5J0ZA

Crystal structure of glic in complex with dha
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of membrane protein.
rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Membrane protein
molecule keywords Proton-gated ion channel
total genus 87
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5j0zA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j0zA01
4AFTA 1OEDC 4ALXA 4ZJSA 3SIOA 3UU3A 5AFHA 2KSRA 4IL9A 5AFKA 4UY2A 4HFCA 4ILAA 3P4WA 5J5FA 2XZ5A 4UM3S 4BFQA 4AFHA 3IGQA 4TWDA 2Y56A 4QABA 5HEGA 4BQTA 5J5HA 2W8FA 4XK9A 5TVCA 2BJ0A 2LKHA 2LLYA 4X5TA 1UV6A 3U8KA 4XHEA 2PH9A 4IREA 2BYPA 5AFMA 5IUXA 5HEHA 2W8GA 5J0ZA 4AFGA 3PEOA 2M6BA 2BYQA 4TWHA 2BYNA 4ZJTA 4Z91A 2QC1B 3WTMA 3RQWA 5HCMA 3RQUA 2XQ5A 2UZ6A 4NZBA 5LXBA 4D01A 3ZDHA 3UQ4A 2BG9B 3UU4A 2XNVA 4TWFA 2Y54A 5CFBA 4HFIA 3GUAA 4LMLA 3WTKA 2X00D 5CO5A 2XQ3A 3P50A 5HCJA 1OEDB 3RI5A 3PMZA 2XQAA 2BG9E 2XNUA 3T4MA 2ZJUA 3U8JA 4UM3P 4HFHA 3C79A 5KZUA 2XQ7A 2MAWA 2ZJVA 5L4EA 1OEDE 4ZZBA 3JAEA 2Y7YA 2YKSA 3TLSA 4HQPA 4ZR6A 1UW6A 2XYSA 3TLVA 4HFBA 3RIFA 3TLUA 2WNCA 5BRXA 1I9BA 5HEJA 5LG3A 3C84A 2BG9A 4FRRA 2XQ9A 4LMJA 5HEOA 2BR7A 3WIPA 5BP0A 3WTLA 4NPPA 3UQ7A 4A97A 2WNJA 3EAMA 1OEDA 3UU5A 2XQ8A 2WZYA 2M6IA 4EZ1A 4COFA 4QH4A 3TLTA 4F8HA 5J5IA 2BYRA 4DBMA 4UM1A 4A98A 2VL0A 4HFDA 2YMDA 3WTJA 2WN9A 2YMEA 4WV9A 2BR8A 2WNLA 3WTNA 4LMKA 3U8LA 2Y58A 5AINA 5BW2A 4QAAA 3WTHA 4ZRUA 5L4HA 3RIAA 3JADA 3WTIA 3LSVA 3UU8A 3ZDGA 2LM2A 4HFEA 4QH5A 2XZ6A 3U8NA 3U8MA 5AFJA 3WTOA 5AFNA 5J5GA 2C9TA 5HEUA 3UUBA 4Z90A 1UX2A 5SYOA 4ZK1A 3SH1A 4TNVA 5AFMB 3SQ6A 4B5DA 4ILBA 2LKGA 4ILCA 4QH1A 4TNWA 4PIRA 2XQ6A 2XQ4A 2XYTA 3EI0A 3EHZA 4ZZCA 4QACA 2BG9C 5FJVA 2YOEA 3RHWA 2Y57A 2YN6A 2PGZA 2X00A 4ZK4A 4UM3A 3TLWA 5KE4A 2BYSA 3ZKRA 2XNTA 4UXUA 5JMEA 3UU6A 5L47A 4IL4A 3JAFA 5AFLA 3SQ9A
chains in the Genus database with same CATH superfamily
4ZJSA 3NRYA 1HNXT 2WWUA 2B76A 3MZKB 3IGQA 4I55E 3JC6C 5LJNA 4DBQA 3Q5WA 5LHHB 4HTEA 2VQET 4IE7A 4PNIA 2W66A 4AFGA 5EK3A 3NVOA 1SHZC 4XZCA 3PUZF 5JH7E 1N36T 4DV2T 3VU7H 2BKOA 2JRKA 2I0MA 2XAJB 4PK6A 1E2AA 3I9WA 3VKHA 3P7IA 5EK4A 3C98B 3ZMZB 2K3WA 1QLBA 2CCQA 1E7PA 1T8BA 3TLSA 4HQPA 2ZM6T 3OVUA 2NW7A 3N9NA 4ZOLE 3ZN1B 3KVAA 5IHYA 4NPPA 1O3XA 2RP4A 3AE9A 3UFEA 2N9DA 1SE7A 2CLYC 3T8OA 3CIRA 2D2SA 4QH4A 3A7MA 4UM1A 3ZT6A 4JYAT 3ESLA 4IE4A 1FIOA 4ZS2A 3VHLA 3L09A 4BJNA 4B3TT 4PJMA 3ZDGA 5AFNA 4TUYE 3RF1A 3Q9DA 2XUEA 4PJLA 2PG8A 4QX7B 5F8PA 5JDGA 3GA8A 4PK4A 3N2KE 2BYSA 4JI8T 1X9BA 3UULA 2YK0A 4IHJE 2JPFA 4IL9A 5AFKA 4AFHA 2GK9A 2Y56A 3HKCE 4XK9A 2J1DG 5CB4E 3I1AA 5HEHA 4HWCA 1KK7A 1XZYA 2VQFT 3RQUA 3IBPA 4O4IE 3GUAA 1YQ3A 4FJOA 5CO5A 2PTFA 1D0XA 4HEAA 2X67A 1IJ6A 3RRCA 1J5WA 5LCYA 3UUXB 3UUNA 5ABHA 3TLVA 1SUMB 1Z0PA 2CE7A 5LYJE 2BKPA 3AE5A 2NOXA 1UCUA 3ZMUB 3UQ7A 1ZKEA 3LFMA 3TLTA 2IW5B 3P4PA 4ISTA 4A56A 1HS7A 2WNLA 2Q9QC 2D9DA 5AINA 4NIQA 5LHIB 1MIYA 2IHR1 3R84B 3C4XA 4UR9A 4DV3T 1ZV4X 5HEUA 3ETUA 2CPTA 3NWIA 4L5GA 2CRBA 2UXCT 5FL1A 1HG2A 2WZHA 4YLHA 2X0LB 3J7Yq 3KV9A 4AQYT 4ZK4A 1IJ5A 1LVKA 5GONE 1ZOYA 3O1JA 4IL4A 3VRAA 3NZQA 1ZHCA 4U74A 2J47A 2BKNA 3ZYMA 4P09A 3SFEA 3HI2A 5AQHB 2LSYA 5JTGA 2RPAA 4XHEA 4IREA 4CI2B 3AEEA 1FMWA 3RLFF 1YD8G 2ACXA 1W09A 3LDQB 2VVSA 4H9OC 4WBOA 3PURA 3PMZA 5LA6E 4UM3P 5AQJB 2UXDT 1R8IA 2LRKA 4F6RC 2WNCA 3HKDE 3AE8A 2HN2A 3ZJ2A 5HEJA 2XSBA 4A97A 5KX5E 3P4RA 2JIWA 3UFGA 4F8HA 3M65A 3BQKA 2JMKA 1DU2A 1T7SA 3HKBE 4EZHA 4LMKA 2J4GA 3ONJA 4HGAA 2IAKA 1U4QA 2C5IT 4AQFA 2DLRA 3AEAA 3RPUA 5L3EB 3O1HA 4I0UA 4Q25A 1UX2A 2I59A 4O8SA 4ZEYA 4ILBA 4PIRA 4AKGA 2XYTA 3IHRA 5FJVA 4QWNB 3UTKA 2YN6A 2Y57A 1KFYA 5JR9A 2XJ7A 2XY8B 1V9DA 5JDFA 3CK6A 3FXDB 4ALXA 3UU3A 5AQFB 3CKDA 4MHCA 5FXWA 2CBIA 4BFQA 4OYJA 4AQGA 4UEMA 5JDMA 2MPKA 2VKHA 3AE7A 5JDQA 1UX4A 2IC6A 2M6BA 1FMVA 5ADXL 3RYCE 4ZJTA 2L9QA 3NRXA 2MTQA 3RQWA 2WDQA 3CX7B 3FZKB 3ABVA 2CLYB 4U31A 3QUJA 3ONLC 1MMDA 2N1GA 5L2LA 4QXCB 4CXWA 3LBXB 4YY3T 2L8KA 1GQEA 1WFDA 1UUSA 3FZLB 3VRBA 2EHOC 2WMOA 3FXEB 2E5VA 1I9BA 5LB7B 4WW0A 4IT4A 1VOMA 5LBQB 4P0AA 3Q5DA 2W4XA 3PE0A 2YDSA 5HXRA 2UXNB 3J9X1 2V8SV 2YDQA 5L3CB 2B1EA 2Y58A 5AQQB 4QAAA 2X0HA 3CQGB 3DJBA 1CUNA 3WTOA 4LFCT 5KXJA 5SYOA 3A8YC 2K48A 2K9AA 2D0TA 5LGNB 3ONXA 4U2YA 2YOEA 4ZS3A 2V6YA 4EAHA 4JBWF 2JQHA 2Y48B 3OKQA 3QB5K 3LBXA 5JREA 3U78A 4LFAT 4DR7T 1MIWA 5KMGP 2HHHT 3U8KA 2BYPA 2CWOA 3I0QA 2ZM8A 3ZCJA 3AEDA 2UU9T 2QC1B 5FXZA 2ZM2A 3GMIA 1W9RA 1KNRA 3M3ZB 5FNVE 3CQCB 4LMLA 3PUVF 1HTJF 5FXVA 4ADZA 5HYAA 2XM2A 2XNUA 4N78D 3PJAA 1HX8A 4DR2T 2C0SA 4HFHA 2XQ7A 4ZZBA 4UV9B 2QA7A 3AXJB 3FZHB 3ZN0B 2V6XA 5CA0E 2W0GA 2X0YA 3WTLA 2A2FX 3C4WA 4H9RC 4B6XA 2MYSA 4EZ4A 4GKJT 2WN9A 3QC9A 3PUXF 4UVAB 3O9XA 1G73A 5BW2A 3WTIA 2Q9QB 1I94T 4HFEA 4LF7T 4J2CA 1I6ZA 2PFVA 4UXNB 3I0OA 3ANWB 2YINA 5L3DB 2J62A 2KMFA 3FZMB 3MK7C 3DP7A 4GYSA 5M4YA 4UXUA 3KBUA 3PUQA 4EV6A 4ERRA 2WY2A 2NP9A 5J5HA 5TVCA 1MMAA 2V5CA 3GN5B 5FYMA 3ANWA 3SRZA 2DL1A 2A3DA 5J2UE 3RKOA 3K1SA 2V5DA 4WYVA 2V26A 5HCJA 1OEDB 2LSGA 4ZI2C 1B7TA 1WLXA 2IC9A 2LSIA 4HWIB 5FKYA 5F3JA 3V5UA 2JQKA 2XQYA 2YKSA 3T1HT 4YFSA 2W61A 1Y64B 2XQ9A 3WAKA 3WIPA 5IWAT 2XTLA 3ZEFB 4EEDA 2BYRA 3SOLA 4M1PA 4K0KT 2YMEA 5FY7A 2KWHA 5AQOB 4YT0A 4ILUA 4B3ST 2V7KA 2NTYA 2XZ6A 3U8NA 4MFRA 2CA5A 2VL8A 2WWVA 3RIUC 4B5DA 1NENA 3AVSA 2ODVA 4DNDA 5F5WA 2C5KT 2BDEA 5LXTE 3RYIE 3ZJ1A 2PGZA 2P9BA 3ZKRA 2E5LT 3SQ9A 2KSRA 1XNQT 3OYZA 2XZ5A 4X1YE 4BQTA 2W8FA 2EHOD 2BJ0A 2NR4A 4H9PC 4IDNA 1UV6A 2FUPA 1M62A 2H89A 5J0ZA 4QHOA 2IMLA 2DHRA 2HPJA 3PJAJ 3KV4A 3WTKA 5HXEA 3FBLA 4QX8B 4BA9A 1N32T 4B3MT 3F31A 2IDOB 1KF6A 3RI5A 2KT9A 2K5BB 2WZIA 2VKJA 5LHGB 3KINB 4DO0A 2WBLA 1EZ3A 4ANJA 3AECA 3IF8B 2ZM0A 3AE3A 5JDNA 2V7JA 1HNZT 1MMGA 3B13A 5AQPB 4YJ2E 2VASA 1FJGT 3N5LA 3L8RA 5AQRB 4YHJA 3WTNA 3O4XE 2ODUA 4C90A 4X62T 4CZZB 2CXLA 3RIUA 5CJ5A 4JI0T 3IA3A 4KHPT 3R6NA 4Z90A 3SQ6A 1ZEEA 4QACA 3ZMVB 3MJXA 3L3PA 1VCTA 1IBKT 3LK2B 4DBMA 4KP3C 3CPZA 4EYUA 5J5FA 4AQFC 1OWAA 3HA4A 4PJNA 5LMUT 4E7SA 3BQLA 4CXYA 3ETVA 3AA6B 5AFMA 1JNRA 4EEBA 3AAEB 2G0UA 4NZBA 2BG9B 4UF0A 4JI5T 4DV1T 4TWFA 1MNDA 2C5JA 3N2GE 4IE5A 3RKGA 3B57A 4X64T 4HKAA 3VR9A 3D0TA 3NZPA 4P1NA 2A9UA 4PK5A 4MBQA 2W63A 5HXHA 4FI5A 1AJ3A 1UW6A 3TLUA 3RIFA 4DR4T 4HWDA 4UIGA 4V1Av 4X65T 3KFWX 4YXDA 1QUUA 2E8IA 3AE2A 3CX8B 2DI4A 5JRCB 3CWZB 2WSSV 2LJLA 3U8LA 4UF0B 2ZLYA 2LHNA 3RIAA 2YU2A 1OXZA 5A1LA 5AFMB 3C50A 2FJDA 1D1AA 3N9LA 4JV5T 3E08A 2FJAA 4TV9E 3BK9A 5BR8T 4JI4T 1UK5A 4I43B 1OEDC 2QGSA 4H63V 3N9QA 3KV6A 4TWDA 2W00A 3EABA 2LLYA 2IUBA 2X66A 1U5PA 2JQQA 2BYQA 2OA5A 4Z8XA 3MKDA 4H9QC 1S94A 2XNVA 1W0BA 1T98A 1L0VA 5HWXA 3P50A 4DR6T 3F57A 2HPLA 5HWYA 2X9YA 3C79A 4NXNT 2WMNA 4X66T 5L4EA 3C84A 2QRXA 5E0OA 2VB6A 2WCAA 3QNUA 4DV4T 1HR0T 3RC3A 2H7OA 1OEDA 3UU5A 4CN1A 4KBMB 4EZ1A 2Y8DA 1HG5A 2UUAT 3AE4A 5BMVE 4ZI3D 2A72A 4BAYB 2LE8A 4XAXB 2BVLA 5JDLA 3HKEE 2X51A 5L4HA 3GN5A 4AKLA 4DR1T 5JR9C 3H3MA 2EHOB 3KDSE 2LM2A 4QH5A 5ETWA 3C64A 4O4LE 4YSZA 2OLTA 3EHZA 4ZZCA 5ABFB 2X00A 4JI2T 4U3CA 4ISSA 2KWIB 3UU6A 4DMWA 4GK5E 5L47A 5AFHA 1BR0A 4UY2A 4GK0E 4HFCA 1HCIA 2FBWA 1WR6A 1IAPA 4B3RT 4QABA 3MACA 4QKNA 2QVAA 2PH9A 3AAIA 4O2AE 4NXMT 3WI3A 4Z91A 1W0AA 3AAAB 1UURA 1LKXA 3ZDHA 3T1YT 4NUVA 2Y54A 3KV5A 3EUHA 4UV8B 3C51A 3SWHA 2WS3A 3F2EA 4AKRB 5ABEA 3UUMA 3TKLB 3PUWF 5FMNA 3FB2A 4JUYA 2CXFA 2MAWA 2ZJVA 4IE0A 4HE8A 1VCSA 1WYBA 3ZC1A 4HFBA 4OX9T 2VKDA 3AA0B 5ABFA 4PJJA 3L39A 2KXPB 5FL0A 2X9HA 3WAJA 4LFBT 4ZXLA 2XQ8A 3E0ZA 4G63A 2JQ9A 2M6IA 4COFA 4KMCA 3G06A 2Y6XA 2XAHB 5C8YE 3QOFA 3WTJA 2UUCT 2PJQA 2FJBA 4JI1T 5LNKA 3RC8A 3H3AA 1D1BA 4OFZA 3QB5A 4GKKT 4X1IE 5FXXA 3ZC0A 2YU1A 4ILCA 3K3OA 1US7B 4P0BA 4YSYA 1XDPA 3PU8A 3TLWA 1J5ET 1BR2A 4PFPA 5JMEA 3SIOA 2Q9QA 4H9SE 3OJAA 5AQLB 3S4UA 1WRDA 4AKHA 2R6GF 2W8GA 2NW8A 2OV9A 4TWHA 4ZHQE 2BYNA 2W67A 3P8CD 5CA1E 5LXBA 4E7ZA 3Q5EA 3UQ4A 3PUYF 2CHOA 2LM9A 3H37A 2WU5A 2V7MA 2XQ3A 1ZP0A 4QXBB 4L9IA 4EOZB 3V5SA 3U8JA 1H7CA 5KZUA 2WQYA 5L3FB 2WDRA 4DV7T 2Q9QD 2AXDS 1YXRA 4AKIA 4LF6T 2LRLA 3VKGA 1MNEA 1MIVA 2LEHA 2X9WA 2VKOA 1WYCA 1X79A 4IDZA 2UUBT 3RX6A 4PAGA 1IBMT 3RYFE 3IEEA 5LG4A 4O2BE 2IIUA 2YMDA 3NKZA 4WV9A 5H6QB 3OTOT 2VVNA 2WP9A 1T72A 2YEVC 4K0UA 3NBXX 4DV5T 5AFJA 1XMOT 4TNVA 5DJQC 2CHNA 3AEGA 4JLEA 1YKHB 3EI0A 4XBFB 2XPKA 3RHWA 2FJEA 5H6RB 1FEWA 3ZYKA 4YHHT 3N9MA 4TZ4C 3JAFA 5AFLA 4IGUA 5C2TA 3CX6B 3AEBA 5JRCA 2DNXA 2QYWA 2H3RA 4X5TA 3KBTA 2EHOA 4YTNA 2F4VT 1MMNA 2PBIA 1BR1A 2XQ5A 4UVBB 4U7IA 3K8PC 4U33A 5C3JA 2E9XA 5AFUL 5IYZE 3PUAA 2UXXB 3N2OA 2DCFA 3ZLIA 5HXCA 1OEDE 4LF4T 4DV6T 2V7LA 1XMQT 4DVDA 2BG9A 4IDOA 5HEOA 2BS3A 3ZMSB 2XZEA 3EAMA 3PDYA 1KNPA 4DBRA 4HFDA 1G8XA 4U2ZA 2WM9A 5LGTB 3QK6A 3DTOA 3WTHA 1SA0E 4WNKA 4MALA 4O4JE 4BJMA 3UUBA 3AXJA 3ZPOA 4IIJE 5JR9B 3ZT7A 4ZK1A 3SH1A 3HL6A 4QH1A 3SFDA 2XQ6A 2XAFB 2E9XC 4AIUA 4HWHA 4IDPA 3P4SA 4AFTA 4ILAA 2Z6EA 5HXSA 1KNZA 2LT3A 2VWAA 5L3GB 5LBMA 4GYRA 3B5MA 3ZCIA 3WTMA 5HCMA 2DWKA 3ZYLA 3N9OA 3C4ZA 2BS2A 2RA1A 5LMNT 4KI0F 1QSDA 4IE6A 4CI3B 2V6YB 2ZJUA 2ES0A 5AQVB 1M7KA 1N33T 4CXXA 3U3IA 1CHUA 1YQ4A 4OK0A 5KDMC 3JAEA 2Y7YA 3Q2MA 3ZMTB 2XYSA 4KUMB 4FRRA 3LG7A 2CBJA 5BP0A 4H9NC 1J1JA 4TN7B 2CM0A 1NAFA 4HWFA 2V1DB 2XM1A 4EXTA 2BS4A 2YDRA 3K3QC 2NTXA 3AVRA 3LSVA 3O1IA 5FVKA 2KLQA 4OYKA 4TV8E 4EIWA 3K3NA 5JQGE 2NWBA 4JI7T 1NEKA 4UM3A 2XNTA 2WU2A 3CQXC 3AB3B 3EVYA 2E9XD 3P4WA 4ASKA 4DIDB 2BBJA 3FHNA 4DUYT 4O4HE 4CN6A 5IUXA 1UGOA 3AA7B 4HN9A 3OPCA 3Q5XA 3EDVA 4AISA 2E2AA 1LRZA 4D01A 1XDOA 3UU4A 3E22E 2MBGA 5CFBA 4HFIA 4CI1B 1HFAA 5LP6E 5EK2A 2XQAA 5J2TE 3PUGA 2BG9E 3ZT5A 5DQVA 3KVBA 4PW8A 2H88A 1S35A 3RRWA 2XAGB 3CMLA 2KZ7B 4QXHB 5LGUB 5EZYE 5LG3A 3ZSTA 2WAUA 2DWGA 1YKEB 1XWMA 2AE9A 3BQIA 2JJ9A 2BR7A 4EB6E 3EDUA 2H7VC 3RYHE 1VRBA 2WNJA 4OHFA 5AQNB 3OBVE 4PFOA 2D5UA 5FY1A 2KINB 3AE1A 3X1DA 3W15B 4DR3T 2KNDA 4LF8T 5DABA 3AA1B 1UX5A 3LK3B 2XAQB 1Y01A 2C9TA 1E1HB 4WZXA 2XHEB 4L0RA 3RGLA 3SS1A 3PU3A 4KX6A 4TNWA 4LF9T 2XASB 5JVDE 3FBZA 4YTPA 2BZBA 2LSJA 5AQGB 4DMVA 1IBLT 4TX5A 1KEYA 4UM3S 2HN1A 5HEGA 4NUUA 1LVFA 3GWHA 2SPCA 2BVMA 4JEHB 4DR5T 2WB5A 2UZ6A 1BR4A 4EGWA 5AQUB 4AI6A 2X00D 4WBNE 4KHZF 3UT5E 1Z8UA 4UVCB 4JEUB 3HR0A 2HH7A 4DUZT 3VR8A 4ZR6A 3JCFA 5BRXA 4YSXA 2CXDA 2L3LA 4LMJA 4AXPA 2W2UA 5CGMA 5AQKB 2VK9A 2WZYA 4DV0T 5J5IA 5J1GA 2K24A 3CVRA 4ZI7E 2BR8A 4MLKA 3LJCA 4ZI2D 5L3BB 3JADA 2ACZA 1D0ZA 5J5GA 3RH3A 2LKGA 3MXZA 2N2NA 4UELA 2BG9C 1IZNB 3LK42 1N34T 1HX1B 3FZFB 3JC6D 3P4QA 2D0UA 5DQWA 2CWYA 4G2AA 5AQSB 4YTMA 2W62A 2LKHA 2LSKA 4YJ3E 1HNWT 4I50E 4U72A 3A5XA 3PV0F 4LF5T 3PEOA 1D1CA 4GIWA 4JI6T 1D0YA 5AQMB 4H63H 4X20E 5LJMA 5ABGA 1YW0A 5AQIB 5HAXA 2ZMAA 3T4MA 4JI3T 3AE6A 1HF8A 3I9YA 4EYYR 2LOPA 2X9XA 1XNRT 2JMHA 3N9PA 3MA9A 5TAOA 4CN4A 4C91A 3ZSSA 1WCRA 3PUSA 2XSAA 2BBHA 5LOVE 4I4TE 2VURA 5FVLA 1NWMX 5FY0A 2CMRA 2V7IA 3PTRB 3OYXA 4HFVA 5JDHA 4A98A 2VL0A 1JNZA 2UXBT 4A5XA 5AQTB 2WDVA 2NW9A 2E9XB 4ZRUA 2MOZA 3UU8A 3U8MA 2I6HA 2CEAA 2X68A 2LOSA 4CQIA 4IDQA 3AEFA 1WR0A 2LHRA 2XQ4A 4U7YA 2M67A 4ZI3C 5KE4A 5FP3A 4X1KE 4GOUA
chains in the Genus database with same CATH topology
4AFTA 1OEDC 4ALXA 4ZJSA 3SIOA 3UU3A 5AFHA 2KSRA 4IL9A 5AFKA 4UY2A 4HFCA 4ILAA 3P4WA 5J5FA 2XZ5A 4UM3S 4BFQA 4AFHA 3IGQA 4TWDA 2Y56A 4QABA 5HEGA 4BQTA 5J5HA 2W8FA 4XK9A 5TVCA 2BJ0A 2LKHA 2LLYA 4X5TA 1UV6A 3U8KA 4XHEA 2PH9A 4IREA 2BYPA 5AFMA 5IUXA 5HEHA 2W8GA 5J0ZA 4AFGA 3PEOA 2M6BA 2BYQA 4TWHA 2BYNA 4ZJTA 4Z91A 2QC1B 3WTMA 3RQWA 5HCMA 3RQUA 2XQ5A 2UZ6A 4NZBA 5LXBA 4D01A 3ZDHA 3UQ4A 2BG9B 3UU4A 2XNVA 4TWFA 2Y54A 5CFBA 4HFIA 3GUAA 4LMLA 3WTKA 2X00D 5CO5A 2XQ3A 3P50A 5HCJA 1OEDB 3RI5A 3PMZA 2XQAA 2BG9E 2XNUA 3T4MA 2ZJUA 3U8JA 4UM3P 4HFHA 3C79A 5KZUA 2XQ7A 2MAWA 2ZJVA 5L4EA 1OEDE 4ZZBA 3JAEA 2Y7YA 2YKSA 3TLSA 4HQPA 4ZR6A 1UW6A 2XYSA 3TLVA 4HFBA 3RIFA 3TLUA 2WNCA 5BRXA 1I9BA 5HEJA 5LG3A 3C84A 2BG9A 4FRRA 2XQ9A 4LMJA 5HEOA 2BR7A 3WIPA 5BP0A 3WTLA 4NPPA 3UQ7A 4A97A 2WNJA 3EAMA 1OEDA 3UU5A 2XQ8A 2WZYA 2M6IA 4EZ1A 4COFA 4QH4A 3TLTA 4F8HA 5J5IA 2BYRA 4DBMA 4UM1A 4A98A 2VL0A 4HFDA 2YMDA 3WTJA 2WN9A 2YMEA 4WV9A 2BR8A 2WNLA 3WTNA 4LMKA 3U8LA 2Y58A 5AINA 5BW2A 4QAAA 3WTHA 4ZRUA 5L4HA 3RIAA 3JADA 3WTIA 3LSVA 3UU8A 3ZDGA 2LM2A 4HFEA 4QH5A 2XZ6A 3U8NA 3U8MA 5AFJA 3WTOA 5AFNA 5J5GA 2C9TA 5HEUA 3UUBA 4Z90A 1UX2A 5SYOA 4ZK1A 3SH1A 4TNVA 5AFMB 3SQ6A 4B5DA 4ILBA 2LKGA 4ILCA 4QH1A 4TNWA 4PIRA 2XQ6A 2XQ4A 2XYTA 3EI0A 3EHZA 4ZZCA 4QACA 2BG9C 5FJVA 2YOEA 3RHWA 2Y57A 2YN6A 2PGZA 2X00A 4ZK4A 4UM3A 3TLWA 5KE4A 2BYSA 3ZKRA 2XNTA 4UXUA 5JMEA 3UU6A 5L47A 4IL4A 3JAFA 5AFLA 3SQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AFT A;  1OED C;  4ALX A;  4ZJS A;  3SIO A;  3UU3 A;  5AFH A;  2KSR A;  4IL9 A;  5AFK A;  4UY2 A;  4HFC A;  4ILA A;  3P4W A;  5J5F A;  2XZ5 A;  4UM3 S;  4BFQ A;  4AFH A;  3IGQ A;  4TWD A;  2Y56 A;  4QAB A;  5HEG A;  4BQT A;  5J5H A;  2W8F A;  4XK9 A;  5TVC A;  2BJ0 A;  2LKH A;  2LLY A;  4X5T A;  1UV6 A;  3U8K A;  4XHE A;  2PH9 A;  4IRE A;  2BYP A;  5AFM A;  5IUX A;  5HEH A;  2W8G A;  5J0Z A;  4AFG A;  3PEO A;  2M6B A;  2BYQ A;  4TWH A;  2BYN A;  4ZJT A;  4Z91 A;  2QC1 B;  3WTM A;  3RQW A;  5HCM A;  3RQU A;  2XQ5 A;  2UZ6 A;  4NZB A;  5LXB A;  4D01 A;  3ZDH A;  3UQ4 A;  2BG9 B;  3UU4 A;  2XNV A;  4TWF A;  2Y54 A;  5CFB A;  4HFI A;  3GUA A;  4LML A;  3WTK A;  2X00 D;  5CO5 A;  2XQ3 A;  3P50 A;  5HCJ A;  1OED B;  3RI5 A;  3PMZ A;  2XQA A;  2BG9 E;  2XNU A;  3T4M A;  2ZJU A;  3U8J A;  4UM3 P;  4HFH A;  3C79 A;  5KZU A;  2XQ7 A;  2MAW A;  2ZJV A;  5L4E A;  1OED E;  4ZZB A;  3JAE A;  2Y7Y A;  2YKS A;  3TLS A;  4HQP A;  4ZR6 A;  1UW6 A;  2XYS A;  3TLV A;  4HFB A;  3RIF A;  3TLU A;  2WNC A;  5BRX A;  1I9B A;  5HEJ A;  5LG3 A;  3C84 A;  2BG9 A;  4FRR A;  2XQ9 A;  4LMJ A;  5HEO A;  2BR7 A;  3WIP A;  5BP0 A;  3WTL A;  4NPP A;  3UQ7 A;  4A97 A;  2WNJ A;  3EAM A;  1OED A;  3UU5 A;  2XQ8 A;  2WZY A;  2M6I A;  4EZ1 A;  4COF A;  4QH4 A;  3TLT A;  4F8H A;  5J5I A;  2BYR A;  4DBM A;  4UM1 A;  4A98 A;  2VL0 A;  4HFD A;  2YMD A;  3WTJ A;  2WN9 A;  2YME A;  4WV9 A;  2BR8 A;  2WNL A;  3WTN A;  4LMK A;  3U8L A;  2Y58 A;  5AIN A;  5BW2 A;  4QAA A;  3WTH A;  4ZRU A;  5L4H A;  3RIA A;  3JAD A;  3WTI A;  3LSV A;  3UU8 A;  3ZDG A;  2LM2 A;  4HFE A;  4QH5 A;  2XZ6 A;  3U8N A;  3U8M A;  5AFJ A;  3WTO A;  5AFN A;  5J5G A;  2C9T A;  5HEU A;  3UUB A;  4Z90 A;  1UX2 A;  5SYO A;  4ZK1 A;  3SH1 A;  4TNV A;  5AFM B;  3SQ6 A;  4B5D A;  4ILB A;  2LKG A;  4ILC A;  4QH1 A;  4TNW A;  4PIR A;  2XQ6 A;  2XQ4 A;  2XYT A;  3EI0 A;  3EHZ A;  4ZZC A;  4QAC A;  2BG9 C;  5FJV A;  2YOE A;  3RHW A;  2Y57 A;  2YN6 A;  2PGZ A;  2X00 A;  4ZK4 A;  4UM3 A;  3TLW A;  5KE4 A;  2BYS A;  3ZKR A;  2XNT A;  4UXU A;  5JME A;  3UU6 A;  5L47 A;  4IL4 A;  3JAF A;  5AFL A;  3SQ9 A; 
#chains in the Genus database with same CATH topology
 4ZJS A;  3NRY A;  1HNX T;  2WWU A;  2B76 A;  3MZK B;  3IGQ A;  4I55 E;  3JC6 C;  5LJN A;  4DBQ A;  3Q5W A;  5LHH B;  4HTE A;  2VQE T;  4IE7 A;  4PNI A;  2W66 A;  4AFG A;  5EK3 A;  3NVO A;  1SHZ C;  4XZC A;  3PUZ F;  5JH7 E;  1N36 T;  4DV2 T;  3VU7 H;  2BKO A;  2JRK A;  2I0M A;  2XAJ B;  4PK6 A;  1E2A A;  3I9W A;  3VKH A;  3P7I A;  5EK4 A;  3C98 B;  3ZMZ B;  2K3W A;  1QLB A;  2CCQ A;  1E7P A;  1T8B A;  3TLS A;  4HQP A;  2ZM6 T;  3OVU A;  2NW7 A;  3N9N A;  4ZOL E;  3ZN1 B;  3KVA A;  5IHY A;  4NPP A;  1O3X A;  2RP4 A;  3AE9 A;  3UFE A;  2N9D A;  1SE7 A;  2CLY C;  3T8O A;  3CIR A;  2D2S A;  4QH4 A;  3A7M A;  4UM1 A;  3ZT6 A;  4JYA T;  3ESL A;  4IE4 A;  1FIO A;  4ZS2 A;  3VHL A;  3L09 A;  4BJN A;  4B3T T;  4PJM A;  3ZDG A;  5AFN A;  4TUY E;  3RF1 A;  3Q9D A;  2XUE A;  4PJL A;  2PG8 A;  4QX7 B;  5F8P A;  5JDG A;  3GA8 A;  4PK4 A;  3N2K E;  2BYS A;  4JI8 T;  1X9B A;  3UUL A;  2YK0 A;  4IHJ E;  2JPF A;  4IL9 A;  5AFK A;  4AFH A;  2GK9 A;  2Y56 A;  3HKC E;  4XK9 A;  2J1D G;  5CB4 E;  3I1A A;  5HEH A;  4HWC A;  1KK7 A;  1XZY A;  2VQF T;  3RQU A;  3IBP A;  4O4I E;  3GUA A;  1YQ3 A;  4FJO A;  5CO5 A;  2PTF A;  1D0X A;  4HEA A;  2X67 A;  1IJ6 A;  3RRC A;  1J5W A;  5LCY A;  3UUX B;  3UUN A;  5ABH A;  3TLV A;  1SUM B;  1Z0P A;  2CE7 A;  5LYJ E;  2BKP A;  3AE5 A;  2NOX A;  1UCU A;  3ZMU B;  3UQ7 A;  1ZKE A;  3LFM A;  3TLT A;  2IW5 B;  3P4P A;  4IST A;  4A56 A;  1HS7 A;  2WNL A;  2Q9Q C;  2D9D A;  5AIN A;  4NIQ A;  5LHI B;  1MIY A;  2IHR 1;  3R84 B;  3C4X A;  4UR9 A;  4DV3 T;  1ZV4 X;  5HEU A;  3ETU A;  2CPT A;  3NWI A;  4L5G A;  2CRB A;  2UXC T;  5FL1 A;  1HG2 A;  2WZH A;  4YLH A;  2X0L B;  3J7Y q;  3KV9 A;  4AQY T;  4ZK4 A;  1IJ5 A;  1LVK A;  5GON E;  1ZOY A;  3O1J A;  4IL4 A;  3VRA A;  3NZQ A;  1ZHC A;  4U74 A;  2J47 A;  2BKN A;  3ZYM A;  4P09 A;  3SFE A;  3HI2 A;  5AQH B;  2LSY A;  5JTG A;  2RPA A;  4XHE A;  4IRE A;  4CI2 B;  3AEE A;  1FMW A;  3RLF F;  1YD8 G;  2ACX A;  1W09 A;  3LDQ B;  2VVS A;  4H9O C;  4WBO A;  3PUR A;  3PMZ A;  5LA6 E;  4UM3 P;  5AQJ B;  2UXD T;  1R8I A;  2LRK A;  4F6R C;  2WNC A;  3HKD E;  3AE8 A;  2HN2 A;  3ZJ2 A;  5HEJ A;  2XSB A;  4A97 A;  5KX5 E;  3P4R A;  2JIW A;  3UFG A;  4F8H A;  3M65 A;  3BQK A;  2JMK A;  1DU2 A;  1T7S A;  3HKB E;  4EZH A;  4LMK A;  2J4G A;  3ONJ A;  4HGA A;  2IAK A;  1U4Q A;  2C5I T;  4AQF A;  2DLR A;  3AEA A;  3RPU A;  5L3E B;  3O1H A;  4I0U A;  4Q25 A;  1UX2 A;  2I59 A;  4O8S A;  4ZEY A;  4ILB A;  4PIR A;  4AKG A;  2XYT A;  3IHR A;  5FJV A;  4QWN B;  3UTK A;  2YN6 A;  2Y57 A;  1KFY A;  5JR9 A;  2XJ7 A;  2XY8 B;  1V9D A;  5JDF A;  3CK6 A;  3FXD B;  4ALX A;  3UU3 A;  5AQF B;  3CKD A;  4MHC A;  5FXW A;  2CBI A;  4BFQ A;  4OYJ A;  4AQG A;  4UEM A;  5JDM A;  2MPK A;  2VKH A;  3AE7 A;  5JDQ A;  1UX4 A;  2IC6 A;  2M6B A;  1FMV A;  5ADX L;  3RYC E;  4ZJT A;  2L9Q A;  3NRX A;  2MTQ A;  3RQW A;  2WDQ A;  3CX7 B;  3FZK B;  3ABV A;  2CLY B;  4U31 A;  3QUJ A;  3ONL C;  1MMD A;  2N1G A;  5L2L A;  4QXC B;  4CXW A;  3LBX B;  4YY3 T;  2L8K A;  1GQE A;  1WFD A;  1UUS A;  3FZL B;  3VRB A;  2EHO C;  2WMO A;  3FXE B;  2E5V A;  1I9B A;  5LB7 B;  4WW0 A;  4IT4 A;  1VOM A;  5LBQ B;  4P0A A;  3Q5D A;  2W4X A;  3PE0 A;  2YDS A;  5HXR A;  2UXN B;  3J9X 1;  2V8S V;  2YDQ A;  5L3C B;  2B1E A;  2Y58 A;  5AQQ B;  4QAA A;  2X0H A;  3CQG B;  3DJB A;  1CUN A;  3WTO A;  4LFC T;  5KXJ A;  5SYO A;  3A8Y C;  2K48 A;  2K9A A;  2D0T A;  5LGN B;  3ONX A;  4U2Y A;  2YOE A;  4ZS3 A;  2V6Y A;  4EAH A;  4JBW F;  2JQH A;  2Y48 B;  3OKQ A;  3QB5 K;  3LBX A;  5JRE A;  3U78 A;  4LFA T;  4DR7 T;  1MIW A;  5KMG P;  2HHH T;  3U8K A;  2BYP A;  2CWO A;  3I0Q A;  2ZM8 A;  3ZCJ A;  3AED A;  2UU9 T;  2QC1 B;  5FXZ A;  2ZM2 A;  3GMI A;  1W9R A;  1KNR A;  3M3Z B;  5FNV E;  3CQC B;  4LML A;  3PUV F;  1HTJ F;  5FXV A;  4ADZ A;  5HYA A;  2XM2 A;  2XNU A;  4N78 D;  3PJA A;  1HX8 A;  4DR2 T;  2C0S A;  4HFH A;  2XQ7 A;  4ZZB A;  4UV9 B;  2QA7 A;  3AXJ B;  3FZH B;  3ZN0 B;  2V6X A;  5CA0 E;  2W0G A;  2X0Y A;  3WTL A;  2A2F X;  3C4W A;  4H9R C;  4B6X A;  2MYS A;  4EZ4 A;  4GKJ T;  2WN9 A;  3QC9 A;  3PUX F;  4UVA B;  3O9X A;  1G73 A;  5BW2 A;  3WTI A;  2Q9Q B;  1I94 T;  4HFE A;  4LF7 T;  4J2C A;  1I6Z A;  2PFV A;  4UXN B;  3I0O A;  3ANW B;  2YIN A;  5L3D B;  2J62 A;  2KMF A;  3FZM B;  3MK7 C;  3DP7 A;  4GYS A;  5M4Y A;  4UXU A;  3KBU A;  3PUQ A;  4EV6 A;  4ERR A;  2WY2 A;  2NP9 A;  5J5H A;  5TVC A;  1MMA A;  2V5C A;  3GN5 B;  5FYM A;  3ANW A;  3SRZ A;  2DL1 A;  2A3D A;  5J2U E;  3RKO A;  3K1S A;  2V5D A;  4WYV A;  2V26 A;  5HCJ A;  1OED B;  2LSG A;  4ZI2 C;  1B7T A;  1WLX A;  2IC9 A;  2LSI A;  4HWI B;  5FKY A;  5F3J A;  3V5U A;  2JQK A;  2XQY A;  2YKS A;  3T1H T;  4YFS A;  2W61 A;  1Y64 B;  2XQ9 A;  3WAK A;  3WIP A;  5IWA T;  2XTL A;  3ZEF B;  4EED A;  2BYR A;  3SOL A;  4M1P A;  4K0K T;  2YME A;  5FY7 A;  2KWH A;  5AQO B;  4YT0 A;  4ILU A;  4B3S T;  2V7K A;  2NTY A;  2XZ6 A;  3U8N A;  4MFR A;  2CA5 A;  2VL8 A;  2WWV A;  3RIU C;  4B5D A;  1NEN A;  3AVS A;  2ODV A;  4DND A;  5F5W A;  2C5K T;  2BDE A;  5LXT E;  3RYI E;  3ZJ1 A;  2PGZ A;  2P9B A;  3ZKR A;  2E5L T;  3SQ9 A;  2KSR A;  1XNQ T;  3OYZ A;  2XZ5 A;  4X1Y E;  4BQT A;  2W8F A;  2EHO D;  2BJ0 A;  2NR4 A;  4H9P C;  4IDN A;  1UV6 A;  2FUP A;  1M62 A;  2H89 A;  5J0Z A;  4QHO A;  2IML A;  2DHR A;  2HPJ A;  3PJA J;  3KV4 A;  3WTK A;  5HXE A;  3FBL A;  4QX8 B;  4BA9 A;  1N32 T;  4B3M T;  3F31 A;  2IDO B;  1KF6 A;  3RI5 A;  2KT9 A;  2K5B B;  2WZI A;  2VKJ A;  5LHG B;  3KIN B;  4DO0 A;  2WBL A;  1EZ3 A;  4ANJ A;  3AEC A;  3IF8 B;  2ZM0 A;  3AE3 A;  5JDN A;  2V7J A;  1HNZ T;  1MMG A;  3B13 A;  5AQP B;  4YJ2 E;  2VAS A;  1FJG T;  3N5L A;  3L8R A;  5AQR B;  4YHJ A;  3WTN A;  3O4X E;  2ODU A;  4C90 A;  4X62 T;  4CZZ B;  2CXL A;  3RIU A;  5CJ5 A;  4JI0 T;  3IA3 A;  4KHP T;  3R6N A;  4Z90 A;  3SQ6 A;  1ZEE A;  4QAC A;  3ZMV B;  3MJX A;  3L3P A;  1VCT A;  1IBK T;  3LK2 B;  4DBM A;  4KP3 C;  3CPZ A;  4EYU A;  5J5F A;  4AQF C;  1OWA A;  3HA4 A;  4PJN A;  5LMU T;  4E7S A;  3BQL A;  4CXY A;  3ETV A;  3AA6 B;  5AFM A;  1JNR A;  4EEB A;  3AAE B;  2G0U A;  4NZB A;  2BG9 B;  4UF0 A;  4JI5 T;  4DV1 T;  4TWF A;  1MND A;  2C5J A;  3N2G E;  4IE5 A;  3RKG A;  3B57 A;  4X64 T;  4HKA A;  3VR9 A;  3D0T A;  3NZP A;  4P1N A;  2A9U A;  4PK5 A;  4MBQ A;  2W63 A;  5HXH A;  4FI5 A;  1AJ3 A;  1UW6 A;  3TLU A;  3RIF A;  4DR4 T;  4HWD A;  4UIG A;  4V1A v;  4X65 T;  3KFW X;  4YXD A;  1QUU A;  2E8I A;  3AE2 A;  3CX8 B;  2DI4 A;  5JRC B;  3CWZ B;  2WSS V;  2LJL A;  3U8L A;  4UF0 B;  2ZLY A;  2LHN A;  3RIA A;  2YU2 A;  1OXZ A;  5A1L A;  5AFM B;  3C50 A;  2FJD A;  1D1A A;  3N9L A;  4JV5 T;  3E08 A;  2FJA A;  4TV9 E;  3BK9 A;  5BR8 T;  4JI4 T;  1UK5 A;  4I43 B;  1OED C;  2QGS A;  4H63 V;  3N9Q A;  3KV6 A;  4TWD A;  2W00 A;  3EAB A;  2LLY A;  2IUB A;  2X66 A;  1U5P A;  2JQQ A;  2BYQ A;  2OA5 A;  4Z8X A;  3MKD A;  4H9Q C;  1S94 A;  2XNV A;  1W0B A;  1T98 A;  1L0V A;  5HWX A;  3P50 A;  4DR6 T;  3F57 A;  2HPL A;  5HWY A;  2X9Y A;  3C79 A;  4NXN T;  2WMN A;  4X66 T;  5L4E A;  3C84 A;  2QRX A;  5E0O A;  2VB6 A;  2WCA A;  3QNU A;  4DV4 T;  1HR0 T;  3RC3 A;  2H7O A;  1OED A;  3UU5 A;  4CN1 A;  4KBM B;  4EZ1 A;  2Y8D A;  1HG5 A;  2UUA T;  3AE4 A;  5BMV E;  4ZI3 D;  2A72 A;  4BAY B;  2LE8 A;  4XAX B;  2BVL A;  5JDL A;  3HKE E;  2X51 A;  5L4H A;  3GN5 A;  4AKL A;  4DR1 T;  5JR9 C;  3H3M A;  2EHO B;  3KDS E;  2LM2 A;  4QH5 A;  5ETW A;  3C64 A;  4O4L E;  4YSZ A;  2OLT A;  3EHZ A;  4ZZC A;  5ABF B;  2X00 A;  4JI2 T;  4U3C A;  4ISS A;  2KWI B;  3UU6 A;  4DMW A;  4GK5 E;  5L47 A;  5AFH A;  1BR0 A;  4UY2 A;  4GK0 E;  4HFC A;  1HCI A;  2FBW A;  1WR6 A;  1IAP A;  4B3R T;  4QAB A;  3MAC A;  4QKN A;  2QVA A;  2PH9 A;  3AAI A;  4O2A E;  4NXM T;  3WI3 A;  4Z91 A;  1W0A A;  3AAA B;  1UUR A;  1LKX A;  3ZDH A;  3T1Y T;  4NUV A;  2Y54 A;  3KV5 A;  3EUH A;  4UV8 B;  3C51 A;  3SWH A;  2WS3 A;  3F2E A;  4AKR B;  5ABE A;  3UUM A;  3TKL B;  3PUW F;  5FMN A;  3FB2 A;  4JUY A;  2CXF A;  2MAW A;  2ZJV A;  4IE0 A;  4HE8 A;  1VCS A;  1WYB A;  3ZC1 A;  4HFB A;  4OX9 T;  2VKD A;  3AA0 B;  5ABF A;  4PJJ A;  3L39 A;  2KXP B;  5FL0 A;  2X9H A;  3WAJ A;  4LFB T;  4ZXL A;  2XQ8 A;  3E0Z A;  4G63 A;  2JQ9 A;  2M6I A;  4COF A;  4KMC A;  3G06 A;  2Y6X A;  2XAH B;  5C8Y E;  3QOF A;  3WTJ A;  2UUC T;  2PJQ A;  2FJB A;  4JI1 T;  5LNK A;  3RC8 A;  3H3A A;  1D1B A;  4OFZ A;  3QB5 A;  4GKK T;  4X1I E;  5FXX A;  3ZC0 A;  2YU1 A;  4ILC A;  3K3O A;  1US7 B;  4P0B A;  4YSY A;  1XDP A;  3PU8 A;  3TLW A;  1J5E T;  1BR2 A;  4PFP A;  5JME A;  3SIO A;  2Q9Q A;  4H9S E;  3OJA A;  5AQL B;  3S4U A;  1WRD A;  4AKH A;  2R6G F;  2W8G A;  2NW8 A;  2OV9 A;  4TWH A;  4ZHQ E;  2BYN A;  2W67 A;  3P8C D;  5CA1 E;  5LXB A;  4E7Z A;  3Q5E A;  3UQ4 A;  3PUY F;  2CHO A;  2LM9 A;  3H37 A;  2WU5 A;  2V7M A;  2XQ3 A;  1ZP0 A;  4QXB B;  4L9I A;  4EOZ B;  3V5S A;  3U8J A;  1H7C A;  5KZU A;  2WQY A;  5L3F B;  2WDR A;  4DV7 T;  2Q9Q D;  2AXD S;  1YXR A;  4AKI A;  4LF6 T;  2LRL A;  3VKG A;  1MNE A;  1MIV A;  2LEH A;  2X9W A;  2VKO A;  1WYC A;  1X79 A;  4IDZ A;  2UUB T;  3RX6 A;  4PAG A;  1IBM T;  3RYF E;  3IEE A;  5LG4 A;  4O2B E;  2IIU A;  2YMD A;  3NKZ A;  4WV9 A;  5H6Q B;  3OTO T;  2VVN A;  2WP9 A;  1T72 A;  2YEV C;  4K0U A;  3NBX X;  4DV5 T;  5AFJ A;  1XMO T;  4TNV A;  5DJQ C;  2CHN A;  3AEG A;  4JLE A;  1YKH B;  3EI0 A;  4XBF B;  2XPK A;  3RHW A;  2FJE A;  5H6R B;  1FEW A;  3ZYK A;  4YHH T;  3N9M A;  4TZ4 C;  3JAF A;  5AFL A;  4IGU A;  5C2T A;  3CX6 B;  3AEB A;  5JRC A;  2DNX A;  2QYW A;  2H3R A;  4X5T A;  3KBT A;  2EHO A;  4YTN A;  2F4V T;  1MMN A;  2PBI A;  1BR1 A;  2XQ5 A;  4UVB B;  4U7I A;  3K8P C;  4U33 A;  5C3J A;  2E9X A;  5AFU L;  5IYZ E;  3PUA A;  2UXX B;  3N2O A;  2DCF A;  3ZLI A;  5HXC A;  1OED E;  4LF4 T;  4DV6 T;  2V7L A;  1XMQ T;  4DVD A;  2BG9 A;  4IDO A;  5HEO A;  2BS3 A;  3ZMS B;  2XZE A;  3EAM A;  3PDY A;  1KNP A;  4DBR A;  4HFD A;  1G8X A;  4U2Z A;  2WM9 A;  5LGT B;  3QK6 A;  3DTO A;  3WTH A;  1SA0 E;  4WNK A;  4MAL A;  4O4J E;  4BJM A;  3UUB A;  3AXJ A;  3ZPO A;  4IIJ E;  5JR9 B;  3ZT7 A;  4ZK1 A;  3SH1 A;  3HL6 A;  4QH1 A;  3SFD A;  2XQ6 A;  2XAF B;  2E9X C;  4AIU A;  4HWH A;  4IDP A;  3P4S A;  4AFT A;  4ILA A;  2Z6E A;  5HXS A;  1KNZ A;  2LT3 A;  2VWA A;  5L3G B;  5LBM A;  4GYR A;  3B5M A;  3ZCI A;  3WTM A;  5HCM A;  2DWK A;  3ZYL A;  3N9O A;  3C4Z A;  2BS2 A;  2RA1 A;  5LMN T;  4KI0 F;  1QSD A;  4IE6 A;  4CI3 B;  2V6Y B;  2ZJU A;  2ES0 A;  5AQV B;  1M7K A;  1N33 T;  4CXX A;  3U3I A;  1CHU A;  1YQ4 A;  4OK0 A;  5KDM C;  3JAE A;  2Y7Y A;  3Q2M A;  3ZMT B;  2XYS A;  4KUM B;  4FRR A;  3LG7 A;  2CBJ A;  5BP0 A;  4H9N C;  1J1J A;  4TN7 B;  2CM0 A;  1NAF A;  4HWF A;  2V1D B;  2XM1 A;  4EXT A;  2BS4 A;  2YDR A;  3K3Q C;  2NTX A;  3AVR A;  3LSV A;  3O1I A;  5FVK A;  2KLQ A;  4OYK A;  4TV8 E;  4EIW A;  3K3N A;  5JQG E;  2NWB A;  4JI7 T;  1NEK A;  4UM3 A;  2XNT A;  2WU2 A;  3CQX C;  3AB3 B;  3EVY A;  2E9X D;  3P4W A;  4ASK A;  4DID B;  2BBJ A;  3FHN A;  4DUY T;  4O4H E;  4CN6 A;  5IUX A;  1UGO A;  3AA7 B;  4HN9 A;  3OPC A;  3Q5X A;  3EDV A;  4AIS A;  2E2A A;  1LRZ A;  4D01 A;  1XDO A;  3UU4 A;  3E22 E;  2MBG A;  5CFB A;  4HFI A;  4CI1 B;  1HFA A;  5LP6 E;  5EK2 A;  2XQA A;  5J2T E;  3PUG A;  2BG9 E;  3ZT5 A;  5DQV A;  3KVB A;  4PW8 A;  2H88 A;  1S35 A;  3RRW A;  2XAG B;  3CML A;  2KZ7 B;  4QXH B;  5LGU B;  5EZY E;  5LG3 A;  3ZST A;  2WAU A;  2DWG A;  1YKE B;  1XWM A;  2AE9 A;  3BQI A;  2JJ9 A;  2BR7 A;  4EB6 E;  3EDU A;  2H7V C;  3RYH E;  1VRB A;  2WNJ A;  4OHF A;  5AQN B;  3OBV E;  4PFO A;  2D5U A;  5FY1 A;  2KIN B;  3AE1 A;  3X1D A;  3W15 B;  4DR3 T;  2KND A;  4LF8 T;  5DAB A;  3AA1 B;  1UX5 A;  3LK3 B;  2XAQ B;  1Y01 A;  2C9T A;  1E1H B;  4WZX A;  2XHE B;  4L0R A;  3RGL A;  3SS1 A;  3PU3 A;  4KX6 A;  4TNW A;  4LF9 T;  2XAS B;  5JVD E;  3FBZ A;  4YTP A;  2BZB A;  2LSJ A;  5AQG B;  4DMV A;  1IBL T;  4TX5 A;  1KEY A;  4UM3 S;  2HN1 A;  5HEG A;  4NUU A;  1LVF A;  3GWH A;  2SPC A;  2BVM A;  4JEH B;  4DR5 T;  2WB5 A;  2UZ6 A;  1BR4 A;  4EGW A;  5AQU B;  4AI6 A;  2X00 D;  4WBN E;  4KHZ F;  3UT5 E;  1Z8U A;  4UVC B;  4JEU B;  3HR0 A;  2HH7 A;  4DUZ T;  3VR8 A;  4ZR6 A;  3JCF A;  5BRX A;  4YSX A;  2CXD A;  2L3L A;  4LMJ A;  4AXP A;  2W2U A;  5CGM A;  5AQK B;  2VK9 A;  2WZY A;  4DV0 T;  5J5I A;  5J1G A;  2K24 A;  3CVR A;  4ZI7 E;  2BR8 A;  4MLK A;  3LJC A;  4ZI2 D;  5L3B B;  3JAD A;  2ACZ A;  1D0Z A;  5J5G A;  3RH3 A;  2LKG A;  3MXZ A;  2N2N A;  4UEL A;  2BG9 C;  1IZN B;  3LK4 2;  1N34 T;  1HX1 B;  3FZF B;  3JC6 D;  3P4Q A;  2D0U A;  5DQW A;  2CWY A;  4G2A A;  5AQS B;  4YTM A;  2W62 A;  2LKH A;  2LSK A;  4YJ3 E;  1HNW T;  4I50 E;  4U72 A;  3A5X A;  3PV0 F;  4LF5 T;  3PEO A;  1D1C A;  4GIW A;  4JI6 T;  1D0Y A;  5AQM B;  4H63 H;  4X20 E;  5LJM A;  5ABG A;  1YW0 A;  5AQI B;  5HAX A;  2ZMA A;  3T4M A;  4JI3 T;  3AE6 A;  1HF8 A;  3I9Y A;  4EYY R;  2LOP A;  2X9X A;  1XNR T;  2JMH A;  3N9P A;  3MA9 A;  5TAO A;  4CN4 A;  4C91 A;  3ZSS A;  1WCR A;  3PUS A;  2XSA A;  2BBH A;  5LOV E;  4I4T E;  2VUR A;  5FVL A;  1NWM X;  5FY0 A;  2CMR A;  2V7I A;  3PTR B;  3OYX A;  4HFV A;  5JDH A;  4A98 A;  2VL0 A;  1JNZ A;  2UXB T;  4A5X A;  5AQT B;  2WDV A;  2NW9 A;  2E9X B;  4ZRU A;  2MOZ A;  3UU8 A;  3U8M A;  2I6H A;  2CEA A;  2X68 A;  2LOS A;  4CQI A;  4IDQ A;  3AEF A;  1WR0 A;  2LHR A;  2XQ4 A;  4U7Y A;  2M67 A;  4ZI3 C;  5KE4 A;  5FP3 A;  4X1K E;  4GOU A; 
#chains in the Genus database with same CATH homology
 4AFT A;  1OED C;  4ALX A;  4ZJS A;  3SIO A;  3UU3 A;  5AFH A;  2KSR A;  4IL9 A;  5AFK A;  4UY2 A;  4HFC A;  4ILA A;  3P4W A;  5J5F A;  2XZ5 A;  4UM3 S;  4BFQ A;  4AFH A;  3IGQ A;  4TWD A;  2Y56 A;  4QAB A;  5HEG A;  4BQT A;  5J5H A;  2W8F A;  4XK9 A;  5TVC A;  2BJ0 A;  2LKH A;  2LLY A;  4X5T A;  1UV6 A;  3U8K A;  4XHE A;  2PH9 A;  4IRE A;  2BYP A;  5AFM A;  5IUX A;  5HEH A;  2W8G A;  5J0Z A;  4AFG A;  3PEO A;  2M6B A;  2BYQ A;  4TWH A;  2BYN A;  4ZJT A;  4Z91 A;  2QC1 B;  3WTM A;  3RQW A;  5HCM A;  3RQU A;  2XQ5 A;  2UZ6 A;  4NZB A;  5LXB A;  4D01 A;  3ZDH A;  3UQ4 A;  2BG9 B;  3UU4 A;  2XNV A;  4TWF A;  2Y54 A;  5CFB A;  4HFI A;  3GUA A;  4LML A;  3WTK A;  2X00 D;  5CO5 A;  2XQ3 A;  3P50 A;  5HCJ A;  1OED B;  3RI5 A;  3PMZ A;  2XQA A;  2BG9 E;  2XNU A;  3T4M A;  2ZJU A;  3U8J A;  4UM3 P;  4HFH A;  3C79 A;  5KZU A;  2XQ7 A;  2MAW A;  2ZJV A;  5L4E A;  1OED E;  4ZZB A;  3JAE A;  2Y7Y A;  2YKS A;  3TLS A;  4HQP A;  4ZR6 A;  1UW6 A;  2XYS A;  3TLV A;  4HFB A;  3RIF A;  3TLU A;  2WNC A;  5BRX A;  1I9B A;  5HEJ A;  5LG3 A;  3C84 A;  2BG9 A;  4FRR A;  2XQ9 A;  4LMJ A;  5HEO A;  2BR7 A;  3WIP A;  5BP0 A;  3WTL A;  4NPP A;  3UQ7 A;  4A97 A;  2WNJ A;  3EAM A;  1OED A;  3UU5 A;  2XQ8 A;  2WZY A;  2M6I A;  4EZ1 A;  4COF A;  4QH4 A;  3TLT A;  4F8H A;  5J5I A;  2BYR A;  4DBM A;  4UM1 A;  4A98 A;  2VL0 A;  4HFD A;  2YMD A;  3WTJ A;  2WN9 A;  2YME A;  4WV9 A;  2BR8 A;  2WNL A;  3WTN A;  4LMK A;  3U8L A;  2Y58 A;  5AIN A;  5BW2 A;  4QAA A;  3WTH A;  4ZRU A;  5L4H A;  3RIA A;  3JAD A;  3WTI A;  3LSV A;  3UU8 A;  3ZDG A;  2LM2 A;  4HFE A;  4QH5 A;  2XZ6 A;  3U8N A;  3U8M A;  5AFJ A;  3WTO A;  5AFN A;  5J5G A;  2C9T A;  5HEU A;  3UUB A;  4Z90 A;  1UX2 A;  5SYO A;  4ZK1 A;  3SH1 A;  4TNV A;  5AFM B;  3SQ6 A;  4B5D A;  4ILB A;  2LKG A;  4ILC A;  4QH1 A;  4TNW A;  4PIR A;  2XQ6 A;  2XQ4 A;  2XYT A;  3EI0 A;  3EHZ A;  4ZZC A;  4QAC A;  2BG9 C;  5FJV A;  2YOE A;  3RHW A;  2Y57 A;  2YN6 A;  2PGZ A;  2X00 A;  4ZK4 A;  4UM3 A;  3TLW A;  5KE4 A;  2BYS A;  3ZKR A;  2XNT A;  4UXU A;  5JME A;  3UU6 A;  5L47 A;  4IL4 A;  3JAF A;  5AFL A;  3SQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...