWI B;  5HEU A;  3AE9 A;  3RIU A;  2Y8D A;  4EGW A;  4AKL A;  4MFR A;  3RIU C;  4DR7 T;  3O1H A;  3OPC A;  3AEA A;  3WAJ A;  3KFW X;  2CXD A;  5AFN A;  2VB6 A;  4JUY A;  4PIR A;  2FJD A;  5BR8 T;  5AQQ B;  2V7L A;  2YEV C;  2V7M A;  3SFD A;  2HN1 A;  3AB3 B;  4TNW A;  3PUG A;  3ZC1 A;  4D01 A;  2PGZ A;  3G06 A;  4EYY R;  3Q2M A;  2KT9 A;  5FXZ A;  2IDO B;  4YHH T;  4NPP A;  4AQG A;  2JIW A;  3P4Q A;  4IT4 A;  1T72 A;  3PUZ F;  3LK3 B;  1WFD A;  1DU2 A;  2E2A A;  3LK4 2;  4NUU A;  3ZMV B;  2X9H A;  5DJQ C;  1HTJ F;  1BR4 A;  4KUM B;  4LF5 T;  2PG8 A;  3L09 A;  4HTE A;  4WZX A;  5ABF B;  5J5I A;  2BYR A;  1UCU A;  4DV7 T;  3CWZ B;  4CN6 A;  4LFA T;  4EZH A;  3LBX B;  5IUX A;  3ZYK A;  3ZYM A;  4BA9 A;  4HWD A;  1UUS A;  4PJN A;  1I94 T;  1I9B A;  1HCI A;  4HWI B;  4G63 A;  4JEH B;  4UVC B;  5HWY A;  2XAG B;  4U3C A;  3JAE A;  4UXU A;  5LBM A;  3WTM A;  2CXF A;  4QAA A;  2BG9 A;  4DR6 T;  4B3T T;  3KV6 A;  2BG9 C;  4X66 T;  3HKB E;  3DJB A;  1KNZ A;  5LBQ B;  2RA1 A;  4U2Y A;  5HXS A;  4HGA A;  2YMD A;  2YDR A;  4AKI A;  2Z6E A;  3K1S A;  4X1K E;  2V5D A;  1N36 T;  1W0A A;  1HR0 T;  2V7K A;  1UX2 A;  3N2G E;  2EHO D;  2OLT A;  3NKZ A;  5GON E;  3EDU A;  3AA0 B;  3KV9 A;  4L0R A;  1MNE A;  2KLQ A;  5FVK A;  3CX6 B;  4OYJ A;  3IA3 A;  2LSY A;  4CN1 A;  4QAC A;  4E7Z A;  2NWB A;  2W2U A;  4EV6 A;  2XM1 A;  2XHE B;  2YOE A;  2MAW A;  1IJ6 A;  4PJM A;  2X0H A;  2XZ6 A;  2MPK A;  1EZ3 A;  5EK4 A;  3V5U A;  3RC3 A;  3CIR A;  3P4S A;  1VRB A;  4I50 E;  3QOF A;  4H63 V;  3OTO T;  3ESL A;  2XNT A;  2L9Q A;  3HKC E;  1KNR A;  2K3W A;  5JH7 E;  4V1A v;  3JAD A;  4C90 A;  5FXX A;  3NZP A;  4YTN A;  3IGQ A;  2VVS A;  5EK2 A;  4CXW A;  4LF9 T;  2E9X B;  2V6Y B;  4DUZ T;  3LFM A;  5JRC A;  4WBO A;  4GKK T;  4JI0 T;  2PTF A;  2D9D A;  2WU5 A;  4QAB A;  5FYM A;  1FJG T;  1MND A;  3UFE A;  3ZPO A;  1U5P A;  4NXM T;  3C4X A;  4EZ1 A;  5J2T E;  3L3P A;  2JQK A;  2WBL A;  2QA7 A;  2LRK A;  1WR0 A;  4N78 D;  2ACZ A;  4EB6 E;  2X9X A;  3GMI A;  4A56 A;  2BYP A;  2R6G F;  5JDH A;  1D1C A;  2D0T A;  3VRA A;  2FJA A;  3C4Z A;  2MYS A;  2Q9Q C;  5AFK A;  4EZ4 A;  2BS4 A;  2YDQ A;  2X00 D;  2MOZ A;  2WZY A;  2LT3 A;  4DV6 T;  4K0K T;  3W15 B;  3KVB A;  3DTO A;  1X9B A;  4CZZ B;  3R6N A;  3CQX C;  3CQC B;  4IDQ A;  4EAH A;  4NIQ A;  2XSA A;  2N2N A;  5AQT B; 
#chains in the Genus database with same CATH homology
 5J5I A;  2BYR A;  4AFG A;  5KZU A;  1OED B;  2XNT A;  3EI0 A;  3WTH A;  3U8L A;  2YME A;  4UM3 S;  4ZZB A;  5IUX A;  4LMK A;  2Y58 A;  2YKS A;  2LKG A;  5HEG A;  1UW6 A;  4WV9 A;  3WTK A;  5HEO A;  4TWF A;  2WNJ A;  2WNL A;  3UQ7 A;  2W8G A;  3U8K A;  4NZB A;  2BG9 E;  3JAF A;  4TWH A;  3UU3 A;  5AFM B;  4BQT A;  3RIF A;  1I9B A;  2LM2 A;  4AFH A;  2WNC A;  3JAD A;  4UM3 A;  4QH4 A;  2XYS A;  2Y7Y A;  4HFE A;  5AIN A;  4COF A;  4AFT A;  4LML A;  3IGQ A;  3P4W A;  2C9T A;  3JAE A;  4UXU A;  1OED A;  3UU5 A;  3UUB A;  2ZJU A;  3WTM A;  3TLS A;  5J5H A;  5L4E A;  5FJV A;  3EAM A;  4QAA A;  2BG9 A;  5J5G A;  5CFB A;  5AFH A;  4XHE A;  4ZK1 A;  4ZJS A;  3P50 A;  2BG9 C;  5HEU A;  5J0Z A;  4HFB A;  3SIO A;  2XQ3 A;  2VL0 A;  1OED E;  2BR7 A;  3C79 A;  5TVC A;  5KE4 A;  4UM1 A;  3TLV A;  3UU4 A;  3TLU A;  4IRE A;  3TLW A;  3TLT A;  2YMD A;  5J5F A;  4QAB A;  3WTN A;  3SH1 A;  4QH1 A;  5BW2 A;  4LMJ A;  3ZDH A;  2PH9 A;  2UZ6 A;  4IL9 A;  2YN6 A;  2XZ5 A;  3GUA A;  4TNV A;  3PMZ A;  2XQ8 A;  2XQ9 A;  5SYO A;  3WTI A;  4HFC A;  4HFD A;  4A97 A;  2XYT A;  4ILA A;  2ZJV A;  4UM3 P;  5AFN A;  4ILB A;  3WIP A;  4EZ1 A;  4ALX A;  4PIR A;  2M6I A;  3T4M A;  1OED C;  1UX2 A;  3RI5 A;  3WTO A;  3ZDG A;  2M6B A;  2Y56 A;  4ZZC A;  4HFI A;  3RHW A;  3WTL A;  5AFM A;  2XNU A;  2XQ4 A;  2BYN A;  5HCJ A;  4TNW A;  2KSR A;  2XQ5 A;  4A98 A;  3SQ9 A;  3ZKR A;  3U8M A;  2Y57 A;  4D01 A;  3SQ6 A;  5LG3 A;  2PGZ A;  5AFJ A;  3UU8 A;  3UQ4 A;  4BFQ A;  2LLY A;  2LKH A;  4F8H A;  4HFH A;  2BR8 A;  5HEJ A;  2BYP A;  4ILC A;  5AFL A;  5BRX A;  4QAC A;  5LXB A;  4TWD A;  4NPP A;  3RQU A;  4Z90 A;  3U8J A;  3RQW A;  4X5T A;  5AFK A;  4Z91 A;  2BG9 B;  5L47 A;  2X00 A;  3WTJ A;  4HQP A;  2BJ0 A;  2Y54 A;  3UU6 A;  2BYQ A;  2X00 D;  2WZY A;  2XQ6 A;  2YOE A;  3PEO A;  2MAW A;  2XQA A;  2WN9 A;  2QC1 B;  2BYS A;  4FRR A;  5CO5 A;  3LSV A;  2XZ6 A;  4ZRU A;  1UV6 A;  4ZK4 A;  3RIA A;  5L4H A;  2W8F A;  4ZJT A;  4B5D A;  5BP0 A;  3C84 A;  4QH5 A;  4DBM A;  4IL4 A;  2XNV A;  4UY2 A;  4ZR6 A;  5JME A;  2XQ7 A;  5HCM A;  5HEH A;  3EHZ A;  4XK9 A;  3U8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...