4WV9A

Crystal structure of acetylcholine binding protein (achbp) from aplysia californica in complex with click chemistry compound (3-exo)-8,8-dimethyl-3-[4-(pyridin-4-yl)-1h-1,2,3-triazol-1-yl]-8-azoniabicyclo[3.2.1]octane
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
206
Chain Sequence
b'DKLHSQANLMRLKSDLFNYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Crystal structure of acetylcholine binding protein (AChBP) from Aplysia Californica in complex with click chemistry compound.
rcsb
source organism Aplysia californica
molecule tags Choline-binding protein
total genus 48
structure length 206
sequence length 210
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4wv9A00
3RQWA 3JADA 3WTNA 2XQ7A 5FJVA 5HEJA 2XQ5A 2YOEA 3U8MA 2XQ4A 1UX2A 3WTKA 2BR8A 4LMJA 3T4MA 4AFTA 4LMKA 2X00D 4IREA 4NPPA 1I9BA 2XQ8A 2Y57A 2BR7A 3EI0A 4IL9A 5CO5A 3UU8A 4F8HA 1UV6A 2BYPA 5BP0A 3SQ9A 2BJ0A 3RQUA 2BYRA 4IL4A 4COFA 4UM3S 4QAAA 2Y58A 4QH1A 5AFMA 3TLWA 4WV9A 3UU6A 5BW2A 5J5HA 3P50A 5TVCA 5SYOA 4BFQA 4ILCA 4HFEA 4ILBA 2XQ9A 4QH5A 2VL0A 5J5FA 5AFJA 2XYSA 4BQTA 2WNCA 2W8GA 2X00A 3WTMA 4ZK1A 5AFNA 2ZJVA 5AINA 3RI5A 4D01A 4HFBA 2YN6A 3SQ6A 2XQ3A 5HEOA 5AFLA 3LSVA 4A98A 3P4WA 2XQAA 4NZBA 2XQ6A 2XNVA 3UUBA 5LXBA 3C79A 5L4HA 4B5DA 5HEUA 4HFHA 4FRRA 2BG9E 4QH4A 3ZKRA 5L4EA 4AFHA 5KZUA 3UU4A 4ZJSA 4UXUA 4XK9A 3WTLA 4UM3A 4EZ1A 4ZZCA 4HFDA 2BYNA 2XZ5A 4LMLA 4HQPA 2C9TA 3U8NA 4TNWA 2XZ6A 3TLUA 2XNTA 3U8JA 2BG9A 2PGZA 2BG9B 2XYTA 4ILAA 4X5TA 4Z90A 4ZRUA 4PIRA 5J5GA 3ZDHA 3GUAA 4ALXA 5JMEA 5KE4A 5HEGA 3UU5A 3WTOA 4HFIA 5CFBA 3U8LA 4Z91A 4A97A 4UY2A 3ZDGA 4XHEA 3RHWA 2QC1B 4QABA 3IGQA 4UM1A 4ZZBA 5J0ZA 5L47A 2BYSA 3SH1A 4ZR6A 2XNUA 3RIAA 3TLSA 2YMEA 2Y7YA 3SIOA 2YMDA 3UQ4A 4AFGA 2BG9C 2PH9A 3EHZA 2Y56A 3TLTA 3EAMA 5BRXA 4DBMA 5HCMA 5HEHA 3UU3A 2WNJA 2Y54A 3UQ7A 3PMZA 4HFCA 5J5IA 2WZYA 5LG3A 2YKSA 3WTHA 3C84A 4TWFA 5AFKA 4TNVA 2BYQA 4ZK4A 3WIPA 3RIFA 3TLVA 2UZ6A 2W8FA 4QACA 2ZJUA 4ZJTA 3PEOA 5AFMB 2WNLA 3WTIA 4UM3P 5HCJA 4TWDA 2WN9A 3JAEA 5AFHA 5IUXA 1UW6A 4TWHA 3U8KA 3JAFA 3WTJA
chains in the Genus database with same CATH superfamily
3RQWA 3JADA 3WTNA 2XQ7A 5FJVA 5HEJA 2XQ5A 2YOEA 3U8MA 2XQ4A 1UX2A 3WTKA 2BR8A 4LMJA 3T4MA 4AFTA 4LMKA 2X00D 4IREA 4NPPA 1I9BA 2XQ8A 2Y57A 2BR7A 3EI0A 4IL9A 5CO5A 3UU8A 4F8HA 1UV6A 2BYPA 5BP0A 3SQ9A 2BJ0A 3RQUA 2BYRA 4IL4A 4COFA 4UM3S 4QAAA 2Y58A 4QH1A 5AFMA 3TLWA 4WV9A 3UU6A 5BW2A 5J5HA 3P50A 5TVCA 5SYOA 4BFQA 4ILCA 4HFEA 4ILBA 2XQ9A 4QH5A 2VL0A 5J5FA 5AFJA 2XYSA 4BQTA 2WNCA 2W8GA 2X00A 3WTMA 4ZK1A 5AFNA 2ZJVA 5AINA 3RI5A 4D01A 4HFBA 2YN6A 3SQ6A 2XQ3A 5HEOA 5AFLA 3LSVA 4A98A 3P4WA 2XQAA 4NZBA 2XQ6A 2XNVA 3UUBA 5LXBA 3C79A 5L4HA 4B5DA 5HEUA 4HFHA 4FRRA 2BG9E 4QH4A 3ZKRA 5L4EA 4AFHA 5KZUA 3UU4A 4ZJSA 4UXUA 4XK9A 3WTLA 4UM3A 4EZ1A 4ZZCA 4HFDA 2BYNA 2XZ5A 4LMLA 4HQPA 2C9TA 3U8NA 4TNWA 2XZ6A 3TLUA 2XNTA 3U8JA 2BG9A 2PGZA 2BG9B 2XYTA 4ILAA 4X5TA 4Z90A 4ZRUA 4PIRA 5J5GA 3ZDHA 3GUAA 4ALXA 5JMEA 5KE4A 5HEGA 3UU5A 3WTOA 4HFIA 5CFBA 3U8LA 4Z91A 4A97A 4UY2A 3ZDGA 4XHEA 3RHWA 2QC1B 4QABA 3IGQA 4UM1A 4ZZBA 5J0ZA 5L47A 2BYSA 3SH1A 4ZR6A 2XNUA 3RIAA 3TLSA 2YMEA 2Y7YA 3SIOA 2YMDA 3UQ4A 4AFGA 2BG9C 2PH9A 3EHZA 2Y56A 3TLTA 3EAMA 5BRXA 4DBMA 5HCMA 5HEHA 3UU3A 2WNJA 2Y54A 3UQ7A 3PMZA 4HFCA 5J5IA 2WZYA 5LG3A 2YKSA 3WTHA 3C84A 4TWFA 5AFKA 4TNVA 2BYQA 4ZK4A 3WIPA 3RIFA 3TLVA 2UZ6A 2W8FA 4QACA 2ZJUA 4ZJTA 3PEOA 5AFMB 2WNLA 3WTIA 4UM3P 5HCJA 4TWDA 2WN9A 3JAEA 5AFHA 5IUXA 1UW6A 4TWHA 3U8KA 3JAFA 3WTJA
chains in the Genus database with same CATH topology
3RQWA 3JADA 3WTNA 2XQ7A 5FJVA 5HEJA 2XQ5A 2YOEA 3U8MA 2XQ4A 1UX2A 3WTKA 2BR8A 4LMJA 3T4MA 4AFTA 4LMKA 2X00D 4IREA 4NPPA 1I9BA 2XQ8A 2Y57A 2BR7A 3EI0A 4IL9A 5CO5A 3UU8A 4F8HA 1UV6A 2BYPA 5BP0A 3SQ9A 2BJ0A 3RQUA 2BYRA 4IL4A 4COFA 4UM3S 4QAAA 2Y58A 4QH1A 5AFMA 3TLWA 4WV9A 3UU6A 5BW2A 5J5HA 3P50A 5TVCA 5SYOA 4BFQA 4ILCA 4HFEA 4ILBA 2XQ9A 4QH5A 2VL0A 5J5FA 5AFJA 2XYSA 4BQTA 2WNCA 2W8GA 2X00A 3WTMA 4ZK1A 5AFNA 2ZJVA 5AINA 3RI5A 4D01A 4HFBA 2YN6A 3SQ6A 2XQ3A 5HEOA 5AFLA 3LSVA 4A98A 3P4WA 2XQAA 4NZBA 2XQ6A 2XNVA 3UUBA 5LXBA 3C79A 5L4HA 4B5DA 5HEUA 4HFHA 4FRRA 2BG9E 4QH4A 3ZKRA 5L4EA 4AFHA 5KZUA 3UU4A 4ZJSA 4UXUA 4XK9A 3WTLA 4UM3A 4EZ1A 4ZZCA 4HFDA 2BYNA 2XZ5A 4LMLA 4HQPA 2C9TA 3U8NA 4TNWA 2XZ6A 3TLUA 2XNTA 3U8JA 2BG9A 2PGZA 2BG9B 2XYTA 4ILAA 4X5TA 4Z90A 4ZRUA 4PIRA 5J5GA 3ZDHA 3GUAA 4ALXA 5JMEA 5KE4A 5HEGA 3UU5A 3WTOA 4HFIA 5CFBA 3U8LA 4Z91A 4A97A 4UY2A 3ZDGA 4XHEA 3RHWA 2QC1B 4QABA 3IGQA 4UM1A 4ZZBA 5J0ZA 5L47A 2BYSA 3SH1A 4ZR6A 2XNUA 3RIAA 3TLSA 2YMEA 2Y7YA 3SIOA 2YMDA 3UQ4A 4AFGA 2BG9C 2PH9A 3EHZA 2Y56A 3TLTA 3EAMA 5BRXA 4DBMA 5HCMA 5HEHA 3UU3A 2WNJA 2Y54A 3UQ7A 3PMZA 4HFCA 5J5IA 2WZYA 5LG3A 2YKSA 3WTHA 3C84A 4TWFA 5AFKA 4TNVA 2BYQA 4ZK4A 3WIPA 3RIFA 3TLVA 2UZ6A 2W8FA 4QACA 2ZJUA 4ZJTA 3PEOA 5AFMB 2WNLA 3WTIA 4UM3P 5HCJA 4TWDA 2WN9A 3JAEA 5AFHA 5IUXA 1UW6A 4TWHA 3U8KA 3JAFA 3WTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQW A;  3JAD A;  3WTN A;  2XQ7 A;  5FJV A;  5HEJ A;  2XQ5 A;  2YOE A;  3U8M A;  2XQ4 A;  1UX2 A;  3WTK A;  2BR8 A;  4LMJ A;  3T4M A;  4AFT A;  4LMK A;  2X00 D;  4IRE A;  4NPP A;  1I9B A;  2XQ8 A;  2Y57 A;  2BR7 A;  3EI0 A;  4IL9 A;  5CO5 A;  3UU8 A;  4F8H A;  1UV6 A;  2BYP A;  5BP0 A;  3SQ9 A;  2BJ0 A;  3RQU A;  2BYR A;  4IL4 A;  4COF A;  4UM3 S;  4QAA A;  2Y58 A;  4QH1 A;  5AFM A;  3TLW A;  4WV9 A;  3UU6 A;  5BW2 A;  5J5H A;  3P50 A;  5TVC A;  5SYO A;  4BFQ A;  4ILC A;  4HFE A;  4ILB A;  2XQ9 A;  4QH5 A;  2VL0 A;  5J5F A;  5AFJ A;  2XYS A;  4BQT A;  2WNC A;  2W8G A;  2X00 A;  3WTM A;  4ZK1 A;  5AFN A;  2ZJV A;  5AIN A;  3RI5 A;  4D01 A;  4HFB A;  2YN6 A;  3SQ6 A;  2XQ3 A;  5HEO A;  5AFL A;  3LSV A;  4A98 A;  3P4W A;  2XQA A;  4NZB A;  2XQ6 A;  2XNV A;  3UUB A;  5LXB A;  3C79 A;  5L4H A;  4B5D A;  5HEU A;  4HFH A;  4FRR A;  2BG9 E;  4QH4 A;  3ZKR A;  5L4E A;  4AFH A;  5KZU A;  3UU4 A;  4ZJS A;  4UXU A;  4XK9 A;  3WTL A;  4UM3 A;  4EZ1 A;  4ZZC A;  4HFD A;  2BYN A;  2XZ5 A;  4LML A;  4HQP A;  2C9T A;  3U8N A;  4TNW A;  2XZ6 A;  3TLU A;  2XNT A;  3U8J A;  2BG9 A;  2PGZ A;  2BG9 B;  2XYT A;  4ILA A;  4X5T A;  4Z90 A;  4ZRU A;  4PIR A;  5J5G A;  3ZDH A;  3GUA A;  4ALX A;  5JME A;  5KE4 A;  5HEG A;  3UU5 A;  3WTO A;  4HFI A;  5CFB A;  3U8L A;  4Z91 A;  4A97 A;  4UY2 A;  3ZDG A;  4XHE A;  3RHW A;  2QC1 B;  4QAB A;  3IGQ A;  4UM1 A;  4ZZB A;  5J0Z A;  5L47 A;  2BYS A;  3SH1 A;  4ZR6 A;  2XNU A;  3RIA A;  3TLS A;  2YME A;  2Y7Y A;  3SIO A;  2YMD A;  3UQ4 A;  4AFG A;  2BG9 C;  2PH9 A;  3EHZ A;  2Y56 A;  3TLT A;  3EAM A;  5BRX A;  4DBM A;  5HCM A;  5HEH A;  3UU3 A;  2WNJ A;  2Y54 A;  3UQ7 A;  3PMZ A;  4HFC A;  5J5I A;  2WZY A;  5LG3 A;  2YKS A;  3WTH A;  3C84 A;  4TWF A;  5AFK A;  4TNV A;  2BYQ A;  4ZK4 A;  3WIP A;  3RIF A;  3TLV A;  2UZ6 A;  2W8F A;  4QAC A;  2ZJU A;  4ZJT A;  3PEO A;  5AFM B;  2WNL A;  3WTI A;  4UM3 P;  5HCJ A;  4TWD A;  2WN9 A;  3JAE A;  5AFH A;  5IUX A;  1UW6 A;  4TWH A;  3U8K A;  3JAF A;  3WTJ A; 
#chains in the Genus database with same CATH topology
 3RQW A;  3JAD A;  3WTN A;  2XQ7 A;  5FJV A;  5HEJ A;  2XQ5 A;  2YOE A;  3U8M A;  2XQ4 A;  1UX2 A;  3WTK A;  2BR8 A;  4LMJ A;  3T4M A;  4AFT A;  4LMK A;  2X00 D;  4IRE A;  4NPP A;  1I9B A;  2XQ8 A;  2Y57 A;  2BR7 A;  3EI0 A;  4IL9 A;  5CO5 A;  3UU8 A;  4F8H A;  1UV6 A;  2BYP A;  5BP0 A;  3SQ9 A;  2BJ0 A;  3RQU A;  2BYR A;  4IL4 A;  4COF A;  4UM3 S;  4QAA A;  2Y58 A;  4QH1 A;  5AFM A;  3TLW A;  4WV9 A;  3UU6 A;  5BW2 A;  5J5H A;  3P50 A;  5TVC A;  5SYO A;  4BFQ A;  4ILC A;  4HFE A;  4ILB A;  2XQ9 A;  4QH5 A;  2VL0 A;  5J5F A;  5AFJ A;  2XYS A;  4BQT A;  2WNC A;  2W8G A;  2X00 A;  3WTM A;  4ZK1 A;  5AFN A;  2ZJV A;  5AIN A;  3RI5 A;  4D01 A;  4HFB A;  2YN6 A;  3SQ6 A;  2XQ3 A;  5HEO A;  5AFL A;  3LSV A;  4A98 A;  3P4W A;  2XQA A;  4NZB A;  2XQ6 A;  2XNV A;  3UUB A;  5LXB A;  3C79 A;  5L4H A;  4B5D A;  5HEU A;  4HFH A;  4FRR A;  2BG9 E;  4QH4 A;  3ZKR A;  5L4E A;  4AFH A;  5KZU A;  3UU4 A;  4ZJS A;  4UXU A;  4XK9 A;  3WTL A;  4UM3 A;  4EZ1 A;  4ZZC A;  4HFD A;  2BYN A;  2XZ5 A;  4LML A;  4HQP A;  2C9T A;  3U8N A;  4TNW A;  2XZ6 A;  3TLU A;  2XNT A;  3U8J A;  2BG9 A;  2PGZ A;  2BG9 B;  2XYT A;  4ILA A;  4X5T A;  4Z90 A;  4ZRU A;  4PIR A;  5J5G A;  3ZDH A;  3GUA A;  4ALX A;  5JME A;  5KE4 A;  5HEG A;  3UU5 A;  3WTO A;  4HFI A;  5CFB A;  3U8L A;  4Z91 A;  4A97 A;  4UY2 A;  3ZDG A;  4XHE A;  3RHW A;  2QC1 B;  4QAB A;  3IGQ A;  4UM1 A;  4ZZB A;  5J0Z A;  5L47 A;  2BYS A;  3SH1 A;  4ZR6 A;  2XNU A;  3RIA A;  3TLS A;  2YME A;  2Y7Y A;  3SIO A;  2YMD A;  3UQ4 A;  4AFG A;  2BG9 C;  2PH9 A;  3EHZ A;  2Y56 A;  3TLT A;  3EAM A;  5BRX A;  4DBM A;  5HCM A;  5HEH A;  3UU3 A;  2WNJ A;  2Y54 A;  3UQ7 A;  3PMZ A;  4HFC A;  5J5I A;  2WZY A;  5LG3 A;  2YKS A;  3WTH A;  3C84 A;  4TWF A;  5AFK A;  4TNV A;  2BYQ A;  4ZK4 A;  3WIP A;  3RIF A;  3TLV A;  2UZ6 A;  2W8F A;  4QAC A;  2ZJU A;  4ZJT A;  3PEO A;  5AFM B;  2WNL A;  3WTI A;  4UM3 P;  5HCJ A;  4TWD A;  2WN9 A;  3JAE A;  5AFH A;  5IUX A;  1UW6 A;  4TWH A;  3U8K A;  3JAF A;  3WTJ A; 
#chains in the Genus database with same CATH homology
 3RQW A;  3JAD A;  3WTN A;  2XQ7 A;  5FJV A;  5HEJ A;  2XQ5 A;  2YOE A;  3U8M A;  2XQ4 A;  1UX2 A;  3WTK A;  2BR8 A;  4LMJ A;  3T4M A;  4AFT A;  4LMK A;  2X00 D;  4IRE A;  4NPP A;  1I9B A;  2XQ8 A;  2Y57 A;  2BR7 A;  3EI0 A;  4IL9 A;  5CO5 A;  3UU8 A;  4F8H A;  1UV6 A;  2BYP A;  5BP0 A;  3SQ9 A;  2BJ0 A;  3RQU A;  2BYR A;  4IL4 A;  4COF A;  4UM3 S;  4QAA A;  2Y58 A;  4QH1 A;  5AFM A;  3TLW A;  4WV9 A;  3UU6 A;  5BW2 A;  5J5H A;  3P50 A;  5TVC A;  5SYO A;  4BFQ A;  4ILC A;  4HFE A;  4ILB A;  2XQ9 A;  4QH5 A;  2VL0 A;  5J5F A;  5AFJ A;  2XYS A;  4BQT A;  2WNC A;  2W8G A;  2X00 A;  3WTM A;  4ZK1 A;  5AFN A;  2ZJV A;  5AIN A;  3RI5 A;  4D01 A;  4HFB A;  2YN6 A;  3SQ6 A;  2XQ3 A;  5HEO A;  5AFL A;  3LSV A;  4A98 A;  3P4W A;  2XQA A;  4NZB A;  2XQ6 A;  2XNV A;  3UUB A;  5LXB A;  3C79 A;  5L4H A;  4B5D A;  5HEU A;  4HFH A;  4FRR A;  2BG9 E;  4QH4 A;  3ZKR A;  5L4E A;  4AFH A;  5KZU A;  3UU4 A;  4ZJS A;  4UXU A;  4XK9 A;  3WTL A;  4UM3 A;  4EZ1 A;  4ZZC A;  4HFD A;  2BYN A;  2XZ5 A;  4LML A;  4HQP A;  2C9T A;  3U8N A;  4TNW A;  2XZ6 A;  3TLU A;  2XNT A;  3U8J A;  2BG9 A;  2PGZ A;  2BG9 B;  2XYT A;  4ILA A;  4X5T A;  4Z90 A;  4ZRU A;  4PIR A;  5J5G A;  3ZDH A;  3GUA A;  4ALX A;  5JME A;  5KE4 A;  5HEG A;  3UU5 A;  3WTO A;  4HFI A;  5CFB A;  3U8L A;  4Z91 A;  4A97 A;  4UY2 A;  3ZDG A;  4XHE A;  3RHW A;  2QC1 B;  4QAB A;  3IGQ A;  4UM1 A;  4ZZB A;  5J0Z A;  5L47 A;  2BYS A;  3SH1 A;  4ZR6 A;  2XNU A;  3RIA A;  3TLS A;  2YME A;  2Y7Y A;  3SIO A;  2YMD A;  3UQ4 A;  4AFG A;  2BG9 C;  2PH9 A;  3EHZ A;  2Y56 A;  3TLT A;  3EAM A;  5BRX A;  4DBM A;  5HCM A;  5HEH A;  3UU3 A;  2WNJ A;  2Y54 A;  3UQ7 A;  3PMZ A;  4HFC A;  5J5I A;  2WZY A;  5LG3 A;  2YKS A;  3WTH A;  3C84 A;  4TWF A;  5AFK A;  4TNV A;  2BYQ A;  4ZK4 A;  3WIP A;  3RIF A;  3TLV A;  2UZ6 A;  2W8F A;  4QAC A;  2ZJU A;  4ZJT A;  3PEO A;  5AFM B;  2WNL A;  3WTI A;  4UM3 P;  5HCJ A;  4TWD A;  2WN9 A;  3JAE A;  5AFH A;  5IUX A;  1UW6 A;  4TWH A;  3U8K A;  3JAF A;  3WTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...