5J0ZA

Crystal structure of glic in complex with dha
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Crystal Structure of membrane protein.
rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Membrane protein
total genus 87
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5j0zA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j0zA01
2XZ5A 2Y56A 3LSVA 2LM2A 4IL4A 3SIOA 4HFHA 2Y7YA 3EHZA 3RQWA 4DBMA 5HEHA 4AFTA 3TLTA 2LKGA 2XQAA 1UV6A 2C9TA 2LKHA 4HFDA 3U8KA 3UU8A 5J5FA 4WV9A 5KE4A 2BG9E 2BYRA 2WZYA 2PH9A 3T4MA 3U8JA 3WTMA 5BRXA 5AFMA 3ZKRA 4ZZCA 5BW2A 4TWHA 5L47A 4FRRA 4HFEA 5SYOA 2XNVA 2ZJUA 3U8NA 4QH5A 4ZR6A 4ZJSA 4NZBA 2VL0A 4QAAA 3ZDGA 2XQ4A 4UM3P 4UXUA 1OEDE 4UM3A 4A98A 2BR8A 4LMKA 4B5DA 5LG3A 3IGQA 4A97A 3PMZA 2BG9A 2Y57A 4ILCA 5HEGA 4UM3S 2W8FA 4ZJTA 3SH1A 2LLYA 3TLSA 3UU3A 3WTLA 2Y54A 5IUXA 5KZUA 2BG9B 2BYQA 5BP0A 3EI0A 5HCMA 3WTNA 3RI5A 2ZJVA 3WTKA 2WNJA 3UU4A 4IREA 4HQPA 5HEOA 3SQ9A 2XZ6A 1OEDA 4TWDA 4XHEA 5AFHA 2XQ8A 4UM1A 4ZZBA 3WIPA 3TLUA 3C84A 2MAWA 5AFKA 2XQ5A 3RIAA 4BFQA 1OEDB 3TLWA 1UW6A 5J5GA 2BYSA 4TNVA 4X5TA 3UUBA 4LMJA 2YN6A 2M6IA 3WTOA 4QH1A 2X00A 5AFNA 2UZ6A 5AFJA 4ZRUA 4HFBA 3ZDHA 5AFLA 4BQTA 5J5HA 5L4HA 5HEJA 3JAEA 4IL9A 5HCJA 2YKSA 3RHWA 2BYNA 4QACA 4ZK4A 5JMEA 3RIFA 2W8GA 2XQ6A 4AFGA 4HFCA 2M6BA 5J5IA 3SQ6A 3RQUA 2BYPA 4NPPA 4COFA 3WTIA 4AFHA 5HEUA 2X00D 2BJ0A 4D01A 2Y58A 4Z90A 2WNCA 2XYSA 3PEOA 3TLVA 2WNLA 3WTHA 2KSRA 3UQ7A 4TNWA 2BG9C 2QC1B 4QABA 5CO5A 3U8LA 4ZK1A 5LXBA 4F8HA 2XYTA 3P50A 2XNUA 5FJVA 4ILBA 3UQ4A 4LMLA 5TVCA 1UX2A 4HFIA 3UU6A 3U8MA 5L4EA 4UY2A 4QH4A 3UU5A 3GUAA 4ILAA 1I9BA 2PGZA 2YMEA 5J0ZA 4PIRA 2BR7A 4Z91A 4ALXA 2XQ7A 2YMDA 5AINA 4XK9A 5AFMB 2XNTA 4TWFA 3WTJA 3C79A 1OEDC 3EAMA 3P4WA 4EZ1A 5CFBA 2XQ3A 2YOEA 2XQ9A 3JADA 3JAFA 2WN9A
chains in the Genus database with same CATH superfamily
4GYRA 4QWNB 5FXWA 2BKNA 4HWIB 3RQWA 3WAKA 2XAQB 4ISTA 4HFDA 5KE4A 2DHRA 4U2ZA 2NWBA 4IHJE 5LGNB 5SYOA 4L9IA 4WZXA 3EVYA 2EHOB 1X9BA 3T1YT 1HF8A 1X79A 2LLYA 3TLSA 4F6RC 1YD8G 3EI0A 1DU2A 5ABEA 1OEDA 2ACXA 5AFHA 4BFQA 4QX8B 2DWKA 4QH1A 4E7SA 5J5HA 3ZSTA 1YKEB 4NUUA 4LFAT 2A72A 3LFMA 3B13A 3L3PA 4JI2T 3QK6A 4ZI3C 5FP3A 2WM9A 4DR5T 4AISA 2XZEA 4UVAB 4YSXA 5LXBA 3U3IA 4X64T 4CN6A 2YDSA 2CHOA 4GKKT 2PGZA 3RRWA 4UF0A 3AAIA 5LJNA 5FXZA 3HA4A 2PBIA 3AEDA 3VKGA 5LG4A 1UV6A 4H9RC 5J5FA 2WBLA 3PUZF 3QB5A 4U31A 5L3GB 3ZMSB 4QH5A 1N32T 4ZR6A 3ZDGA 2BR8A 3FB2A 4N78D 4PK4A 4YHJA 3CX8B 1NEKA 3K1SA 3SS1A 4TWDA 2KMFA 1ZV4X 3TLUA 4EYUA 2KXPB 4G63A 4TX5A 4YFSA 3N9PA 1XDOA 3PUVF 4NUVA 2VVNA 4C91A 2YINA 2LE8A 3N2KE 3RF1A 4BJMA 2BVLA 3ZT7A 4OK0A 2WB5A 5JR9B 1WYBA 2M6BA 2D0TA 2XAFB 2UXCT 2KZ7B 5LHIB 1MIYA 1Y64B 3RYHE 5CO5A 3CX6B 3N9QA 2XYTA 3UQ4A 4G2AA 5LXTE 4DV0T 4ZS2A 2HPLA 1KK7A 2NW9A 2R6GF 3RIUA 4IIJE 4JEUB 2LM9A 2WN9A 3LJCA 3ONXA 2Y48B 4BJNA 1N33T 3TLTA 2V7MA 4EV6A 4QXHB 4GOUA 4ZOLE 3UT5E 3VHLA 4IE7A 1M62A 5AQSB 3AE2A 1UURA 3MKDA 5LG3A 2BG9A 2Y57A 5FKYA 3ONJA 3RYIE 5JDMA 2XHEB 1D1CA 2LJLA 3I1AA 4HQPA 3K3OA 2BS2A 3KBTA 3C4XA 4PK6A 2K24A 4B6XA 4KMCA 3UULA 4IDOA 5J5GA 2V7LA 4JEHB 1V9DA 1XWMA 2MOZA 3UTKA 4O2AE 4CXYA 3C98B 4ZK4A 2W8GA 1HCIA 2CLYC 1W9RA 3SQ6A 4JBWF 4COFA 2IDOB 3FZLB 5AQNB 2LT3A 2UXNB 1SHZC 1W0BA 2E5VA 3UQ7A 2QC1B 4X1IE 5LMUT 3AAEB 3P50A 1E1HB 4HN9A 4JI8T 2KLQA 4P1NA 2BKPA 5A1LA 5LHHB 4KX6A 2I6HA 3D0TA 3R84B 4DV2T 5FVLA 4CXXA 1WCRA 3FBZA 4CI1B 4ISSA 3ZT5A 3BQKA 4YXDA 2QGSA 3K3QC 5AFMA 5CB4E 3CPZA 3PU8A 3PUYF 2VKOA 4UV8B 1SE7A 4JI7T 2LRLA 2ZJUA 2PG8A 4GIWA 5AQGB 1BR0A 3VRBA 2CLYB 3PMZA 1IBLT 3ZCJA 3AEBA 4DR2T 2L9QA 3EDVA 2Y54A 5BP0A 1UX5A 4ZXLA 2WNJA 2D9DA 3ZSSA 3WIPA 5AFKA 3PJAJ 2IC6A 1HX8A 4L0RA 1UW6A 3P4QA 3KV9A 1WRDA 4CXWA 2A3DA 3ANWA 2XPKA 4UVBB 5JMEA 4WYVA 4HFCA 3ZYKA 1SA0E 1KNRA 5J5IA 4LFCT 2DCFA 4E7ZA 5ADXL 2J62A 4HWHA 2C0SA 1UX4A 4UF0B 5E0OA 3O1HA 2VQFT 3HL6A 4F8HA 2V6XA 2Y8DA 2CBJA 3ZMVB 3A8YC 4UY2A 3VU7H 4IGUA 3N5LA 4O4JE 4EXTA 2YMDA 1N36T 2FJDA 4EB6E 3PU3A 5AQIB 1EZ3A 3UFEA 2BDEA 3I0QA 3AE8A 2D5UA 4DO0A 1H7CA 2RP4A 4B5DA 1BR1A 3AAAB 3LK2B 2VB6A 3N9OA 5DQWA 2LOPA 4HTEA 2CRBA 1ZKEA 1D1AA 2B76A 2W61A 4U7IA 2CCQA 4JUYA 2XY8B 5EK4A 1VCTA 1FEWA 2V7JA 5HEOA 2V1DB 3WAJA 5LHGB 3AE3A 3OPCA 4MALA 4I50E 2LSKA 2L3LA 4ERRA 3HR0A 5JRCB 2VVSA 2FJEA 2VKHA 2X00A 3V5UA 4EZHA 4PW8A 5FVKA 4PAGA 1LVFA 3P4SA 5HAXA 5L3FB 5AQVB 4JI1T 4U7YA 2CXDA 2LHRA 4LF7T 2H88A 5HEUA 2X00D 4D01A 5BR8T 2BBJA 2XYSA 3WTHA 2WNLA 2SPCA 3CKDA 4XBFB 4ASKA 4HGAA 4YT0A 2DI4A 5JREA 5IWAT 4DR1T 4OHFA 4ILAA 2X51A 1OWAA 3FXEB 2Q9QC 4XK9A 3QOFA 3RKOA 2JMKA 4DBRA 2WDQA 3JAFA 3FZKB 2H3RA 2HPJA 3AXJB 3A5XA 1Z0PA 4TUYE 4ZI2D 4JI4T 3ZKRA 4B3RT 2CEAA 2Y6XA 2VKJA 3EDUA 4MFRA 5HWXA 1YQ4A 4DV5T 4ZJSA 4UIGA 1XMOT 3E0ZA 3ZCIA 3IGQA 1VCSA 3RYCE 1JNZA 2DWGA 3P8CD 3J9X1 3QUJA 5LA6E 2WSSV 2PJQA 5ETWA 3VR9A 2N1GA 2CWOA 3FZFB 3DTOA 3UU4A 3OBVE 5LBMA 4DMVA 3RC8A 2Q9QB 3RIAA 4P0BA 1HR0T 5HXSA 2YU2A 2XTLA 2KWHA 2CWYA 2VWAA 3RIFA 5HXEA 5DJQC 2ZMAA 1XNQT 2H89A 2ODUA 3WTIA 5AQHB 2Y58A 4MHCA 1IJ5A 3U8LA 5LMNT 1KEYA 1UX2A 2ES0A 3PV0F 5AFMB 1D0XA 4YY3T 4QKNA 3L09A 5HXRA 3AEEA 4DIDB 2E9XA 2W00A 5J2UE 5BRXA 1Z8UA 4DR7T 3T1HT 3QB5K 4DR4T 1ZOYA 4UXNB 1I94T 2E9XD 4BA9A 1XMQT 5AQKB 4EIWA 4ZS3A 4HWFA 5JR9C 3KV6A 3O1IA 5AQRB 3WTLA 2DLRA 3NKZA 4JI6T 2WAUA 5LNKA 2X68A 3RI5A 2ZJVA 2JIWA 4IREA 3ANWB 2YEVC 1E2AA 2IUBA 4ZZBA 5J1GA 2MAWA 5FMNA 1MIWA 4AI6A 3LDQB 4TNVA 4IDNA 4PJJA 1M7KA 4EOZB 5KMGP 3O1JA 4XAXB 5CJ5A 4IL9A 3AECA 4U3CA 4X62T 3S4UA 4NXMT 2YU1A 3PE0A 2BYPA 4WBNE 4AFHA 1R8IA 3I0OA 3A7MA 2B1EA 5LYJE 3KBUA 2WWVA 1G8XA 2OA5A 4HFIA 4PFPA 1FMVA 4CN4A 3WTJA 3KV5A 4EZ1A 3GN5A 2GK9A 1T98A 4H9OC 2WZYA 1D0ZA 2YK0A 2CHNA 3AA6B 1HNXT 2XNVA 5CA1E 2I59A 2WZHA 2NW8A 4XZCA 2NP9A 2W4XA 3ZPOA 2UXXB 3U78A 4BAYB 3Q9DA 4UM3S 3CIRA 4GYSA 2VASA 3BQLA 4PJLA 3Q5WA 3HKBE 5KZUA 5IUXA 2AE9A 1ZHCA 4KUMB 3JC6D 5HCMA 3WTNA 1NAFA 1HG2A 5ABFA 2XQYA 4AQFA 3SQ9A 5FXXA 1G73A 2BVMA 2JQQA 2AXDS 1KFYA 3OTOT 3MACA 3UUBA 4IDZA 5AFNA 3AEGA 4ZRUA 4HFBA 4IE4A 4O4HE 5HXHA 3RHWA 2BYNA 4EYYR 2XQ6A 5LGUB 3ONLC 2FJAA 4JLEA 2WNCA 4ZEYA 3TLVA 2H7OA 3L39A 4MLKA 5JDHA 2WMOA 5AQOB 5AQPB 5TVCA 3UU6A 3U8MA 4DBQA 3MJXA 4QH4A 5AQFB 3Q5DA 2W2UA 4Z91A 4X1KE 3R6NA 3UFGA 4I0UA 1OEDC 4OYKA 3RKGA 2X9XA 3EAMA 3FBLA 5TAOA 5CFBA 2WWUA 1WLXA 4UM3P 4X66T 4H63H 2JQKA 3SIOA 3AE9A 1UGOA 4HFHA 3NRYA 2X67A 2J4GA 2UU9T 4KBMB 3IBPA 2J47A 2EHOA 3RX6A 3N2OA 2V8SV 5JDFA 5JDGA 2N2NA 3UUXB 4TZ4C 3ZYLA 5FXVA 1OEDE 5DQVA 4UM3A 3QNUA 4LMKA 4TV9E 2EHOD 3LK42 4IE5A 4KP3C 5L3EB 2FJBA 4JV5T 4DV4T 5EK2A 3RLFF 2H7VC 5DABA 4YTMA 3FZHB 4UM1A 1MNDA 2C5KT 2XQ5A 3ZLIA 1OEDB 2BYSA 2ZM6T 5FY7A 3Q5XA 2VKDA 4LMJA 2M6IA 1KNPA 1QLBA 3CMLA 1NENA 5AFJA 1HS7A 2N9DA 1IBKT 3KDSE 1I6ZA 1FJGT 5HXCA 5C2TA 1IAPA 4NPPA 4AKLA 2HH7A 4HWCA 3B5MA 4O8SA 4Z90A 1ZEEA 2WS3A 3PUSA 3ETUA 4V1Av 2XAGB 1B7TA 2M67A 4A56A 4CN1A 3AVSA 2JRKA 2KT9A 4ANJA 2YMEA 2E9XB 1MMDA 1E7PA 4TWFA 2NTXA 2XQ3A 2YOEA 3O9XA 1L0VA 2Y7YA 3EHZA 3JCFA 3UU8A 4QXCB 3WTMA 4KHPT 3KVBA 2WU2A 1WR0A 2XUEA 4FRRA 4H9NC 2ZM2A 4YHHT 3B57A 1WYCA 4A97A 3ZC0A 2W8FA 5FY1A 2WQYA 3P4RA 4ZI3D 2LSIA 2QYWA 4DUYT 4X1YE 3RIUC 3PURA 5JDQA 3LK3B 2CM0A 2IMLA 3L8RA 3UUMA 2X0HA 3WTOA 4QX7B 1Y01A 2WY2A 2ZM0A 3CWZB 2BBHA 2UZ6A 2OV9A 4K0KT 5L4HA 4UEMA 3ABVA 1S35A 4I43B 5JDNA 4AQFC 4Z8XA 3I9YA 2K5BB 2JJ9A 3V5SA 2HHHT 2C5IT 4TNWA 2BG9C 2F4VT 3VRAA 2ACZA 3PUWF 3NBXX 5FL0A 2LOSA 3AVRA 1NWMX 5LB7B 2HN1A 1IJ6A 2BR7A 5HWYA 5BMVE 2LEHA 3PTRB 4ALXA 2LRKA 4P09A 3IHRA 2JQ9A 5FL1A 2XZ5A 5JH7E 2HN2A 2LHNA 4CQIA 2LM2A 2VL8A 2XAJB 4IDPA 4O4LE 3HI2A 2A2FX 3OVUA 2XQAA 4WV9A 2BG9E 4IT4A 3U8JA 2CBIA 4GKJT 3F31A 2V5DA 2UUBT 2E8IA 3NWIA 2CXFA 4K0UA 5FNVE 5H6QB 5ABFB 5M4YA 3AA7B 1UUSA 4LF4T 2C5JA 5HEGA 1OXZA 1YW0A 1MIVA 3UU3A 1HG5A 2BG9B 3ZMTB 4O4IE 1MMAA 1J5WA 3SWHA 3DJBA 1IZNB 3F57A 3H3MA 4UV9B 2L8KA 2YN6A 4OX9T 1CHUA 4IE0A 4AFGA 2WDVA 3E08A 2VURA 3I9WA 2X0LB 3G06A 5FY0A 4AKIA 2KSRA 4QABA 4H9QC 4CI3B 4C90A 2X0YA 4YLHA 1YQ3A 5LGTB 4PIRA 4KI0F 3HKEE 4X20E 2IC9A 2XSAA 4H9PC 1UCUA 2MTQA 5KX5E 3FXDB 3FHNA 2CE7A 3LSVA 5HEHA 2LKGA 3U8KA 2BYRA 2XASB 5CGMA 3PJAA 4EEBA 4NXNT 2D0UA 3BQIA 3K8PC 1HNZT 3C50A 2XQ4A 4YSYA 1KNZA 4EGWA 3VR8A 1XDPA 4U33A 4O2BE 4ILCA 2V7IA 4NIQA 3PUAA 3CQCB 3WTKA 3AE4A 5AFUL 4XHEA 1LKXA 3C84A 3AE1A 3WI3A 4HFVA 2CA5A 5FYMA 4X5TA 2IAKA 3HKDE 2NTYA 3ZDHA 5AQUB 5AFLA 4BQTA 2FUPA 4H9SE 3RGLA 2W66A 3AA0B 3IF8B 2OLTA 2WU5A 1O3XA 3Q5EA 2XM2A 4CI2B 2BJ0A 4LF6T 4OFZA 2E2AA 4LMLA 3SFDA 2X66A 3UU5A 2QVAA 2VQET 5AQQB 4PFOA 4M1PA 5JQGE 3HKCE 2UUAT 1MMNA 3O4XE 2QA7A 2DL1A 4UR9A 1IBMT 2KWIB 3C4WA 1SUMB 4DBMA 2LKHA 2BS3A 4UELA 3NZPA 1VRBA 2XJ7A 2I0MA 4AQYT 1UK5A 3LBXA 4HFEA 5GONE 3KINB 2JMHA 2VL0A 4QAAA 2J1DG 5LOVE 1D0YA 5JTGA 3CK6A 3MXZA 2WP9A 2BS4A 2V6YA 1HNWT 3SH1A 3H37A 2BYQA 3AE6A 3ZJ2A 4ZI2C 4DNDA 2X9HA 3AE5A 1HFAA 1D1BA 5LCYA 2LSGA 3M3ZB 4DR3T 5JRCA 4WBOA 1XZYA 4DVDA 3N2GE 3ZYMA 4WW0A 3ZC1A 4I55E 3JAEA 5HCJA 4I4TE 1YKHB 3RQUA 1T7SA 3KVAA 3OYZA 3RYFE 3KFWX 3IEEA 3FZMB 3DP7A 3PEOA 3SFEA 3RRCA 5LP6E 4LF9T 4ILBA 3GA8A 5L4EA 1WFDA 1J1JA 4JYAT 3OYXA 2ZM8A 4U74A 3C79A 3AXJA 4HKAA 2WMNA 5LJMA 3ZMUB 3VKHA 5F5WA 1ZP0A 4GK5E 4A5XA 1N34T 3UUNA 5IYZE 3SOLA 4AQGA 2PTFA 2PH9A 3T4MA 2IHR1 4ZZCA 3PDYA 4TWHA 4HEAA 4AKGA 3N9NA 3PUGA 3U8NA 4NZBA 2XSBA 4PK5A 3CQXC 1W0AA 2XM1A 1S94A 3NRXA 4ZJTA 1WR6A 3LG7A 4MBQA 3ZMZB 2Q9QA 3ZEFB 1BR2A 4YJ2E 2W63A 2WDRA 2XQ8A 4EEDA 3MZKB 3AEFA 3OJAA 2P9BA 2Q9QD 2V26A 5L3BB 1FMWA 3N9LA 2E9XC 3C4ZA 3H3AA 1BR4A 5HEJA 5JDLA 2ZLYA 1US7B 4YTPA 5L3CB 1J5ET 3AA1B 4B3MT 4J2CA 2MPKA 4YSZA 1XNRT 2XNUA 4DV6T 4P0AA 4HE8A 1AJ3A 5F8PA 3ZN1B 3NZQA 4TV8E 5KDMC 4ZHQE 2XQ7A 4LF8T 5AINA 4X65T 3MK7C 3OKQA 4OYJA 3RPUA 1W09A 2XQ9A 3TKLB 2IIUA 3EABA 4GK0E 2Y56A 3M65A 2W67A 2DNXA 4YTNA 4ZI7E 4AFTA 2C9TA 1MNEA 3GMIA 4FJOA 3QC9A 2W62A 1U4QA 4B3TT 5BW2A 5C8YE 1JNRA 3KV4A 3F2EA 5L47A 5H6RB 1KF6A 3CQGB 5LBQB 3Q2MA 1FIOA 3RH3A 4HWDA 2KNDA 2CMRA 4DUZT 4A98A 4LFBT 4QHOA 4H63V 2YDRA 4EAHA 2FBWA 3ETVA 1MMGA 1HTJF 4U72A 2W0GA 3BK9A 2WZIA 1U5PA 5EZYE 5ABGA 5IHYA 4TN7B 2LSJA 3RC3A 2JPFA 5AQMB 4L5GA 4DV7T 5L3DB 5JVDE 3TLWA 2JQHA 2G0UA 2VK9A 3PUXF 5EK3A 2NOXA 4UVCB 4DV1T 3PUQA 4QXBB 1T72A 2X9WA 5AQJB 3W15B 3CVRA 3JC6C 4PJMA 3P7IA 3E22E 2NR4A 2K3WA 2CPTA 2MBGA 5CA0E 2D2SA 5JR9A 3GUAA 3MA9A 5J0ZA 2WCAA 3ZT6A 1LVKA 4IE6A 2XNTA 4EZ4A 2BKOA 2KINB 2Z6EA 4DR6T 5KXJA 4AXPA 3ZJ1A 3LBXB 3X1DA 3GWHA 2V5CA 3AB3B 4IL4A 1YXRA 4Q25A 3GN5B 4U2YA 5AQLB 2QRXA 4FI5A 4AKHA 2ODVA 2V6YB 3J7Yq 2UXDT 4YJ3E 3C51A 4DMWA 4UXUA 1VOMA 4JI0T 1T8BA 2PFVA 1GQEA 2X9YA 3IA3A 3EUHA 2XAHB 5AQTB 2CXLA 4IDQA 4DV3T 2IW5B 4B3ST 5J2TE 1LRZA 3P4PA 2MYSA 3AE7A 2V7KA 4ILUA 5L2LA 2LSYA 4CZZB 1QSDA 2UXBT 4KHZF 4AKRB 2XZ6A 4PJNA 4PNIA 3NVOA 5C3JA 5HYAA 2RPAA 2NW7A 2YDQA 4ADZA 2EHOC 2A9UA 3AEAA 3K3NA 2YKSA 5F3JA 4QACA 4JI5T 4WNKA 5ABHA 2K9AA 3SRZA 3CX7B 3N9MA 2E5LT 4ZK1A 2K48A 5FJVA 3T8OA 4JI3T 4AIUA 3ZN0B 2RA1A 1QUUA 1I9BA 1CUNA 3C64A 1HX1B 2UUCT 2BZBA 3P4WA 3ESLA 3JADA 4LF5T
chains in the Genus database with same CATH topology
2XZ5A 2Y56A 3LSVA 2LM2A 4IL4A 3SIOA 4HFHA 2Y7YA 3EHZA 3RQWA 4DBMA 5HEHA 4AFTA 3TLTA 2LKGA 2XQAA 1UV6A 2C9TA 2LKHA 4HFDA 3U8KA 3UU8A 5J5FA 4WV9A 5KE4A 2BG9E 2BYRA 2WZYA 2PH9A 3T4MA 3U8JA 3WTMA 5BRXA 5AFMA 3ZKRA 4ZZCA 5BW2A 4TWHA 5L47A 4FRRA 4HFEA 5SYOA 2XNVA 2ZJUA 3U8NA 4QH5A 4ZR6A 4ZJSA 4NZBA 2VL0A 4QAAA 3ZDGA 2XQ4A 4UM3P 4UXUA 1OEDE 4UM3A 4A98A 2BR8A 4LMKA 4B5DA 5LG3A 3IGQA 4A97A 3PMZA 2BG9A 2Y57A 4ILCA 5HEGA 4UM3S 2W8FA 4ZJTA 3SH1A 2LLYA 3TLSA 3UU3A 3WTLA 2Y54A 5IUXA 5KZUA 2BG9B 2BYQA 5BP0A 3EI0A 5HCMA 3WTNA 3RI5A 2ZJVA 3WTKA 2WNJA 3UU4A 4IREA 4HQPA 5HEOA 3SQ9A 2XZ6A 1OEDA 4TWDA 4XHEA 5AFHA 2XQ8A 4UM1A 4ZZBA 3WIPA 3TLUA 3C84A 2MAWA 5AFKA 2XQ5A 3RIAA 4BFQA 1OEDB 3TLWA 1UW6A 5J5GA 2BYSA 4TNVA 4X5TA 3UUBA 4LMJA 2YN6A 2M6IA 3WTOA 4QH1A 2X00A 5AFNA 2UZ6A 5AFJA 4ZRUA 4HFBA 3ZDHA 5AFLA 4BQTA 5J5HA 5L4HA 5HEJA 3JAEA 4IL9A 5HCJA 2YKSA 3RHWA 2BYNA 4QACA 4ZK4A 5JMEA 3RIFA 2W8GA 2XQ6A 4AFGA 4HFCA 2M6BA 5J5IA 3SQ6A 3RQUA 2BYPA 4NPPA 4COFA 3WTIA 4AFHA 5HEUA 2X00D 2BJ0A 4D01A 2Y58A 4Z90A 2WNCA 2XYSA 3PEOA 3TLVA 2WNLA 3WTHA 2KSRA 3UQ7A 4TNWA 2BG9C 2QC1B 4QABA 5CO5A 3U8LA 4ZK1A 5LXBA 4F8HA 2XYTA 3P50A 2XNUA 5FJVA 4ILBA 3UQ4A 4LMLA 5TVCA 1UX2A 4HFIA 3UU6A 3U8MA 5L4EA 4UY2A 4QH4A 3UU5A 3GUAA 4ILAA 1I9BA 2PGZA 2YMEA 5J0ZA 4PIRA 2BR7A 4Z91A 4ALXA 2XQ7A 2YMDA 5AINA 4XK9A 5AFMB 2XNTA 4TWFA 3WTJA 3C79A 1OEDC 3EAMA 3P4WA 4EZ1A 5CFBA 2XQ3A 2YOEA 2XQ9A 3JADA 3JAFA 2WN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZ5 A;  2Y56 A;  3LSV A;  2LM2 A;  4IL4 A;  3SIO A;  4HFH A;  2Y7Y A;  3EHZ A;  3RQW A;  4DBM A;  5HEH A;  4AFT A;  3TLT A;  2LKG A;  2XQA A;  1UV6 A;  2C9T A;  2LKH A;  4HFD A;  3U8K A;  3UU8 A;  5J5F A;  4WV9 A;  5KE4 A;  2BG9 E;  2BYR A;  2WZY A;  2PH9 A;  3T4M A;  3U8J A;  3WTM A;  5BRX A;  5AFM A;  3ZKR A;  4ZZC A;  5BW2 A;  4TWH A;  5L47 A;  4FRR A;  4HFE A;  5SYO A;  2XNV A;  2ZJU A;  3U8N A;  4QH5 A;  4ZR6 A;  4ZJS A;  4NZB A;  2VL0 A;  4QAA A;  3ZDG A;  2XQ4 A;  4UM3 P;  4UXU A;  1OED E;  4UM3 A;  4A98 A;  2BR8 A;  4LMK A;  4B5D A;  5LG3 A;  3IGQ A;  4A97 A;  3PMZ A;  2BG9 A;  2Y57 A;  4ILC A;  5HEG A;  4UM3 S;  2W8F A;  4ZJT A;  3SH1 A;  2LLY A;  3TLS A;  3UU3 A;  3WTL A;  2Y54 A;  5IUX A;  5KZU A;  2BG9 B;  2BYQ A;  5BP0 A;  3EI0 A;  5HCM A;  3WTN A;  3RI5 A;  2ZJV A;  3WTK A;  2WNJ A;  3UU4 A;  4IRE A;  4HQP A;  5HEO A;  3SQ9 A;  2XZ6 A;  1OED A;  4TWD A;  4XHE A;  5AFH A;  2XQ8 A;  4UM1 A;  4ZZB A;  3WIP A;  3TLU A;  3C84 A;  2MAW A;  5AFK A;  2XQ5 A;  3RIA A;  4BFQ A;  1OED B;  3TLW A;  1UW6 A;  5J5G A;  2BYS A;  4TNV A;  4X5T A;  3UUB A;  4LMJ A;  2YN6 A;  2M6I A;  3WTO A;  4QH1 A;  2X00 A;  5AFN A;  2UZ6 A;  5AFJ A;  4ZRU A;  4HFB A;  3ZDH A;  5AFL A;  4BQT A;  5J5H A;  5L4H A;  5HEJ A;  3JAE A;  4IL9 A;  5HCJ A;  2YKS A;  3RHW A;  2BYN A;  4QAC A;  4ZK4 A;  5JME A;  3RIF A;  2W8G A;  2XQ6 A;  4AFG A;  4HFC A;  2M6B A;  5J5I A;  3SQ6 A;  3RQU A;  2BYP A;  4NPP A;  4COF A;  3WTI A;  4AFH A;  5HEU A;  2X00 D;  2BJ0 A;  4D01 A;  2Y58 A;  4Z90 A;  2WNC A;  2XYS A;  3PEO A;  3TLV A;  2WNL A;  3WTH A;  2KSR A;  3UQ7 A;  4TNW A;  2BG9 C;  2QC1 B;  4QAB A;  5CO5 A;  3U8L A;  4ZK1 A;  5LXB A;  4F8H A;  2XYT A;  3P50 A;  2XNU A;  5FJV A;  4ILB A;  3UQ4 A;  4LML A;  5TVC A;  1UX2 A;  4HFI A;  3UU6 A;  3U8M A;  5L4E A;  4UY2 A;  4QH4 A;  3UU5 A;  3GUA A;  4ILA A;  1I9B A;  2PGZ A;  2YME A;  5J0Z A;  4PIR A;  2BR7 A;  4Z91 A;  4ALX A;  2XQ7 A;  2YMD A;  5AIN A;  4XK9 A;  5AFM B;  2XNT A;  4TWF A;  3WTJ A;  3C79 A;  1OED C;  3EAM A;  3P4W A;  4EZ1 A;  5CFB A;  2XQ3 A;  2YOE A;  2XQ9 A;  3JAD A;  3JAF A;  2WN9 A; 
#chains in the Genus database with same CATH topology
 4GYR A;  4QWN B;  5FXW A;  2BKN A;  4HWI B;  3RQW A;  3WAK A;  2XAQ B;  4IST A;  4HFD A;  5KE4 A;  2DHR A;  4U2Z A;  2NWB A;  4IHJ E;  5LGN B;  5SYO A;  4L9I A;  4WZX A;  3EVY A;  2EHO B;  1X9B A;  3T1Y T;  1HF8 A;  1X79 A;  2LLY A;  3TLS A;  4F6R C;  1YD8 G;  3EI0 A;  1DU2 A;  5ABE A;  1OED A;  2ACX A;  5AFH A;  4BFQ A;  4QX8 B;  2DWK A;  4QH1 A;  4E7S A;  5J5H A;  3ZST A;  1YKE B;  4NUU A;  4LFA T;  2A72 A;  3LFM A;  3B13 A;  3L3P A;  4JI2 T;  3QK6 A;  4ZI3 C;  5FP3 A;  2WM9 A;  4DR5 T;  4AIS A;  2XZE A;  4UVA B;  4YSX A;  5LXB A;  3U3I A;  4X64 T;  4CN6 A;  2YDS A;  2CHO A;  4GKK T;  2PGZ A;  3RRW A;  4UF0 A;  3AAI A;  5LJN A;  5FXZ A;  3HA4 A;  2PBI A;  3AED A;  3VKG A;  5LG4 A;  1UV6 A;  4H9R C;  5J5F A;  2WBL A;  3PUZ F;  3QB5 A;  4U31 A;  5L3G B;  3ZMS B;  4QH5 A;  1N32 T;  4ZR6 A;  3ZDG A;  2BR8 A;  3FB2 A;  4N78 D;  4PK4 A;  4YHJ A;  3CX8 B;  1NEK A;  3K1S A;  3SS1 A;  4TWD A;  2KMF A;  1ZV4 X;  3TLU A;  4EYU A;  2KXP B;  4G63 A;  4TX5 A;  4YFS A;  3N9P A;  1XDO A;  3PUV F;  4NUV A;  2VVN A;  4C91 A;  2YIN A;  2LE8 A;  3N2K E;  3RF1 A;  4BJM A;  2BVL A;  3ZT7 A;  4OK0 A;  2WB5 A;  5JR9 B;  1WYB A;  2M6B A;  2D0T A;  2XAF B;  2UXC T;  2KZ7 B;  5LHI B;  1MIY A;  1Y64 B;  3RYH E;  5CO5 A;  3CX6 B;  3N9Q A;  2XYT A;  3UQ4 A;  4G2A A;  5LXT E;  4DV0 T;  4ZS2 A;  2HPL A;  1KK7 A;  2NW9 A;  2R6G F;  3RIU A;  4IIJ E;  4JEU B;  2LM9 A;  2WN9 A;  3LJC A;  3ONX A;  2Y48 B;  4BJN A;  1N33 T;  3TLT A;  2V7M A;  4EV6 A;  4QXH B;  4GOU A;  4ZOL E;  3UT5 E;  3VHL A;  4IE7 A;  1M62 A;  5AQS B;  3AE2 A;  1UUR A;  3MKD A;  5LG3 A;  2BG9 A;  2Y57 A;  5FKY A;  3ONJ A;  3RYI E;  5JDM A;  2XHE B;  1D1C A;  2LJL A;  3I1A A;  4HQP A;  3K3O A;  2BS2 A;  3KBT A;  3C4X A;  4PK6 A;  2K24 A;  4B6X A;  4KMC A;  3UUL A;  4IDO A;  5J5G A;  2V7L A;  4JEH B;  1V9D A;  1XWM A;  2MOZ A;  3UTK A;  4O2A E;  4CXY A;  3C98 B;  4ZK4 A;  2W8G A;  1HCI A;  2CLY C;  1W9R A;  3SQ6 A;  4JBW F;  4COF A;  2IDO B;  3FZL B;  5AQN B;  2LT3 A;  2UXN B;  1SHZ C;  1W0B A;  2E5V A;  3UQ7 A;  2QC1 B;  4X1I E;  5LMU T;  3AAE B;  3P50 A;  1E1H B;  4HN9 A;  4JI8 T;  2KLQ A;  4P1N A;  2BKP A;  5A1L A;  5LHH B;  4KX6 A;  2I6H A;  3D0T A;  3R84 B;  4DV2 T;  5FVL A;  4CXX A;  1WCR A;  3FBZ A;  4CI1 B;  4ISS A;  3ZT5 A;  3BQK A;  4YXD A;  2QGS A;  3K3Q C;  5AFM A;  5CB4 E;  3CPZ A;  3PU8 A;  3PUY F;  2VKO A;  4UV8 B;  1SE7 A;  4JI7 T;  2LRL A;  2ZJU A;  2PG8 A;  4GIW A;  5AQG B;  1BR0 A;  3VRB A;  2CLY B;  3PMZ A;  1IBL T;  3ZCJ A;  3AEB A;  4DR2 T;  2L9Q A;  3EDV A;  2Y54 A;  5BP0 A;  1UX5 A;  4ZXL A;  2WNJ A;  2D9D A;  3ZSS A;  3WIP A;  5AFK A;  3PJA J;  2IC6 A;  1HX8 A;  4L0R A;  1UW6 A;  3P4Q A;  3KV9 A;  1WRD A;  4CXW A;  2A3D A;  3ANW A;  2XPK A;  4UVB B;  5JME A;  4WYV A;  4HFC A;  3ZYK A;  1SA0 E;  1KNR A;  5J5I A;  4LFC T;  2DCF A;  4E7Z A;  5ADX L;  2J62 A;  4HWH A;  2C0S A;  1UX4 A;  4UF0 B;  5E0O A;  3O1H A;  2VQF T;  3HL6 A;  4F8H A;  2V6X A;  2Y8D A;  2CBJ A;  3ZMV B;  3A8Y C;  4UY2 A;  3VU7 H;  4IGU A;  3N5L A;  4O4J E;  4EXT A;  2YMD A;  1N36 T;  2FJD A;  4EB6 E;  3PU3 A;  5AQI B;  1EZ3 A;  3UFE A;  2BDE A;  3I0Q A;  3AE8 A;  2D5U A;  4DO0 A;  1H7C A;  2RP4 A;  4B5D A;  1BR1 A;  3AAA B;  3LK2 B;  2VB6 A;  3N9O A;  5DQW A;  2LOP A;  4HTE A;  2CRB A;  1ZKE A;  1D1A A;  2B76 A;  2W61 A;  4U7I A;  2CCQ A;  4JUY A;  2XY8 B;  5EK4 A;  1VCT A;  1FEW A;  2V7J A;  5HEO A;  2V1D B;  3WAJ A;  5LHG B;  3AE3 A;  3OPC A;  4MAL A;  4I50 E;  2LSK A;  2L3L A;  4ERR A;  3HR0 A;  5JRC B;  2VVS A;  2FJE A;  2VKH A;  2X00 A;  3V5U A;  4EZH A;  4PW8 A;  5FVK A;  4PAG A;  1LVF A;  3P4S A;  5HAX A;  5L3F B;  5AQV B;  4JI1 T;  4U7Y A;  2CXD A;  2LHR A;  4LF7 T;  2H88 A;  5HEU A;  2X00 D;  4D01 A;  5BR8 T;  2BBJ A;  2XYS A;  3WTH A;  2WNL A;  2SPC A;  3CKD A;  4XBF B;  4ASK A;  4HGA A;  4YT0 A;  2DI4 A;  5JRE A;  5IWA T;  4DR1 T;  4OHF A;  4ILA A;  2X51 A;  1OWA A;  3FXE B;  2Q9Q C;  4XK9 A;  3QOF A;  3RKO A;  2JMK A;  4DBR A;  2WDQ A;  3JAF A;  3FZK B;  2H3R A;  2HPJ A;  3AXJ B;  3A5X A;  1Z0P A;  4TUY E;  4ZI2 D;  4JI4 T;  3ZKR A;  4B3R T;  2CEA A;  2Y6X A;  2VKJ A;  3EDU A;  4MFR A;  5HWX A;  1YQ4 A;  4DV5 T;  4ZJS A;  4UIG A;  1XMO T;  3E0Z A;  3ZCI A;  3IGQ A;  1VCS A;  3RYC E;  1JNZ A;  2DWG A;  3P8C D;  3J9X 1;  3QUJ A;  5LA6 E;  2WSS V;  2PJQ A;  5ETW A;  3VR9 A;  2N1G A;  2CWO A;  3FZF B;  3DTO A;  3UU4 A;  3OBV E;  5LBM A;  4DMV A;  3RC8 A;  2Q9Q B;  3RIA A;  4P0B A;  1HR0 T;  5HXS A;  2YU2 A;  2XTL A;  2KWH A;  2CWY A;  2VWA A;  3RIF A;  5HXE A;  5DJQ C;  2ZMA A;  1XNQ T;  2H89 A;  2ODU A;  3WTI A;  5AQH B;  2Y58 A;  4MHC A;  1IJ5 A;  3U8L A;  5LMN T;  1KEY A;  1UX2 A;  2ES0 A;  3PV0 F;  5AFM B;  1D0X A;  4YY3 T;  4QKN A;  3L09 A;  5HXR A;  3AEE A;  4DID B;  2E9X A;  2W00 A;  5J2U E;  5BRX A;  1Z8U A;  4DR7 T;  3T1H T;  3QB5 K;  4DR4 T;  1ZOY A;  4UXN B;  1I94 T;  2E9X D;  4BA9 A;  1XMQ T;  5AQK B;  4EIW A;  4ZS3 A;  4HWF A;  5JR9 C;  3KV6 A;  3O1I A;  5AQR B;  3WTL A;  2DLR A;  3NKZ A;  4JI6 T;  2WAU A;  5LNK A;  2X68 A;  3RI5 A;  2ZJV A;  2JIW A;  4IRE A;  3ANW B;  2YEV C;  1E2A A;  2IUB A;  4ZZB A;  5J1G A;  2MAW A;  5FMN A;  1MIW A;  4AI6 A;  3LDQ B;  4TNV A;  4IDN A;  4PJJ A;  1M7K A;  4EOZ B;  5KMG P;  3O1J A;  4XAX B;  5CJ5 A;  4IL9 A;  3AEC A;  4U3C A;  4X62 T;  3S4U A;  4NXM T;  2YU1 A;  3PE0 A;  2BYP A;  4WBN E;  4AFH A;  1R8I A;  3I0O A;  3A7M A;  2B1E A;  5LYJ E;  3KBU A;  2WWV A;  1G8X A;  2OA5 A;  4HFI A;  4PFP A;  1FMV A;  4CN4 A;  3WTJ A;  3KV5 A;  4EZ1 A;  3GN5 A;  2GK9 A;  1T98 A;  4H9O C;  2WZY A;  1D0Z A;  2YK0 A;  2CHN A;  3AA6 B;  1HNX T;  2XNV A;  5CA1 E;  2I59 A;  2WZH A;  2NW8 A;  4XZC A;  2NP9 A;  2W4X A;  3ZPO A;  2UXX B;  3U78 A;  4BAY B;  3Q9D A;  4UM3 S;  3CIR A;  4GYS A;  2VAS A;  3BQL A;  4PJL A;  3Q5W A;  3HKB E;  5KZU A;  5IUX A;  2AE9 A;  1ZHC A;  4KUM B;  3JC6 D;  5HCM A;  3WTN A;  1NAF A;  1HG2 A;  5ABF A;  2XQY A;  4AQF A;  3SQ9 A;  5FXX A;  1G73 A;  2BVM A;  2JQQ A;  2AXD S;  1KFY A;  3OTO T;  3MAC A;  3UUB A;  4IDZ A;  5AFN A;  3AEG A;  4ZRU A;  4HFB A;  4IE4 A;  4O4H E;  5HXH A;  3RHW A;  2BYN A;  4EYY R;  2XQ6 A;  5LGU B;  3ONL C;  2FJA A;  4JLE A;  2WNC A;  4ZEY A;  3TLV A;  2H7O A;  3L39 A;  4MLK A;  5JDH A;  2WMO A;  5AQO B;  5AQP B;  5TVC A;  3UU6 A;  3U8M A;  4DBQ A;  3MJX A;  4QH4 A;  5AQF B;  3Q5D A;  2W2U A;  4Z91 A;  4X1K E;  3R6N A;  3UFG A;  4I0U A;  1OED C;  4OYK A;  3RKG A;  2X9X A;  3EAM A;  3FBL A;  5TAO A;  5CFB A;  2WWU A;  1WLX A;  4UM3 P;  4X66 T;  4H63 H;  2JQK A;  3SIO A;  3AE9 A;  1UGO A;  4HFH A;  3NRY A;  2X67 A;  2J4G A;  2UU9 T;  4KBM B;  3IBP A;  2J47 A;  2EHO A;  3RX6 A;  3N2O A;  2V8S V;  5JDF A;  5JDG A;  2N2N A;  3UUX B;  4TZ4 C;  3ZYL A;  5FXV A;  1OED E;  5DQV A;  4UM3 A;  3QNU A;  4LMK A;  4TV9 E;  2EHO D;  3LK4 2;  4IE5 A;  4KP3 C;  5L3E B;  2FJB A;  4JV5 T;  4DV4 T;  5EK2 A;  3RLF F;  2H7V C;  5DAB A;  4YTM A;  3FZH B;  4UM1 A;  1MND A;  2C5K T;  2XQ5 A;  3ZLI A;  1OED B;  2BYS A;  2ZM6 T;  5FY7 A;  3Q5X A;  2VKD A;  4LMJ A;  2M6I A;  1KNP A;  1QLB A;  3CML A;  1NEN A;  5AFJ A;  1HS7 A;  2N9D A;  1IBK T;  3KDS E;  1I6Z A;  1FJG T;  5HXC A;  5C2T A;  1IAP A;  4NPP A;  4AKL A;  2HH7 A;  4HWC A;  3B5M A;  4O8S A;  4Z90 A;  1ZEE A;  2WS3 A;  3PUS A;  3ETU A;  4V1A v;  2XAG B;  1B7T A;  2M67 A;  4A56 A;  4CN1 A;  3AVS A;  2JRK A;  2KT9 A;  4ANJ A;  2YME A;  2E9X B;  1MMD A;  1E7P A;  4TWF A;  2NTX A;  2XQ3 A;  2YOE A;  3O9X A;  1L0V A;  2Y7Y A;  3EHZ A;  3JCF A;  3UU8 A;  4QXC B;  3WTM A;  4KHP T;  3KVB A;  2WU2 A;  1WR0 A;  2XUE A;  4FRR A;  4H9N C;  2ZM2 A;  4YHH T;  3B57 A;  1WYC A;  4A97 A;  3ZC0 A;  2W8F A;  5FY1 A;  2WQY A;  3P4R A;  4ZI3 D;  2LSI A;  2QYW A;  4DUY T;  4X1Y E;  3RIU C;  3PUR A;  5JDQ A;  3LK3 B;  2CM0 A;  2IML A;  3L8R A;  3UUM A;  2X0H A;  3WTO A;  4QX7 B;  1Y01 A;  2WY2 A;  2ZM0 A;  3CWZ B;  2BBH A;  2UZ6 A;  2OV9 A;  4K0K T;  5L4H A;  4UEM A;  3ABV A;  1S35 A;  4I43 B;  5JDN A;  4AQF C;  4Z8X A;  3I9Y A;  2K5B B;  2JJ9 A;  3V5S A;  2HHH T;  2C5I T;  4TNW A;  2BG9 C;  2F4V T;  3VRA A;  2ACZ A;  3PUW F;  3NBX X;  5FL0 A;  2LOS A;  3AVR A;  1NWM X;  5LB7 B;  2HN1 A;  1IJ6 A;  2BR7 A;  5HWY A;  5BMV E;  2LEH A;  3PTR B;  4ALX A;  2LRK A;  4P09 A;  3IHR A;  2JQ9 A;  5FL1 A;  2XZ5 A;  5JH7 E;  2HN2 A;  2LHN A;  4CQI A;  2LM2 A;  2VL8 A;  2XAJ B;  4IDP A;  4O4L E;  3HI2 A;  2A2F X;  3OVU A;  2XQA A;  4WV9 A;  2BG9 E;  4IT4 A;  3U8J A;  2CBI A;  4GKJ T;  3F31 A;  2V5D A;  2UUB T;  2E8I A;  3NWI A;  2CXF A;  4K0U A;  5FNV E;  5H6Q B;  5ABF B;  5M4Y A;  3AA7 B;  1UUS A;  4LF4 T;  2C5J A;  5HEG A;  1OXZ A;  1YW0 A;  1MIV A;  3UU3 A;  1HG5 A;  2BG9 B;  3ZMT B;  4O4I E;  1MMA A;  1J5W A;  3SWH A;  3DJB A;  1IZN B;  3F57 A;  3H3M A;  4UV9 B;  2L8K A;  2YN6 A;  4OX9 T;  1CHU A;  4IE0 A;  4AFG A;  2WDV A;  3E08 A;  2VUR A;  3I9W A;  2X0L B;  3G06 A;  5FY0 A;  4AKI A;  2KSR A;  4QAB A;  4H9Q C;  4CI3 B;  4C90 A;  2X0Y A;  4YLH A;  1YQ3 A;  5LGT B;  4PIR A;  4KI0 F;  3HKE E;  4X20 E;  2IC9 A;  2XSA A;  4H9P C;  1UCU A;  2MTQ A;  5KX5 E;  3FXD B;  3FHN A;  2CE7 A;  3LSV A;  5HEH A;  2LKG A;  3U8K A;  2BYR A;  2XAS B;  5CGM A;  3PJA A;  4EEB A;  4NXN T;  2D0U A;  3BQI A;  3K8P C;  1HNZ T;  3C50 A;  2XQ4 A;  4YSY A;  1KNZ A;  4EGW A;  3VR8 A;  1XDP A;  4U33 A;  4O2B E;  4ILC A;  2V7I A;  4NIQ A;  3PUA A;  3CQC B;  3WTK A;  3AE4 A;  5AFU L;  4XHE A;  1LKX A;  3C84 A;  3AE1 A;  3WI3 A;  4HFV A;  2CA5 A;  5FYM A;  4X5T A;  2IAK A;  3HKD E;  2NTY A;  3ZDH A;  5AQU B;  5AFL A;  4BQT A;  2FUP A;  4H9S E;  3RGL A;  2W66 A;  3AA0 B;  3IF8 B;  2OLT A;  2WU5 A;  1O3X A;  3Q5E A;  2XM2 A;  4CI2 B;  2BJ0 A;  4LF6 T;  4OFZ A;  2E2A A;  4LML A;  3SFD A;  2X66 A;  3UU5 A;  2QVA A;  2VQE T;  5AQQ B;  4PFO A;  4M1P A;  5JQG E;  3HKC E;  2UUA T;  1MMN A;  3O4X E;  2QA7 A;  2DL1 A;  4UR9 A;  1IBM T;  2KWI B;  3C4W A;  1SUM B;  4DBM A;  2LKH A;  2BS3 A;  4UEL A;  3NZP A;  1VRB A;  2XJ7 A;  2I0M A;  4AQY T;  1UK5 A;  3LBX A;  4HFE A;  5GON E;  3KIN B;  2JMH A;  2VL0 A;  4QAA A;  2J1D G;  5LOV E;  1D0Y A;  5JTG A;  3CK6 A;  3MXZ A;  2WP9 A;  2BS4 A;  2V6Y A;  1HNW T;  3SH1 A;  3H37 A;  2BYQ A;  3AE6 A;  3ZJ2 A;  4ZI2 C;  4DND A;  2X9H A;  3AE5 A;  1HFA A;  1D1B A;  5LCY A;  2LSG A;  3M3Z B;  4DR3 T;  5JRC A;  4WBO A;  1XZY A;  4DVD A;  3N2G E;  3ZYM A;  4WW0 A;  3ZC1 A;  4I55 E;  3JAE A;  5HCJ A;  4I4T E;  1YKH B;  3RQU A;  1T7S A;  3KVA A;  3OYZ A;  3RYF E;  3KFW X;  3IEE A;  3FZM B;  3DP7 A;  3PEO A;  3SFE A;  3RRC A;  5LP6 E;  4LF9 T;  4ILB A;  3GA8 A;  5L4E A;  1WFD A;  1J1J A;  4JYA T;  3OYX A;  2ZM8 A;  4U74 A;  3C79 A;  3AXJ A;  4HKA A;  2WMN A;  5LJM A;  3ZMU B;  3VKH A;  5F5W A;  1ZP0 A;  4GK5 E;  4A5X A;  1N34 T;  3UUN A;  5IYZ E;  3SOL A;  4AQG A;  2PTF A;  2PH9 A;  3T4M A;  2IHR 1;  4ZZC A;  3PDY A;  4TWH A;  4HEA A;  4AKG A;  3N9N A;  3PUG A;  3U8N A;  4NZB A;  2XSB A;  4PK5 A;  3CQX C;  1W0A A;  2XM1 A;  1S94 A;  3NRX A;  4ZJT A;  1WR6 A;  3LG7 A;  4MBQ A;  3ZMZ B;  2Q9Q A;  3ZEF B;  1BR2 A;  4YJ2 E;  2W63 A;  2WDR A;  2XQ8 A;  4EED A;  3MZK B;  3AEF A;  3OJA A;  2P9B A;  2Q9Q D;  2V26 A;  5L3B B;  1FMW A;  3N9L A;  2E9X C;  3C4Z A;  3H3A A;  1BR4 A;  5HEJ A;  5JDL A;  2ZLY A;  1US7 B;  4YTP A;  5L3C B;  1J5E T;  3AA1 B;  4B3M T;  4J2C A;  2MPK A;  4YSZ A;  1XNR T;  2XNU A;  4DV6 T;  4P0A A;  4HE8 A;  1AJ3 A;  5F8P A;  3ZN1 B;  3NZQ A;  4TV8 E;  5KDM C;  4ZHQ E;  2XQ7 A;  4LF8 T;  5AIN A;  4X65 T;  3MK7 C;  3OKQ A;  4OYJ A;  3RPU A;  1W09 A;  2XQ9 A;  3TKL B;  2IIU A;  3EAB A;  4GK0 E;  2Y56 A;  3M65 A;  2W67 A;  2DNX A;  4YTN A;  4ZI7 E;  4AFT A;  2C9T A;  1MNE A;  3GMI A;  4FJO A;  3QC9 A;  2W62 A;  1U4Q A;  4B3T T;  5BW2 A;  5C8Y E;  1JNR A;  3KV4 A;  3F2E A;  5L47 A;  5H6R B;  1KF6 A;  3CQG B;  5LBQ B;  3Q2M A;  1FIO A;  3RH3 A;  4HWD A;  2KND A;  2CMR A;  4DUZ T;  4A98 A;  4LFB T;  4QHO A;  4H63 V;  2YDR A;  4EAH A;  2FBW A;  3ETV A;  1MMG A;  1HTJ F;  4U72 A;  2W0G A;  3BK9 A;  2WZI A;  1U5P A;  5EZY E;  5ABG A;  5IHY A;  4TN7 B;  2LSJ A;  3RC3 A;  2JPF A;  5AQM B;  4L5G A;  4DV7 T;  5L3D B;  5JVD E;  3TLW A;  2JQH A;  2G0U A;  2VK9 A;  3PUX F;  5EK3 A;  2NOX A;  4UVC B;  4DV1 T;  3PUQ A;  4QXB B;  1T72 A;  2X9W A;  5AQJ B;  3W15 B;  3CVR A;  3JC6 C;  4PJM A;  3P7I A;  3E22 E;  2NR4 A;  2K3W A;  2CPT A;  2MBG A;  5CA0 E;  2D2S A;  5JR9 A;  3GUA A;  3MA9 A;  5J0Z A;  2WCA A;  3ZT6 A;  1LVK A;  4IE6 A;  2XNT A;  4EZ4 A;  2BKO A;  2KIN B;  2Z6E A;  4DR6 T;  5KXJ A;  4AXP A;  3ZJ1 A;  3LBX B;  3X1D A;  3GWH A;  2V5C A;  3AB3 B;  4IL4 A;  1YXR A;  4Q25 A;  3GN5 B;  4U2Y A;  5AQL B;  2QRX A;  4FI5 A;  4AKH A;  2ODV A;  2V6Y B;  3J7Y q;  2UXD T;  4YJ3 E;  3C51 A;  4DMW A;  4UXU A;  1VOM A;  4JI0 T;  1T8B A;  2PFV A;  1GQE A;  2X9Y A;  3IA3 A;  3EUH A;  2XAH B;  5AQT B;  2CXL A;  4IDQ A;  4DV3 T;  2IW5 B;  4B3S T;  5J2T E;  1LRZ A;  3P4P A;  2MYS A;  3AE7 A;  2V7K A;  4ILU A;  5L2L A;  2LSY A;  4CZZ B;  1QSD A;  2UXB T;  4KHZ F;  4AKR B;  2XZ6 A;  4PJN A;  4PNI A;  3NVO A;  5C3J A;  5HYA A;  2RPA A;  2NW7 A;  2YDQ A;  4ADZ A;  2EHO C;  2A9U A;  3AEA A;  3K3N A;  2YKS A;  5F3J A;  4QAC A;  4JI5 T;  4WNK A;  5ABH A;  2K9A A;  3SRZ A;  3CX7 B;  3N9M A;  2E5L T;  4ZK1 A;  2K48 A;  5FJV A;  3T8O A;  4JI3 T;  4AIU A;  3ZN0 B;  2RA1 A;  1QUU A;  1I9B A;  1CUN A;  3C64 A;  1HX1 B;  2UUC T;  2BZB A;  3P4W A;  3ESL A;  3JAD A;  4LF5 T; 
#chains in the Genus database with same CATH homology
 2XZ5 A;  2Y56 A;  3LSV A;  2LM2 A;  4IL4 A;  3SIO A;  4HFH A;  2Y7Y A;  3EHZ A;  3RQW A;  4DBM A;  5HEH A;  4AFT A;  3TLT A;  2LKG A;  2XQA A;  1UV6 A;  2C9T A;  2LKH A;  4HFD A;  3U8K A;  3UU8 A;  5J5F A;  4WV9 A;  5KE4 A;  2BG9 E;  2BYR A;  2WZY A;  2PH9 A;  3T4M A;  3U8J A;  3WTM A;  5BRX A;  5AFM A;  3ZKR A;  4ZZC A;  5BW2 A;  4TWH A;  5L47 A;  4FRR A;  4HFE A;  5SYO A;  2XNV A;  2ZJU A;  3U8N A;  4QH5 A;  4ZR6 A;  4ZJS A;  4NZB A;  2VL0 A;  4QAA A;  3ZDG A;  2XQ4 A;  4UM3 P;  4UXU A;  1OED E;  4UM3 A;  4A98 A;  2BR8 A;  4LMK A;  4B5D A;  5LG3 A;  3IGQ A;  4A97 A;  3PMZ A;  2BG9 A;  2Y57 A;  4ILC A;  5HEG A;  4UM3 S;  2W8F A;  4ZJT A;  3SH1 A;  2LLY A;  3TLS A;  3UU3 A;  3WTL A;  2Y54 A;  5IUX A;  5KZU A;  2BG9 B;  2BYQ A;  5BP0 A;  3EI0 A;  5HCM A;  3WTN A;  3RI5 A;  2ZJV A;  3WTK A;  2WNJ A;  3UU4 A;  4IRE A;  4HQP A;  5HEO A;  3SQ9 A;  2XZ6 A;  1OED A;  4TWD A;  4XHE A;  5AFH A;  2XQ8 A;  4UM1 A;  4ZZB A;  3WIP A;  3TLU A;  3C84 A;  2MAW A;  5AFK A;  2XQ5 A;  3RIA A;  4BFQ A;  1OED B;  3TLW A;  1UW6 A;  5J5G A;  2BYS A;  4TNV A;  4X5T A;  3UUB A;  4LMJ A;  2YN6 A;  2M6I A;  3WTO A;  4QH1 A;  2X00 A;  5AFN A;  2UZ6 A;  5AFJ A;  4ZRU A;  4HFB A;  3ZDH A;  5AFL A;  4BQT A;  5J5H A;  5L4H A;  5HEJ A;  3JAE A;  4IL9 A;  5HCJ A;  2YKS A;  3RHW A;  2BYN A;  4QAC A;  4ZK4 A;  5JME A;  3RIF A;  2W8G A;  2XQ6 A;  4AFG A;  4HFC A;  2M6B A;  5J5I A;  3SQ6 A;  3RQU A;  2BYP A;  4NPP A;  4COF A;  3WTI A;  4AFH A;  5HEU A;  2X00 D;  2BJ0 A;  4D01 A;  2Y58 A;  4Z90 A;  2WNC A;  2XYS A;  3PEO A;  3TLV A;  2WNL A;  3WTH A;  2KSR A;  3UQ7 A;  4TNW A;  2BG9 C;  2QC1 B;  4QAB A;  5CO5 A;  3U8L A;  4ZK1 A;  5LXB A;  4F8H A;  2XYT A;  3P50 A;  2XNU A;  5FJV A;  4ILB A;  3UQ4 A;  4LML A;  5TVC A;  1UX2 A;  4HFI A;  3UU6 A;  3U8M A;  5L4E A;  4UY2 A;  4QH4 A;  3UU5 A;  3GUA A;  4ILA A;  1I9B A;  2PGZ A;  2YME A;  5J0Z A;  4PIR A;  2BR7 A;  4Z91 A;  4ALX A;  2XQ7 A;  2YMD A;  5AIN A;  4XK9 A;  5AFM B;  2XNT A;  4TWF A;  3WTJ A;  3C79 A;  1OED C;  3EAM A;  3P4W A;  4EZ1 A;  5CFB A;  2XQ3 A;  2YOE A;  2XQ9 A;  3JAD A;  3JAF A;  2WN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...