5JMEA

Crystal structure of acetylcholine binding protein (achbp) from aplysia californica in complex with alpha-conotoxin peia
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
209
structure length
205
Chain Sequence
DKLHSQANLMRLKSDLFNYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine binding protein
molecule keywords Soluble acetylcholine receptor
publication title Crystal structure of acetylcholine binding protein (AChBP) from Aplysia Californica in complex with alpha-conotoxin PeIA
rcsb
source organism Aplysia californica
total genus 49
structure length 205
sequence length 209
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5jmeA00
2XNTA 4UY2A 3P50A 5LG3A 2XQ8A 5JMEA 5J0ZA 2W8GA 2Y7YA 3WTHA 2XNUA 2BYRA 5J5FA 3PEOA 3ZDHA 4HQPA 2WNLA 4AFTA 2Y57A 5CFBA 4B5DA 5KE4A 4Z90A 4LMJA 5BW2A 3T4MA 2YMDA 5AFMB 5CO5A 2XQ7A 2Y58A 2XQ5A 5HEUA 2YN6A 4ZK4A 5AFMA 4HFCA 2Y56A 4XK9A 2BG9C 3RHWA 4IL4A 4HFBA 3GUAA 3RIFA 5SYOA 5FJVA 3RIAA 1UX2A 2ZJUA 4HFEA 4HFIA 4IL9A 1UV6A 2YOEA 5HEOA 2XZ5A 4ILAA 4ZJSA 3U8KA 2WNJA 3EI0A 3WIPA 3EAMA 2UZ6A 4ZZBA 4X5TA 5KZUA 2VL0A 4ZR6A 5HCJA 3WTJA 5J5IA 2YKSA 3EHZA 5AFJA 4IREA 2XYSA 4ZRUA 3U8NA 3UU8A 3WTOA 4ILBA 4ILCA 4UM1A 4QACA 3U8JA 2BYPA 4A97A 5IUXA 5TVCA 4BFQA 2X00A 4NPPA 2BYQA 4PIRA 4LMKA 4UXUA 4A98A 1I9BA 3TLSA 4TNVA 2XYTA 4ZK1A 3JADA 3WTNA 3U8LA 2WNCA 2Y54A 3UUBA 3WTLA 2WN9A 3SQ6A 3UQ7A 5HEHA 4LMLA 4QABA 2XQ3A 4QH1A 2XQ4A 3WTIA 2WZYA 3C79A 3LSVA 2BG9B 5HEGA 3RQUA 3TLTA 1UW6A 2PGZA 3PMZA 4WV9A 4COFA 2BG9A 4ZZCA 5HCMA 4NZBA 3UQ4A 2QC1B 3UU5A 3WTMA 3ZKRA 3P4WA 4QH5A 4TWDA 4ZJTA 3UU3A 4EZ1A 4ALXA 4Z91A 2X00D 4QAAA 3TLUA 5AINA 3ZDGA 3JAEA 2ZJVA 4QH4A 5AFHA 5J5HA 4UM3P 4FRRA 5L4HA 3SQ9A 2YMEA 3IGQA 5HEJA 2PH9A 5L47A 3UU4A 3TLWA 3WTKA 2BYNA 2BR7A 2BJ0A 3RI5A 4TWHA 2XQ9A 4BQTA 4HFDA 2W8FA 4D01A 5J5GA 5AFKA 2XNVA 2BR8A 4HFHA 2BYSA 3TLVA 4AFHA 3RQWA 5LXBA 3UU6A 2BG9E 4UM3A 3JAFA 4TNWA 3C84A 3SH1A 4XHEA 4AFGA 5AFNA 2C9TA 5L4EA 2XQ6A 3SIOA 5BP0A 4F8HA 5BRXA 4UM3S 2XZ6A 4TWFA 2XQAA 4DBMA 5AFLA 3U8MA
chains in the Genus database with same CATH superfamily
2XNTA 4UY2A 3P50A 5LG3A 2XQ8A 5JMEA 5J0ZA 2W8GA 2Y7YA 3WTHA 2XNUA 2BYRA 5J5FA 3PEOA 3ZDHA 4HQPA 2WNLA 4AFTA 2Y57A 5CFBA 4B5DA 5KE4A 4Z90A 4LMJA 5BW2A 3T4MA 2YMDA 5AFMB 5CO5A 2XQ7A 2Y58A 2XQ5A 5HEUA 2YN6A 4ZK4A 5AFMA 4HFCA 2Y56A 4XK9A 2BG9C 3RHWA 4IL4A 4HFBA 3GUAA 3RIFA 5SYOA 5FJVA 3RIAA 1UX2A 2ZJUA 4HFEA 4HFIA 4IL9A 1UV6A 2YOEA 5HEOA 2XZ5A 4ILAA 4ZJSA 3U8KA 2WNJA 3EI0A 3WIPA 3EAMA 2UZ6A 4ZZBA 4X5TA 5KZUA 2VL0A 4ZR6A 5HCJA 3WTJA 5J5IA 2YKSA 3EHZA 5AFJA 4IREA 2XYSA 4ZRUA 3U8NA 3UU8A 3WTOA 4ILBA 4ILCA 4UM1A 4QACA 3U8JA 2BYPA 4A97A 5IUXA 5TVCA 4BFQA 2X00A 4NPPA 2BYQA 4PIRA 4LMKA 4UXUA 4A98A 1I9BA 3TLSA 4TNVA 2XYTA 4ZK1A 3JADA 3WTNA 3U8LA 2WNCA 2Y54A 3UUBA 3WTLA 2WN9A 3SQ6A 3UQ7A 5HEHA 4LMLA 4QABA 2XQ3A 4QH1A 2XQ4A 3WTIA 2WZYA 3C79A 3LSVA 2BG9B 5HEGA 3RQUA 3TLTA 1UW6A 2PGZA 3PMZA 4WV9A 4COFA 2BG9A 4ZZCA 5HCMA 4NZBA 3UQ4A 2QC1B 3UU5A 3WTMA 3ZKRA 3P4WA 4QH5A 4TWDA 4ZJTA 3UU3A 4EZ1A 4ALXA 4Z91A 2X00D 4QAAA 3TLUA 5AINA 3ZDGA 3JAEA 2ZJVA 4QH4A 5AFHA 5J5HA 4UM3P 4FRRA 5L4HA 3SQ9A 2YMEA 3IGQA 5HEJA 2PH9A 5L47A 3UU4A 3TLWA 3WTKA 2BYNA 2BR7A 2BJ0A 3RI5A 4TWHA 2XQ9A 4BQTA 4HFDA 2W8FA 4D01A 5J5GA 5AFKA 2XNVA 2BR8A 4HFHA 2BYSA 3TLVA 4AFHA 3RQWA 5LXBA 3UU6A 2BG9E 4UM3A 3JAFA 4TNWA 3C84A 3SH1A 4XHEA 4AFGA 5AFNA 2C9TA 5L4EA 2XQ6A 3SIOA 5BP0A 4F8HA 5BRXA 4UM3S 2XZ6A 4TWFA 2XQAA 4DBMA 5AFLA 3U8MA
chains in the Genus database with same CATH topology
2XNTA 4UY2A 3P50A 5LG3A 2XQ8A 5JMEA 5J0ZA 2W8GA 2Y7YA 3WTHA 2XNUA 2BYRA 5J5FA 3PEOA 3ZDHA 4HQPA 2WNLA 4AFTA 2Y57A 5CFBA 4B5DA 5KE4A 4Z90A 4LMJA 5BW2A 3T4MA 2YMDA 5AFMB 5CO5A 2XQ7A 2Y58A 2XQ5A 5HEUA 2YN6A 4ZK4A 5AFMA 4HFCA 2Y56A 4XK9A 2BG9C 3RHWA 4IL4A 4HFBA 3GUAA 3RIFA 5SYOA 5FJVA 3RIAA 1UX2A 2ZJUA 4HFEA 4HFIA 4IL9A 1UV6A 2YOEA 5HEOA 2XZ5A 4ILAA 4ZJSA 3U8KA 2WNJA 3EI0A 3WIPA 3EAMA 2UZ6A 4ZZBA 4X5TA 5KZUA 2VL0A 4ZR6A 5HCJA 3WTJA 5J5IA 2YKSA 3EHZA 5AFJA 4IREA 2XYSA 4ZRUA 3U8NA 3UU8A 3WTOA 4ILBA 4ILCA 4UM1A 4QACA 3U8JA 2BYPA 4A97A 5IUXA 5TVCA 4BFQA 2X00A 4NPPA 2BYQA 4PIRA 4LMKA 4UXUA 4A98A 1I9BA 3TLSA 4TNVA 2XYTA 4ZK1A 3JADA 3WTNA 3U8LA 2WNCA 2Y54A 3UUBA 3WTLA 2WN9A 3SQ6A 3UQ7A 5HEHA 4LMLA 4QABA 2XQ3A 4QH1A 2XQ4A 3WTIA 2WZYA 3C79A 3LSVA 2BG9B 5HEGA 3RQUA 3TLTA 1UW6A 2PGZA 3PMZA 4WV9A 4COFA 2BG9A 4ZZCA 5HCMA 4NZBA 3UQ4A 2QC1B 3UU5A 3WTMA 3ZKRA 3P4WA 4QH5A 4TWDA 4ZJTA 3UU3A 4EZ1A 4ALXA 4Z91A 2X00D 4QAAA 3TLUA 5AINA 3ZDGA 3JAEA 2ZJVA 4QH4A 5AFHA 5J5HA 4UM3P 4FRRA 5L4HA 3SQ9A 2YMEA 3IGQA 5HEJA 2PH9A 5L47A 3UU4A 3TLWA 3WTKA 2BYNA 2BR7A 2BJ0A 3RI5A 4TWHA 2XQ9A 4BQTA 4HFDA 2W8FA 4D01A 5J5GA 5AFKA 2XNVA 2BR8A 4HFHA 2BYSA 3TLVA 4AFHA 3RQWA 5LXBA 3UU6A 2BG9E 4UM3A 3JAFA 4TNWA 3C84A 3SH1A 4XHEA 4AFGA 5AFNA 2C9TA 5L4EA 2XQ6A 3SIOA 5BP0A 4F8HA 5BRXA 4UM3S 2XZ6A 4TWFA 2XQAA 4DBMA 5AFLA 3U8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XNT A;  4UY2 A;  3P50 A;  5LG3 A;  2XQ8 A;  5JME A;  5J0Z A;  2W8G A;  2Y7Y A;  3WTH A;  2XNU A;  2BYR A;  5J5F A;  3PEO A;  3ZDH A;  4HQP A;  2WNL A;  4AFT A;  2Y57 A;  5CFB A;  4B5D A;  5KE4 A;  4Z90 A;  4LMJ A;  5BW2 A;  3T4M A;  2YMD A;  5AFM B;  5CO5 A;  2XQ7 A;  2Y58 A;  2XQ5 A;  5HEU A;  2YN6 A;  4ZK4 A;  5AFM A;  4HFC A;  2Y56 A;  4XK9 A;  2BG9 C;  3RHW A;  4IL4 A;  4HFB A;  3GUA A;  3RIF A;  5SYO A;  5FJV A;  3RIA A;  1UX2 A;  2ZJU A;  4HFE A;  4HFI A;  4IL9 A;  1UV6 A;  2YOE A;  5HEO A;  2XZ5 A;  4ILA A;  4ZJS A;  3U8K A;  2WNJ A;  3EI0 A;  3WIP A;  3EAM A;  2UZ6 A;  4ZZB A;  4X5T A;  5KZU A;  2VL0 A;  4ZR6 A;  5HCJ A;  3WTJ A;  5J5I A;  2YKS A;  3EHZ A;  5AFJ A;  4IRE A;  2XYS A;  4ZRU A;  3U8N A;  3UU8 A;  3WTO A;  4ILB A;  4ILC A;  4UM1 A;  4QAC A;  3U8J A;  2BYP A;  4A97 A;  5IUX A;  5TVC A;  4BFQ A;  2X00 A;  4NPP A;  2BYQ A;  4PIR A;  4LMK A;  4UXU A;  4A98 A;  1I9B A;  3TLS A;  4TNV A;  2XYT A;  4ZK1 A;  3JAD A;  3WTN A;  3U8L A;  2WNC A;  2Y54 A;  3UUB A;  3WTL A;  2WN9 A;  3SQ6 A;  3UQ7 A;  5HEH A;  4LML A;  4QAB A;  2XQ3 A;  4QH1 A;  2XQ4 A;  3WTI A;  2WZY A;  3C79 A;  3LSV A;  2BG9 B;  5HEG A;  3RQU A;  3TLT A;  1UW6 A;  2PGZ A;  3PMZ A;  4WV9 A;  4COF A;  2BG9 A;  4ZZC A;  5HCM A;  4NZB A;  3UQ4 A;  2QC1 B;  3UU5 A;  3WTM A;  3ZKR A;  3P4W A;  4QH5 A;  4TWD A;  4ZJT A;  3UU3 A;  4EZ1 A;  4ALX A;  4Z91 A;  2X00 D;  4QAA A;  3TLU A;  5AIN A;  3ZDG A;  3JAE A;  2ZJV A;  4QH4 A;  5AFH A;  5J5H A;  4UM3 P;  4FRR A;  5L4H A;  3SQ9 A;  2YME A;  3IGQ A;  5HEJ A;  2PH9 A;  5L47 A;  3UU4 A;  3TLW A;  3WTK A;  2BYN A;  2BR7 A;  2BJ0 A;  3RI5 A;  4TWH A;  2XQ9 A;  4BQT A;  4HFD A;  2W8F A;  4D01 A;  5J5G A;  5AFK A;  2XNV A;  2BR8 A;  4HFH A;  2BYS A;  3TLV A;  4AFH A;  3RQW A;  5LXB A;  3UU6 A;  2BG9 E;  4UM3 A;  3JAF A;  4TNW A;  3C84 A;  3SH1 A;  4XHE A;  4AFG A;  5AFN A;  2C9T A;  5L4E A;  2XQ6 A;  3SIO A;  5BP0 A;  4F8H A;  5BRX A;  4UM3 S;  2XZ6 A;  4TWF A;  2XQA A;  4DBM A;  5AFL A;  3U8M A; 
#chains in the Genus database with same CATH topology
 2XNT A;  4UY2 A;  3P50 A;  5LG3 A;  2XQ8 A;  5JME A;  5J0Z A;  2W8G A;  2Y7Y A;  3WTH A;  2XNU A;  2BYR A;  5J5F A;  3PEO A;  3ZDH A;  4HQP A;  2WNL A;  4AFT A;  2Y57 A;  5CFB A;  4B5D A;  5KE4 A;  4Z90 A;  4LMJ A;  5BW2 A;  3T4M A;  2YMD A;  5AFM B;  5CO5 A;  2XQ7 A;  2Y58 A;  2XQ5 A;  5HEU A;  2YN6 A;  4ZK4 A;  5AFM A;  4HFC A;  2Y56 A;  4XK9 A;  2BG9 C;  3RHW A;  4IL4 A;  4HFB A;  3GUA A;  3RIF A;  5SYO A;  5FJV A;  3RIA A;  1UX2 A;  2ZJU A;  4HFE A;  4HFI A;  4IL9 A;  1UV6 A;  2YOE A;  5HEO A;  2XZ5 A;  4ILA A;  4ZJS A;  3U8K A;  2WNJ A;  3EI0 A;  3WIP A;  3EAM A;  2UZ6 A;  4ZZB A;  4X5T A;  5KZU A;  2VL0 A;  4ZR6 A;  5HCJ A;  3WTJ A;  5J5I A;  2YKS A;  3EHZ A;  5AFJ A;  4IRE A;  2XYS A;  4ZRU A;  3U8N A;  3UU8 A;  3WTO A;  4ILB A;  4ILC A;  4UM1 A;  4QAC A;  3U8J A;  2BYP A;  4A97 A;  5IUX A;  5TVC A;  4BFQ A;  2X00 A;  4NPP A;  2BYQ A;  4PIR A;  4LMK A;  4UXU A;  4A98 A;  1I9B A;  3TLS A;  4TNV A;  2XYT A;  4ZK1 A;  3JAD A;  3WTN A;  3U8L A;  2WNC A;  2Y54 A;  3UUB A;  3WTL A;  2WN9 A;  3SQ6 A;  3UQ7 A;  5HEH A;  4LML A;  4QAB A;  2XQ3 A;  4QH1 A;  2XQ4 A;  3WTI A;  2WZY A;  3C79 A;  3LSV A;  2BG9 B;  5HEG A;  3RQU A;  3TLT A;  1UW6 A;  2PGZ A;  3PMZ A;  4WV9 A;  4COF A;  2BG9 A;  4ZZC A;  5HCM A;  4NZB A;  3UQ4 A;  2QC1 B;  3UU5 A;  3WTM A;  3ZKR A;  3P4W A;  4QH5 A;  4TWD A;  4ZJT A;  3UU3 A;  4EZ1 A;  4ALX A;  4Z91 A;  2X00 D;  4QAA A;  3TLU A;  5AIN A;  3ZDG A;  3JAE A;  2ZJV A;  4QH4 A;  5AFH A;  5J5H A;  4UM3 P;  4FRR A;  5L4H A;  3SQ9 A;  2YME A;  3IGQ A;  5HEJ A;  2PH9 A;  5L47 A;  3UU4 A;  3TLW A;  3WTK A;  2BYN A;  2BR7 A;  2BJ0 A;  3RI5 A;  4TWH A;  2XQ9 A;  4BQT A;  4HFD A;  2W8F A;  4D01 A;  5J5G A;  5AFK A;  2XNV A;  2BR8 A;  4HFH A;  2BYS A;  3TLV A;  4AFH A;  3RQW A;  5LXB A;  3UU6 A;  2BG9 E;  4UM3 A;  3JAF A;  4TNW A;  3C84 A;  3SH1 A;  4XHE A;  4AFG A;  5AFN A;  2C9T A;  5L4E A;  2XQ6 A;  3SIO A;  5BP0 A;  4F8H A;  5BRX A;  4UM3 S;  2XZ6 A;  4TWF A;  2XQA A;  4DBM A;  5AFL A;  3U8M A; 
#chains in the Genus database with same CATH homology
 2XNT A;  4UY2 A;  3P50 A;  5LG3 A;  2XQ8 A;  5JME A;  5J0Z A;  2W8G A;  2Y7Y A;  3WTH A;  2XNU A;  2BYR A;  5J5F A;  3PEO A;  3ZDH A;  4HQP A;  2WNL A;  4AFT A;  2Y57 A;  5CFB A;  4B5D A;  5KE4 A;  4Z90 A;  4LMJ A;  5BW2 A;  3T4M A;  2YMD A;  5AFM B;  5CO5 A;  2XQ7 A;  2Y58 A;  2XQ5 A;  5HEU A;  2YN6 A;  4ZK4 A;  5AFM A;  4HFC A;  2Y56 A;  4XK9 A;  2BG9 C;  3RHW A;  4IL4 A;  4HFB A;  3GUA A;  3RIF A;  5SYO A;  5FJV A;  3RIA A;  1UX2 A;  2ZJU A;  4HFE A;  4HFI A;  4IL9 A;  1UV6 A;  2YOE A;  5HEO A;  2XZ5 A;  4ILA A;  4ZJS A;  3U8K A;  2WNJ A;  3EI0 A;  3WIP A;  3EAM A;  2UZ6 A;  4ZZB A;  4X5T A;  5KZU A;  2VL0 A;  4ZR6 A;  5HCJ A;  3WTJ A;  5J5I A;  2YKS A;  3EHZ A;  5AFJ A;  4IRE A;  2XYS A;  4ZRU A;  3U8N A;  3UU8 A;  3WTO A;  4ILB A;  4ILC A;  4UM1 A;  4QAC A;  3U8J A;  2BYP A;  4A97 A;  5IUX A;  5TVC A;  4BFQ A;  2X00 A;  4NPP A;  2BYQ A;  4PIR A;  4LMK A;  4UXU A;  4A98 A;  1I9B A;  3TLS A;  4TNV A;  2XYT A;  4ZK1 A;  3JAD A;  3WTN A;  3U8L A;  2WNC A;  2Y54 A;  3UUB A;  3WTL A;  2WN9 A;  3SQ6 A;  3UQ7 A;  5HEH A;  4LML A;  4QAB A;  2XQ3 A;  4QH1 A;  2XQ4 A;  3WTI A;  2WZY A;  3C79 A;  3LSV A;  2BG9 B;  5HEG A;  3RQU A;  3TLT A;  1UW6 A;  2PGZ A;  3PMZ A;  4WV9 A;  4COF A;  2BG9 A;  4ZZC A;  5HCM A;  4NZB A;  3UQ4 A;  2QC1 B;  3UU5 A;  3WTM A;  3ZKR A;  3P4W A;  4QH5 A;  4TWD A;  4ZJT A;  3UU3 A;  4EZ1 A;  4ALX A;  4Z91 A;  2X00 D;  4QAA A;  3TLU A;  5AIN A;  3ZDG A;  3JAE A;  2ZJV A;  4QH4 A;  5AFH A;  5J5H A;  4UM3 P;  4FRR A;  5L4H A;  3SQ9 A;  2YME A;  3IGQ A;  5HEJ A;  2PH9 A;  5L47 A;  3UU4 A;  3TLW A;  3WTK A;  2BYN A;  2BR7 A;  2BJ0 A;  3RI5 A;  4TWH A;  2XQ9 A;  4BQT A;  4HFD A;  2W8F A;  4D01 A;  5J5G A;  5AFK A;  2XNV A;  2BR8 A;  4HFH A;  2BYS A;  3TLV A;  4AFH A;  3RQW A;  5LXB A;  3UU6 A;  2BG9 E;  4UM3 A;  3JAF A;  4TNW A;  3C84 A;  3SH1 A;  4XHE A;  4AFG A;  5AFN A;  2C9T A;  5L4E A;  2XQ6 A;  3SIO A;  5BP0 A;  4F8H A;  5BRX A;  4UM3 S;  2XZ6 A;  4TWF A;  2XQA A;  4DBM A;  5AFL A;  3U8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...