4WV9A

Crystal structure of acetylcholine binding protein (achbp) from aplysia californica in complex with click chemistry compound (3-exo)-8,8-dimethyl-3-[4-(pyridin-4-yl)-1h-1,2,3-triazol-1-yl]-8-azoniabicyclo[3.2.1]octane
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
206
Chain Sequence
DKLHSQANLMRLKSDLFNYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Crystal structure of acetylcholine binding protein (AChBP) from Aplysia Californica in complex with click chemistry compound.
rcsb
source organism Aplysia californica
molecule tags Choline-binding protein
total genus 48
structure length 206
sequence length 210
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4wv9A00
3U8MA 2XNUA 2XQ3A 3JAFA 3P4WA 4TNWA 3RQUA 4ZR6A 3WTIA 4HFBA 4A97A 4AFTA 4XK9A 4BQTA 5KZUA 2BR8A 3ZDGA 2XQ7A 4Z90A 5L4EA 2BYRA 4COFA 2WNJA 4HFDA 3WTNA 4QACA 2W8GA 4ILCA 2XZ5A 4LMJA 5AFMA 3C84A 4WV9A 2ZJUA 4TWHA 2Y54A 3U8LA 3WTHA 4UM3S 4QABA 5AFJA 5AFKA 5CFBA 1UX2A 3RQWA 2XQ9A 4ZZBA 4IL9A 4QH5A 3ZKRA 3WTKA 4QH1A 3UQ7A 2BYQA 2BJ0A 4HFCA 4NPPA 2X00D 1UW6A 4D01A 4ALXA 5BP0A 3UQ4A 4QH4A 5AFLA 5FJVA 5HEGA 4EZ1A 3UU5A 4XHEA 3PEOA 5J5GA 2YMDA 3P50A 5J5FA 5L47A 5CO5A 4UM1A 2Y58A 5HEOA 4TWDA 2YOEA 2BG9B 4PIRA 4UXUA 2VL0A 2YMEA 3WTMA 5L4HA 3TLUA 2XYSA 4UM3A 2WN9A 2XQ6A 3UU4A 4LMKA 3C79A 3RIAA 3U8NA 5AFHA 2X00A 4ZJTA 4DBMA 2Y56A 4X5TA 3PMZA 4UY2A 3RI5A 2BG9E 2PGZA 3SQ6A 2BYPA 3TLWA 5J0ZA 3RHWA 3IGQA 4ZRUA 2BG9C 2YKSA 4TNVA 3U8JA 3WIPA 3U8KA 5BRXA 5LG3A 4AFGA 2WNLA 2WNCA 3WTJA 3GUAA 4Z91A 4AFHA 4A98A 4HFIA 2Y57A 4ZJSA 3TLSA 3T4MA 2PH9A 5JMEA 5SYOA 5KE4A 3EI0A 3TLVA 5AINA 4BFQA 4TWFA 5HEJA 2BYNA 4HQPA 2ZJVA 3UU6A 2XYTA 3EAMA 4ZZCA 3ZDHA 2XNVA 5HCJA 3SQ9A 2UZ6A 5HEHA 2C9TA 2XZ6A 3WTLA 1UV6A 5AFMB 5J5IA 4UM3P 4HFHA 5IUXA 4IL4A 4ILBA 5AFNA 1I9BA 3LSVA 2XQ4A 4NZBA 4QAAA 5LXBA 3RIFA 2QC1B 3SIOA 2Y7YA 5BW2A 2XQ8A 5J5HA 2XQAA 3UU8A 3WTOA 3EHZA 4IREA 4HFEA 2YN6A 4ZK1A 2XNTA 3SH1A 2W8FA 2WZYA 4ZK4A 3JAEA 3TLTA 2BR7A 4F8HA 3JADA 5HCMA 4LMLA 2BG9A 4FRRA 4ILAA 2XQ5A 5HEUA 3UUBA 2BYSA 3UU3A 4B5DA 5TVCA
chains in the Genus database with same CATH superfamily
3U8MA 2XNUA 2XQ3A 3JAFA 3P4WA 4TNWA 3RQUA 4ZR6A 3WTIA 4HFBA 4A97A 4AFTA 4XK9A 4BQTA 5KZUA 2BR8A 3ZDGA 2XQ7A 4Z90A 5L4EA 2BYRA 4COFA 2WNJA 4HFDA 3WTNA 4QACA 2W8GA 4ILCA 2XZ5A 4LMJA 5AFMA 3C84A 4WV9A 2ZJUA 4TWHA 2Y54A 3U8LA 3WTHA 4UM3S 4QABA 5AFJA 5AFKA 5CFBA 1UX2A 3RQWA 2XQ9A 4ZZBA 4IL9A 4QH5A 3ZKRA 3WTKA 4QH1A 3UQ7A 2BYQA 2BJ0A 4HFCA 4NPPA 2X00D 1UW6A 4D01A 4ALXA 5BP0A 3UQ4A 4QH4A 5AFLA 5FJVA 5HEGA 4EZ1A 3UU5A 4XHEA 3PEOA 5J5GA 2YMDA 3P50A 5J5FA 5L47A 5CO5A 4UM1A 2Y58A 5HEOA 4TWDA 2YOEA 2BG9B 4PIRA 4UXUA 2VL0A 2YMEA 3WTMA 5L4HA 3TLUA 2XYSA 4UM3A 2WN9A 2XQ6A 3UU4A 4LMKA 3C79A 3RIAA 3U8NA 5AFHA 2X00A 4ZJTA 4DBMA 2Y56A 4X5TA 3PMZA 4UY2A 3RI5A 2BG9E 2PGZA 3SQ6A 2BYPA 3TLWA 5J0ZA 3RHWA 3IGQA 4ZRUA 2BG9C 2YKSA 4TNVA 3U8JA 3WIPA 3U8KA 5BRXA 5LG3A 4AFGA 2WNLA 2WNCA 3WTJA 3GUAA 4Z91A 4AFHA 4A98A 4HFIA 2Y57A 4ZJSA 3TLSA 3T4MA 2PH9A 5JMEA 5SYOA 5KE4A 3EI0A 3TLVA 5AINA 4BFQA 4TWFA 5HEJA 2BYNA 4HQPA 2ZJVA 3UU6A 2XYTA 3EAMA 4ZZCA 3ZDHA 2XNVA 5HCJA 3SQ9A 2UZ6A 5HEHA 2C9TA 2XZ6A 3WTLA 1UV6A 5AFMB 5J5IA 4UM3P 4HFHA 5IUXA 4IL4A 4ILBA 5AFNA 1I9BA 3LSVA 2XQ4A 4NZBA 4QAAA 5LXBA 3RIFA 2QC1B 3SIOA 2Y7YA 5BW2A 2XQ8A 5J5HA 2XQAA 3UU8A 3WTOA 3EHZA 4IREA 4HFEA 2YN6A 4ZK1A 2XNTA 3SH1A 2W8FA 2WZYA 4ZK4A 3JAEA 3TLTA 2BR7A 4F8HA 3JADA 5HCMA 4LMLA 2BG9A 4FRRA 4ILAA 2XQ5A 5HEUA 3UUBA 2BYSA 3UU3A 4B5DA 5TVCA
chains in the Genus database with same CATH topology
3U8MA 2XNUA 2XQ3A 3JAFA 3P4WA 4TNWA 3RQUA 4ZR6A 3WTIA 4HFBA 4A97A 4AFTA 4XK9A 4BQTA 5KZUA 2BR8A 3ZDGA 2XQ7A 4Z90A 5L4EA 2BYRA 4COFA 2WNJA 4HFDA 3WTNA 4QACA 2W8GA 4ILCA 2XZ5A 4LMJA 5AFMA 3C84A 4WV9A 2ZJUA 4TWHA 2Y54A 3U8LA 3WTHA 4UM3S 4QABA 5AFJA 5AFKA 5CFBA 1UX2A 3RQWA 2XQ9A 4ZZBA 4IL9A 4QH5A 3ZKRA 3WTKA 4QH1A 3UQ7A 2BYQA 2BJ0A 4HFCA 4NPPA 2X00D 1UW6A 4D01A 4ALXA 5BP0A 3UQ4A 4QH4A 5AFLA 5FJVA 5HEGA 4EZ1A 3UU5A 4XHEA 3PEOA 5J5GA 2YMDA 3P50A 5J5FA 5L47A 5CO5A 4UM1A 2Y58A 5HEOA 4TWDA 2YOEA 2BG9B 4PIRA 4UXUA 2VL0A 2YMEA 3WTMA 5L4HA 3TLUA 2XYSA 4UM3A 2WN9A 2XQ6A 3UU4A 4LMKA 3C79A 3RIAA 3U8NA 5AFHA 2X00A 4ZJTA 4DBMA 2Y56A 4X5TA 3PMZA 4UY2A 3RI5A 2BG9E 2PGZA 3SQ6A 2BYPA 3TLWA 5J0ZA 3RHWA 3IGQA 4ZRUA 2BG9C 2YKSA 4TNVA 3U8JA 3WIPA 3U8KA 5BRXA 5LG3A 4AFGA 2WNLA 2WNCA 3WTJA 3GUAA 4Z91A 4AFHA 4A98A 4HFIA 2Y57A 4ZJSA 3TLSA 3T4MA 2PH9A 5JMEA 5SYOA 5KE4A 3EI0A 3TLVA 5AINA 4BFQA 4TWFA 5HEJA 2BYNA 4HQPA 2ZJVA 3UU6A 2XYTA 3EAMA 4ZZCA 3ZDHA 2XNVA 5HCJA 3SQ9A 2UZ6A 5HEHA 2C9TA 2XZ6A 3WTLA 1UV6A 5AFMB 5J5IA 4UM3P 4HFHA 5IUXA 4IL4A 4ILBA 5AFNA 1I9BA 3LSVA 2XQ4A 4NZBA 4QAAA 5LXBA 3RIFA 2QC1B 3SIOA 2Y7YA 5BW2A 2XQ8A 5J5HA 2XQAA 3UU8A 3WTOA 3EHZA 4IREA 4HFEA 2YN6A 4ZK1A 2XNTA 3SH1A 2W8FA 2WZYA 4ZK4A 3JAEA 3TLTA 2BR7A 4F8HA 3JADA 5HCMA 4LMLA 2BG9A 4FRRA 4ILAA 2XQ5A 5HEUA 3UUBA 2BYSA 3UU3A 4B5DA 5TVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8M A;  2XNU A;  2XQ3 A;  3JAF A;  3P4W A;  4TNW A;  3RQU A;  4ZR6 A;  3WTI A;  4HFB A;  4A97 A;  4AFT A;  4XK9 A;  4BQT A;  5KZU A;  2BR8 A;  3ZDG A;  2XQ7 A;  4Z90 A;  5L4E A;  2BYR A;  4COF A;  2WNJ A;  4HFD A;  3WTN A;  4QAC A;  2W8G A;  4ILC A;  2XZ5 A;  4LMJ A;  5AFM A;  3C84 A;  4WV9 A;  2ZJU A;  4TWH A;  2Y54 A;  3U8L A;  3WTH A;  4UM3 S;  4QAB A;  5AFJ A;  5AFK A;  5CFB A;  1UX2 A;  3RQW A;  2XQ9 A;  4ZZB A;  4IL9 A;  4QH5 A;  3ZKR A;  3WTK A;  4QH1 A;  3UQ7 A;  2BYQ A;  2BJ0 A;  4HFC A;  4NPP A;  2X00 D;  1UW6 A;  4D01 A;  4ALX A;  5BP0 A;  3UQ4 A;  4QH4 A;  5AFL A;  5FJV A;  5HEG A;  4EZ1 A;  3UU5 A;  4XHE A;  3PEO A;  5J5G A;  2YMD A;  3P50 A;  5J5F A;  5L47 A;  5CO5 A;  4UM1 A;  2Y58 A;  5HEO A;  4TWD A;  2YOE A;  2BG9 B;  4PIR A;  4UXU A;  2VL0 A;  2YME A;  3WTM A;  5L4H A;  3TLU A;  2XYS A;  4UM3 A;  2WN9 A;  2XQ6 A;  3UU4 A;  4LMK A;  3C79 A;  3RIA A;  3U8N A;  5AFH A;  2X00 A;  4ZJT A;  4DBM A;  2Y56 A;  4X5T A;  3PMZ A;  4UY2 A;  3RI5 A;  2BG9 E;  2PGZ A;  3SQ6 A;  2BYP A;  3TLW A;  5J0Z A;  3RHW A;  3IGQ A;  4ZRU A;  2BG9 C;  2YKS A;  4TNV A;  3U8J A;  3WIP A;  3U8K A;  5BRX A;  5LG3 A;  4AFG A;  2WNL A;  2WNC A;  3WTJ A;  3GUA A;  4Z91 A;  4AFH A;  4A98 A;  4HFI A;  2Y57 A;  4ZJS A;  3TLS A;  3T4M A;  2PH9 A;  5JME A;  5SYO A;  5KE4 A;  3EI0 A;  3TLV A;  5AIN A;  4BFQ A;  4TWF A;  5HEJ A;  2BYN A;  4HQP A;  2ZJV A;  3UU6 A;  2XYT A;  3EAM A;  4ZZC A;  3ZDH A;  2XNV A;  5HCJ A;  3SQ9 A;  2UZ6 A;  5HEH A;  2C9T A;  2XZ6 A;  3WTL A;  1UV6 A;  5AFM B;  5J5I A;  4UM3 P;  4HFH A;  5IUX A;  4IL4 A;  4ILB A;  5AFN A;  1I9B A;  3LSV A;  2XQ4 A;  4NZB A;  4QAA A;  5LXB A;  3RIF A;  2QC1 B;  3SIO A;  2Y7Y A;  5BW2 A;  2XQ8 A;  5J5H A;  2XQA A;  3UU8 A;  3WTO A;  3EHZ A;  4IRE A;  4HFE A;  2YN6 A;  4ZK1 A;  2XNT A;  3SH1 A;  2W8F A;  2WZY A;  4ZK4 A;  3JAE A;  3TLT A;  2BR7 A;  4F8H A;  3JAD A;  5HCM A;  4LML A;  2BG9 A;  4FRR A;  4ILA A;  2XQ5 A;  5HEU A;  3UUB A;  2BYS A;  3UU3 A;  4B5D A;  5TVC A; 
#chains in the Genus database with same CATH topology
 3U8M A;  2XNU A;  2XQ3 A;  3JAF A;  3P4W A;  4TNW A;  3RQU A;  4ZR6 A;  3WTI A;  4HFB A;  4A97 A;  4AFT A;  4XK9 A;  4BQT A;  5KZU A;  2BR8 A;  3ZDG A;  2XQ7 A;  4Z90 A;  5L4E A;  2BYR A;  4COF A;  2WNJ A;  4HFD A;  3WTN A;  4QAC A;  2W8G A;  4ILC A;  2XZ5 A;  4LMJ A;  5AFM A;  3C84 A;  4WV9 A;  2ZJU A;  4TWH A;  2Y54 A;  3U8L A;  3WTH A;  4UM3 S;  4QAB A;  5AFJ A;  5AFK A;  5CFB A;  1UX2 A;  3RQW A;  2XQ9 A;  4ZZB A;  4IL9 A;  4QH5 A;  3ZKR A;  3WTK A;  4QH1 A;  3UQ7 A;  2BYQ A;  2BJ0 A;  4HFC A;  4NPP A;  2X00 D;  1UW6 A;  4D01 A;  4ALX A;  5BP0 A;  3UQ4 A;  4QH4 A;  5AFL A;  5FJV A;  5HEG A;  4EZ1 A;  3UU5 A;  4XHE A;  3PEO A;  5J5G A;  2YMD A;  3P50 A;  5J5F A;  5L47 A;  5CO5 A;  4UM1 A;  2Y58 A;  5HEO A;  4TWD A;  2YOE A;  2BG9 B;  4PIR A;  4UXU A;  2VL0 A;  2YME A;  3WTM A;  5L4H A;  3TLU A;  2XYS A;  4UM3 A;  2WN9 A;  2XQ6 A;  3UU4 A;  4LMK A;  3C79 A;  3RIA A;  3U8N A;  5AFH A;  2X00 A;  4ZJT A;  4DBM A;  2Y56 A;  4X5T A;  3PMZ A;  4UY2 A;  3RI5 A;  2BG9 E;  2PGZ A;  3SQ6 A;  2BYP A;  3TLW A;  5J0Z A;  3RHW A;  3IGQ A;  4ZRU A;  2BG9 C;  2YKS A;  4TNV A;  3U8J A;  3WIP A;  3U8K A;  5BRX A;  5LG3 A;  4AFG A;  2WNL A;  2WNC A;  3WTJ A;  3GUA A;  4Z91 A;  4AFH A;  4A98 A;  4HFI A;  2Y57 A;  4ZJS A;  3TLS A;  3T4M A;  2PH9 A;  5JME A;  5SYO A;  5KE4 A;  3EI0 A;  3TLV A;  5AIN A;  4BFQ A;  4TWF A;  5HEJ A;  2BYN A;  4HQP A;  2ZJV A;  3UU6 A;  2XYT A;  3EAM A;  4ZZC A;  3ZDH A;  2XNV A;  5HCJ A;  3SQ9 A;  2UZ6 A;  5HEH A;  2C9T A;  2XZ6 A;  3WTL A;  1UV6 A;  5AFM B;  5J5I A;  4UM3 P;  4HFH A;  5IUX A;  4IL4 A;  4ILB A;  5AFN A;  1I9B A;  3LSV A;  2XQ4 A;  4NZB A;  4QAA A;  5LXB A;  3RIF A;  2QC1 B;  3SIO A;  2Y7Y A;  5BW2 A;  2XQ8 A;  5J5H A;  2XQA A;  3UU8 A;  3WTO A;  3EHZ A;  4IRE A;  4HFE A;  2YN6 A;  4ZK1 A;  2XNT A;  3SH1 A;  2W8F A;  2WZY A;  4ZK4 A;  3JAE A;  3TLT A;  2BR7 A;  4F8H A;  3JAD A;  5HCM A;  4LML A;  2BG9 A;  4FRR A;  4ILA A;  2XQ5 A;  5HEU A;  3UUB A;  2BYS A;  3UU3 A;  4B5D A;  5TVC A; 
#chains in the Genus database with same CATH homology
 3U8M A;  2XNU A;  2XQ3 A;  3JAF A;  3P4W A;  4TNW A;  3RQU A;  4ZR6 A;  3WTI A;  4HFB A;  4A97 A;  4AFT A;  4XK9 A;  4BQT A;  5KZU A;  2BR8 A;  3ZDG A;  2XQ7 A;  4Z90 A;  5L4E A;  2BYR A;  4COF A;  2WNJ A;  4HFD A;  3WTN A;  4QAC A;  2W8G A;  4ILC A;  2XZ5 A;  4LMJ A;  5AFM A;  3C84 A;  4WV9 A;  2ZJU A;  4TWH A;  2Y54 A;  3U8L A;  3WTH A;  4UM3 S;  4QAB A;  5AFJ A;  5AFK A;  5CFB A;  1UX2 A;  3RQW A;  2XQ9 A;  4ZZB A;  4IL9 A;  4QH5 A;  3ZKR A;  3WTK A;  4QH1 A;  3UQ7 A;  2BYQ A;  2BJ0 A;  4HFC A;  4NPP A;  2X00 D;  1UW6 A;  4D01 A;  4ALX A;  5BP0 A;  3UQ4 A;  4QH4 A;  5AFL A;  5FJV A;  5HEG A;  4EZ1 A;  3UU5 A;  4XHE A;  3PEO A;  5J5G A;  2YMD A;  3P50 A;  5J5F A;  5L47 A;  5CO5 A;  4UM1 A;  2Y58 A;  5HEO A;  4TWD A;  2YOE A;  2BG9 B;  4PIR A;  4UXU A;  2VL0 A;  2YME A;  3WTM A;  5L4H A;  3TLU A;  2XYS A;  4UM3 A;  2WN9 A;  2XQ6 A;  3UU4 A;  4LMK A;  3C79 A;  3RIA A;  3U8N A;  5AFH A;  2X00 A;  4ZJT A;  4DBM A;  2Y56 A;  4X5T A;  3PMZ A;  4UY2 A;  3RI5 A;  2BG9 E;  2PGZ A;  3SQ6 A;  2BYP A;  3TLW A;  5J0Z A;  3RHW A;  3IGQ A;  4ZRU A;  2BG9 C;  2YKS A;  4TNV A;  3U8J A;  3WIP A;  3U8K A;  5BRX A;  5LG3 A;  4AFG A;  2WNL A;  2WNC A;  3WTJ A;  3GUA A;  4Z91 A;  4AFH A;  4A98 A;  4HFI A;  2Y57 A;  4ZJS A;  3TLS A;  3T4M A;  2PH9 A;  5JME A;  5SYO A;  5KE4 A;  3EI0 A;  3TLV A;  5AIN A;  4BFQ A;  4TWF A;  5HEJ A;  2BYN A;  4HQP A;  2ZJV A;  3UU6 A;  2XYT A;  3EAM A;  4ZZC A;  3ZDH A;  2XNV A;  5HCJ A;  3SQ9 A;  2UZ6 A;  5HEH A;  2C9T A;  2XZ6 A;  3WTL A;  1UV6 A;  5AFM B;  5J5I A;  4UM3 P;  4HFH A;  5IUX A;  4IL4 A;  4ILB A;  5AFN A;  1I9B A;  3LSV A;  2XQ4 A;  4NZB A;  4QAA A;  5LXB A;  3RIF A;  2QC1 B;  3SIO A;  2Y7Y A;  5BW2 A;  2XQ8 A;  5J5H A;  2XQA A;  3UU8 A;  3WTO A;  3EHZ A;  4IRE A;  4HFE A;  2YN6 A;  4ZK1 A;  2XNT A;  3SH1 A;  2W8F A;  2WZY A;  4ZK4 A;  3JAE A;  3TLT A;  2BR7 A;  4F8H A;  3JAD A;  5HCM A;  4LML A;  2BG9 A;  4FRR A;  4ILA A;  2XQ5 A;  5HEU A;  3UUB A;  2BYS A;  3UU3 A;  4B5D A;  5TVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...