4WV9A

Crystal structure of acetylcholine binding protein (achbp) from aplysia californica in complex with click chemistry compound (3-exo)-8,8-dimethyl-3-[4-(pyridin-4-yl)-1h-1,2,3-triazol-1-yl]-8-azoniabicyclo[3.2.1]octane
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
206
Chain Sequence
DKLHSQANLMRLKSDLFNYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Choline-binding protein
molecule keywords Soluble acetylcholine receptor
publication title Crystal structure of acetylcholine binding protein (AChBP) from Aplysia Californica in complex with click chemistry compound.
rcsb
source organism Aplysia californica
total genus 48
structure length 206
sequence length 210
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4wv9A00
3IGQA 1UX2A 3WTJA 2YMDA 5BRXA 4ZJSA 5AFMB 4ZZCA 5JMEA 4ZR6A 5SYOA 2Y7YA 2BYPA 2XNVA 3T4MA 3U8MA 4QAAA 4LMKA 2Y54A 2QC1B 4LMJA 4QABA 3U8LA 4AFTA 2XQ7A 3EAMA 4D01A 4QH5A 3SH1A 3U8NA 5CO5A 2XQ3A 4HFBA 5J0ZA 2BR7A 2BYQA 3UQ4A 2BR8A 4HFHA 1UV6A 3RQUA 4BQTA 5J5GA 3EHZA 4B5DA 2Y56A 2BG9E 2XQ5A 3JAFA 4ALXA 2UZ6A 5HCJA 2PGZA 3UU4A 3TLWA 2WNJA 3UU6A 5HEUA 3U8JA 5BP0A 3RQWA 3GUAA 5J5HA 5TVCA 3TLSA 5AFLA 4ILAA 4AFGA 3RHWA 2C9TA 4QH4A 4TWDA 4PIRA 3JAEA 3RIFA 3ZDHA 5AFNA 4UM3S 5IUXA 3PEOA 3TLVA 3WTMA 4LMLA 5CFBA 2XYSA 2WNCA 3RIAA 5J5FA 4ILCA 4TNVA 3ZDGA 2ZJUA 3WTLA 5HCMA 2XYTA 3UU8A 4QACA 4UM1A 3U8KA 4FRRA 4TWFA 5AFJA 2BG9C 3UU3A 4AFHA 5AINA 5HEJA 4QH1A 4A97A 3WIPA 2BYSA 4Z90A 2ZJVA 2XQ9A 2YN6A 4IREA 2Y57A 3C84A 3LSVA 3PMZA 4TNWA 4XK9A 4IL9A 5HEHA 5L4HA 2WZYA 4X5TA 1I9BA 5LG3A 4ZK4A 3UU5A 4HFEA 4WV9A 3WTHA 2BG9A 3TLTA 5KE4A 4IL4A 3P50A 2X00A 5AFKA 5J5IA 3SQ6A 2VL0A 4ILBA 2XNUA 2W8GA 3JADA 4ZZBA 4A98A 4DBMA 4EZ1A 2XQAA 3RI5A 2PH9A 2BYRA 4UM3A 5L4EA 3UQ7A 2XZ6A 5L47A 2XQ6A 2XQ8A 4HFIA 4XHEA 4HFDA 2XQ4A 2YKSA 5HEGA 3EI0A 4Z91A 3ZKRA 3P4WA 2XNTA 4HQPA 3WTKA 5AFMA 3WTNA 5FJVA 4NZBA 2YMEA 1UW6A 5LXBA 2X00D 4UM3P 5KZUA 5AFHA 4NPPA 3TLUA 2BYNA 2BG9B 4ZRUA 3SIOA 2Y58A 2W8FA 4HFCA 4ZJTA 3WTOA 3C79A 4BFQA 5HEOA 3UUBA 4F8HA 2WN9A 3WTIA 4COFA 3SQ9A 2YOEA 4UXUA 2BJ0A 4ZK1A 2WNLA 4UY2A 2XZ5A 5BW2A 4TWHA
chains in the Genus database with same CATH superfamily
3IGQA 1UX2A 3WTJA 2YMDA 5BRXA 4ZJSA 5AFMB 4ZZCA 5JMEA 4ZR6A 5SYOA 2Y7YA 2BYPA 2XNVA 3T4MA 3U8MA 4QAAA 4LMKA 2Y54A 2QC1B 4LMJA 4QABA 3U8LA 4AFTA 2XQ7A 3EAMA 4D01A 4QH5A 3SH1A 3U8NA 5CO5A 2XQ3A 4HFBA 5J0ZA 2BR7A 2BYQA 3UQ4A 2BR8A 4HFHA 1UV6A 3RQUA 4BQTA 5J5GA 3EHZA 4B5DA 2Y56A 2BG9E 2XQ5A 3JAFA 4ALXA 2UZ6A 5HCJA 2PGZA 3UU4A 3TLWA 2WNJA 3UU6A 5HEUA 3U8JA 5BP0A 3RQWA 3GUAA 5J5HA 5TVCA 3TLSA 5AFLA 4ILAA 4AFGA 3RHWA 2C9TA 4QH4A 4TWDA 4PIRA 3JAEA 3RIFA 3ZDHA 5AFNA 4UM3S 5IUXA 3PEOA 3TLVA 3WTMA 4LMLA 5CFBA 2XYSA 2WNCA 3RIAA 5J5FA 4ILCA 4TNVA 3ZDGA 2ZJUA 3WTLA 5HCMA 2XYTA 3UU8A 4QACA 4UM1A 3U8KA 4FRRA 4TWFA 5AFJA 2BG9C 3UU3A 4AFHA 5AINA 5HEJA 4QH1A 4A97A 3WIPA 2BYSA 4Z90A 2ZJVA 2XQ9A 2YN6A 4IREA 2Y57A 3C84A 3LSVA 3PMZA 4TNWA 4XK9A 4IL9A 5HEHA 5L4HA 2WZYA 4X5TA 1I9BA 5LG3A 4ZK4A 3UU5A 4HFEA 4WV9A 3WTHA 2BG9A 3TLTA 5KE4A 4IL4A 3P50A 2X00A 5AFKA 5J5IA 3SQ6A 2VL0A 4ILBA 2XNUA 2W8GA 3JADA 4ZZBA 4A98A 4DBMA 4EZ1A 2XQAA 3RI5A 2PH9A 2BYRA 4UM3A 5L4EA 3UQ7A 2XZ6A 5L47A 2XQ6A 2XQ8A 4HFIA 4XHEA 4HFDA 2XQ4A 2YKSA 5HEGA 3EI0A 4Z91A 3ZKRA 3P4WA 2XNTA 4HQPA 3WTKA 5AFMA 3WTNA 5FJVA 4NZBA 2YMEA 1UW6A 5LXBA 2X00D 4UM3P 5KZUA 5AFHA 4NPPA 3TLUA 2BYNA 2BG9B 4ZRUA 3SIOA 2Y58A 2W8FA 4HFCA 4ZJTA 3WTOA 3C79A 4BFQA 5HEOA 3UUBA 4F8HA 2WN9A 3WTIA 4COFA 3SQ9A 2YOEA 4UXUA 2BJ0A 4ZK1A 2WNLA 4UY2A 2XZ5A 5BW2A 4TWHA
chains in the Genus database with same CATH topology
3IGQA 1UX2A 3WTJA 2YMDA 5BRXA 4ZJSA 5AFMB 4ZZCA 5JMEA 4ZR6A 5SYOA 2Y7YA 2BYPA 2XNVA 3T4MA 3U8MA 4QAAA 4LMKA 2Y54A 2QC1B 4LMJA 4QABA 3U8LA 4AFTA 2XQ7A 3EAMA 4D01A 4QH5A 3SH1A 3U8NA 5CO5A 2XQ3A 4HFBA 5J0ZA 2BR7A 2BYQA 3UQ4A 2BR8A 4HFHA 1UV6A 3RQUA 4BQTA 5J5GA 3EHZA 4B5DA 2Y56A 2BG9E 2XQ5A 3JAFA 4ALXA 2UZ6A 5HCJA 2PGZA 3UU4A 3TLWA 2WNJA 3UU6A 5HEUA 3U8JA 5BP0A 3RQWA 3GUAA 5J5HA 5TVCA 3TLSA 5AFLA 4ILAA 4AFGA 3RHWA 2C9TA 4QH4A 4TWDA 4PIRA 3JAEA 3RIFA 3ZDHA 5AFNA 4UM3S 5IUXA 3PEOA 3TLVA 3WTMA 4LMLA 5CFBA 2XYSA 2WNCA 3RIAA 5J5FA 4ILCA 4TNVA 3ZDGA 2ZJUA 3WTLA 5HCMA 2XYTA 3UU8A 4QACA 4UM1A 3U8KA 4FRRA 4TWFA 5AFJA 2BG9C 3UU3A 4AFHA 5AINA 5HEJA 4QH1A 4A97A 3WIPA 2BYSA 4Z90A 2ZJVA 2XQ9A 2YN6A 4IREA 2Y57A 3C84A 3LSVA 3PMZA 4TNWA 4XK9A 4IL9A 5HEHA 5L4HA 2WZYA 4X5TA 1I9BA 5LG3A 4ZK4A 3UU5A 4HFEA 4WV9A 3WTHA 2BG9A 3TLTA 5KE4A 4IL4A 3P50A 2X00A 5AFKA 5J5IA 3SQ6A 2VL0A 4ILBA 2XNUA 2W8GA 3JADA 4ZZBA 4A98A 4DBMA 4EZ1A 2XQAA 3RI5A 2PH9A 2BYRA 4UM3A 5L4EA 3UQ7A 2XZ6A 5L47A 2XQ6A 2XQ8A 4HFIA 4XHEA 4HFDA 2XQ4A 2YKSA 5HEGA 3EI0A 4Z91A 3ZKRA 3P4WA 2XNTA 4HQPA 3WTKA 5AFMA 3WTNA 5FJVA 4NZBA 2YMEA 1UW6A 5LXBA 2X00D 4UM3P 5KZUA 5AFHA 4NPPA 3TLUA 2BYNA 2BG9B 4ZRUA 3SIOA 2Y58A 2W8FA 4HFCA 4ZJTA 3WTOA 3C79A 4BFQA 5HEOA 3UUBA 4F8HA 2WN9A 3WTIA 4COFA 3SQ9A 2YOEA 4UXUA 2BJ0A 4ZK1A 2WNLA 4UY2A 2XZ5A 5BW2A 4TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGQ A;  1UX2 A;  3WTJ A;  2YMD A;  5BRX A;  4ZJS A;  5AFM B;  4ZZC A;  5JME A;  4ZR6 A;  5SYO A;  2Y7Y A;  2BYP A;  2XNV A;  3T4M A;  3U8M A;  4QAA A;  4LMK A;  2Y54 A;  2QC1 B;  4LMJ A;  4QAB A;  3U8L A;  4AFT A;  2XQ7 A;  3EAM A;  4D01 A;  4QH5 A;  3SH1 A;  3U8N A;  5CO5 A;  2XQ3 A;  4HFB A;  5J0Z A;  2BR7 A;  2BYQ A;  3UQ4 A;  2BR8 A;  4HFH A;  1UV6 A;  3RQU A;  4BQT A;  5J5G A;  3EHZ A;  4B5D A;  2Y56 A;  2BG9 E;  2XQ5 A;  3JAF A;  4ALX A;  2UZ6 A;  5HCJ A;  2PGZ A;  3UU4 A;  3TLW A;  2WNJ A;  3UU6 A;  5HEU A;  3U8J A;  5BP0 A;  3RQW A;  3GUA A;  5J5H A;  5TVC A;  3TLS A;  5AFL A;  4ILA A;  4AFG A;  3RHW A;  2C9T A;  4QH4 A;  4TWD A;  4PIR A;  3JAE A;  3RIF A;  3ZDH A;  5AFN A;  4UM3 S;  5IUX A;  3PEO A;  3TLV A;  3WTM A;  4LML A;  5CFB A;  2XYS A;  2WNC A;  3RIA A;  5J5F A;  4ILC A;  4TNV A;  3ZDG A;  2ZJU A;  3WTL A;  5HCM A;  2XYT A;  3UU8 A;  4QAC A;  4UM1 A;  3U8K A;  4FRR A;  4TWF A;  5AFJ A;  2BG9 C;  3UU3 A;  4AFH A;  5AIN A;  5HEJ A;  4QH1 A;  4A97 A;  3WIP A;  2BYS A;  4Z90 A;  2ZJV A;  2XQ9 A;  2YN6 A;  4IRE A;  2Y57 A;  3C84 A;  3LSV A;  3PMZ A;  4TNW A;  4XK9 A;  4IL9 A;  5HEH A;  5L4H A;  2WZY A;  4X5T A;  1I9B A;  5LG3 A;  4ZK4 A;  3UU5 A;  4HFE A;  4WV9 A;  3WTH A;  2BG9 A;  3TLT A;  5KE4 A;  4IL4 A;  3P50 A;  2X00 A;  5AFK A;  5J5I A;  3SQ6 A;  2VL0 A;  4ILB A;  2XNU A;  2W8G A;  3JAD A;  4ZZB A;  4A98 A;  4DBM A;  4EZ1 A;  2XQA A;  3RI5 A;  2PH9 A;  2BYR A;  4UM3 A;  5L4E A;  3UQ7 A;  2XZ6 A;  5L47 A;  2XQ6 A;  2XQ8 A;  4HFI A;  4XHE A;  4HFD A;  2XQ4 A;  2YKS A;  5HEG A;  3EI0 A;  4Z91 A;  3ZKR A;  3P4W A;  2XNT A;  4HQP A;  3WTK A;  5AFM A;  3WTN A;  5FJV A;  4NZB A;  2YME A;  1UW6 A;  5LXB A;  2X00 D;  4UM3 P;  5KZU A;  5AFH A;  4NPP A;  3TLU A;  2BYN A;  2BG9 B;  4ZRU A;  3SIO A;  2Y58 A;  2W8F A;  4HFC A;  4ZJT A;  3WTO A;  3C79 A;  4BFQ A;  5HEO A;  3UUB A;  4F8H A;  2WN9 A;  3WTI A;  4COF A;  3SQ9 A;  2YOE A;  4UXU A;  2BJ0 A;  4ZK1 A;  2WNL A;  4UY2 A;  2XZ5 A;  5BW2 A;  4TWH A; 
#chains in the Genus database with same CATH topology
 3IGQ A;  1UX2 A;  3WTJ A;  2YMD A;  5BRX A;  4ZJS A;  5AFM B;  4ZZC A;  5JME A;  4ZR6 A;  5SYO A;  2Y7Y A;  2BYP A;  2XNV A;  3T4M A;  3U8M A;  4QAA A;  4LMK A;  2Y54 A;  2QC1 B;  4LMJ A;  4QAB A;  3U8L A;  4AFT A;  2XQ7 A;  3EAM A;  4D01 A;  4QH5 A;  3SH1 A;  3U8N A;  5CO5 A;  2XQ3 A;  4HFB A;  5J0Z A;  2BR7 A;  2BYQ A;  3UQ4 A;  2BR8 A;  4HFH A;  1UV6 A;  3RQU A;  4BQT A;  5J5G A;  3EHZ A;  4B5D A;  2Y56 A;  2BG9 E;  2XQ5 A;  3JAF A;  4ALX A;  2UZ6 A;  5HCJ A;  2PGZ A;  3UU4 A;  3TLW A;  2WNJ A;  3UU6 A;  5HEU A;  3U8J A;  5BP0 A;  3RQW A;  3GUA A;  5J5H A;  5TVC A;  3TLS A;  5AFL A;  4ILA A;  4AFG A;  3RHW A;  2C9T A;  4QH4 A;  4TWD A;  4PIR A;  3JAE A;  3RIF A;  3ZDH A;  5AFN A;  4UM3 S;  5IUX A;  3PEO A;  3TLV A;  3WTM A;  4LML A;  5CFB A;  2XYS A;  2WNC A;  3RIA A;  5J5F A;  4ILC A;  4TNV A;  3ZDG A;  2ZJU A;  3WTL A;  5HCM A;  2XYT A;  3UU8 A;  4QAC A;  4UM1 A;  3U8K A;  4FRR A;  4TWF A;  5AFJ A;  2BG9 C;  3UU3 A;  4AFH A;  5AIN A;  5HEJ A;  4QH1 A;  4A97 A;  3WIP A;  2BYS A;  4Z90 A;  2ZJV A;  2XQ9 A;  2YN6 A;  4IRE A;  2Y57 A;  3C84 A;  3LSV A;  3PMZ A;  4TNW A;  4XK9 A;  4IL9 A;  5HEH A;  5L4H A;  2WZY A;  4X5T A;  1I9B A;  5LG3 A;  4ZK4 A;  3UU5 A;  4HFE A;  4WV9 A;  3WTH A;  2BG9 A;  3TLT A;  5KE4 A;  4IL4 A;  3P50 A;  2X00 A;  5AFK A;  5J5I A;  3SQ6 A;  2VL0 A;  4ILB A;  2XNU A;  2W8G A;  3JAD A;  4ZZB A;  4A98 A;  4DBM A;  4EZ1 A;  2XQA A;  3RI5 A;  2PH9 A;  2BYR A;  4UM3 A;  5L4E A;  3UQ7 A;  2XZ6 A;  5L47 A;  2XQ6 A;  2XQ8 A;  4HFI A;  4XHE A;  4HFD A;  2XQ4 A;  2YKS A;  5HEG A;  3EI0 A;  4Z91 A;  3ZKR A;  3P4W A;  2XNT A;  4HQP A;  3WTK A;  5AFM A;  3WTN A;  5FJV A;  4NZB A;  2YME A;  1UW6 A;  5LXB A;  2X00 D;  4UM3 P;  5KZU A;  5AFH A;  4NPP A;  3TLU A;  2BYN A;  2BG9 B;  4ZRU A;  3SIO A;  2Y58 A;  2W8F A;  4HFC A;  4ZJT A;  3WTO A;  3C79 A;  4BFQ A;  5HEO A;  3UUB A;  4F8H A;  2WN9 A;  3WTI A;  4COF A;  3SQ9 A;  2YOE A;  4UXU A;  2BJ0 A;  4ZK1 A;  2WNL A;  4UY2 A;  2XZ5 A;  5BW2 A;  4TWH A; 
#chains in the Genus database with same CATH homology
 3IGQ A;  1UX2 A;  3WTJ A;  2YMD A;  5BRX A;  4ZJS A;  5AFM B;  4ZZC A;  5JME A;  4ZR6 A;  5SYO A;  2Y7Y A;  2BYP A;  2XNV A;  3T4M A;  3U8M A;  4QAA A;  4LMK A;  2Y54 A;  2QC1 B;  4LMJ A;  4QAB A;  3U8L A;  4AFT A;  2XQ7 A;  3EAM A;  4D01 A;  4QH5 A;  3SH1 A;  3U8N A;  5CO5 A;  2XQ3 A;  4HFB A;  5J0Z A;  2BR7 A;  2BYQ A;  3UQ4 A;  2BR8 A;  4HFH A;  1UV6 A;  3RQU A;  4BQT A;  5J5G A;  3EHZ A;  4B5D A;  2Y56 A;  2BG9 E;  2XQ5 A;  3JAF A;  4ALX A;  2UZ6 A;  5HCJ A;  2PGZ A;  3UU4 A;  3TLW A;  2WNJ A;  3UU6 A;  5HEU A;  3U8J A;  5BP0 A;  3RQW A;  3GUA A;  5J5H A;  5TVC A;  3TLS A;  5AFL A;  4ILA A;  4AFG A;  3RHW A;  2C9T A;  4QH4 A;  4TWD A;  4PIR A;  3JAE A;  3RIF A;  3ZDH A;  5AFN A;  4UM3 S;  5IUX A;  3PEO A;  3TLV A;  3WTM A;  4LML A;  5CFB A;  2XYS A;  2WNC A;  3RIA A;  5J5F A;  4ILC A;  4TNV A;  3ZDG A;  2ZJU A;  3WTL A;  5HCM A;  2XYT A;  3UU8 A;  4QAC A;  4UM1 A;  3U8K A;  4FRR A;  4TWF A;  5AFJ A;  2BG9 C;  3UU3 A;  4AFH A;  5AIN A;  5HEJ A;  4QH1 A;  4A97 A;  3WIP A;  2BYS A;  4Z90 A;  2ZJV A;  2XQ9 A;  2YN6 A;  4IRE A;  2Y57 A;  3C84 A;  3LSV A;  3PMZ A;  4TNW A;  4XK9 A;  4IL9 A;  5HEH A;  5L4H A;  2WZY A;  4X5T A;  1I9B A;  5LG3 A;  4ZK4 A;  3UU5 A;  4HFE A;  4WV9 A;  3WTH A;  2BG9 A;  3TLT A;  5KE4 A;  4IL4 A;  3P50 A;  2X00 A;  5AFK A;  5J5I A;  3SQ6 A;  2VL0 A;  4ILB A;  2XNU A;  2W8G A;  3JAD A;  4ZZB A;  4A98 A;  4DBM A;  4EZ1 A;  2XQA A;  3RI5 A;  2PH9 A;  2BYR A;  4UM3 A;  5L4E A;  3UQ7 A;  2XZ6 A;  5L47 A;  2XQ6 A;  2XQ8 A;  4HFI A;  4XHE A;  4HFD A;  2XQ4 A;  2YKS A;  5HEG A;  3EI0 A;  4Z91 A;  3ZKR A;  3P4W A;  2XNT A;  4HQP A;  3WTK A;  5AFM A;  3WTN A;  5FJV A;  4NZB A;  2YME A;  1UW6 A;  5LXB A;  2X00 D;  4UM3 P;  5KZU A;  5AFH A;  4NPP A;  3TLU A;  2BYN A;  2BG9 B;  4ZRU A;  3SIO A;  2Y58 A;  2W8F A;  4HFC A;  4ZJT A;  3WTO A;  3C79 A;  4BFQ A;  5HEO A;  3UUB A;  4F8H A;  2WN9 A;  3WTI A;  4COF A;  3SQ9 A;  2YOE A;  4UXU A;  2BJ0 A;  4ZK1 A;  2WNL A;  4UY2 A;  2XZ5 A;  5BW2 A;  4TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...