5J0ZA

Crystal structure of glic in complex with dha
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Crystal Structure of membrane protein.
rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Membrane protein
total genus 87
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5j0zA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j0zA01
5HEHA 5J5IA 4ZZBA 3UQ4A 4TWFA 1OEDE 2XQ3A 5HCMA 2WZYA 1I9BA 4EZ1A 4ZJSA 3U8MA 3PMZA 2XQ9A 5AFMB 5AINA 4HFHA 3WTJA 4ILBA 3U8NA 2BG9A 3SQ6A 4HFEA 3LSVA 3RI5A 2XQAA 3C79A 4FRRA 5HEGA 2BYSA 3U8KA 5BP0A 5BW2A 5HEUA 4LMLA 4BFQA 4WV9A 4PIRA 4UM1A 3RIAA 3SH1A 4X5TA 4Z90A 3UUBA 4XHEA 2MAWA 4ZZCA 2YMDA 3PEOA 4XK9A 3P4WA 3UU6A 2YN6A 2UZ6A 2XZ6A 2YOEA 3TLWA 3C84A 4QH4A 4ZR6A 3WTOA 4B5DA 5HEJA 4TNWA 4UM3P 2PH9A 5BRXA 2PGZA 3ZDGA 2XQ7A 4TWDA 3JAFA 3TLUA 2BJ0A 3WTNA 5AFJA 4HFCA 4TWHA 2BR7A 4NZBA 4NPPA 1UV6A 4UM3A 5CFBA 1OEDA 3JAEA 4HFIA 3RIFA 3ZKRA 5AFHA 4UY2A 3TLVA 3EHZA 4QAAA 2KSRA 5KE4A 2BG9B 3JADA 2BR8A 2YMEA 3SQ9A 3WTHA 5LG3A 5LXBA 4ZK4A 4IL4A 3TLTA 3SIOA 3WTIA 3U8LA 4ZK1A 5KZUA 3RHWA 2W8GA 2M6BA 3RQUA 2XNTA 2BG9C 4ALXA 1UW6A 2XNVA 2WNCA 2M6IA 4D01A 2QC1B 4UXUA 3U8JA 3EI0A 2XYTA 2Y7YA 4BQTA 4UM3S 3UU8A 4QH5A 4IL9A 2BYNA 3T4MA 2X00D 5AFNA 3P50A 3WIPA 2BYRA 2XNUA 4QH1A 2XQ6A 4HFDA 5J5GA 3WTLA 4LMJA 5JMEA 3RQWA 2LM2A 5L4HA 2XYSA 4A97A 2LKGA 4ZRUA 3WTKA 3ZDHA 5AFLA 3TLSA 4AFHA 2BG9E 2WNJA 4HQPA 4AFTA 5AFMA 4A98A 2VL0A 4TNVA 2ZJUA 4COFA 5TVCA 2Y54A 1OEDB 2W8FA 5SYOA 4QACA 5HEOA 2X00A 4Z91A 5FJVA 2BYPA 4ZJTA 2XQ4A 2WN9A 3GUAA 4QABA 2LLYA 1OEDC 3EAMA 3WTMA 2C9TA 3UU5A 4IREA 5AFKA 4LMKA 3UU3A 2BYQA 4AFGA 2Y58A 5J5FA 4ILAA 5J0ZA 2XZ5A 3UQ7A 2WNLA 1UX2A 2LKHA 4DBMA 3UU4A 4ILCA 5L4EA 2XQ8A 4HFBA 2XQ5A 3IGQA 2Y57A 2YKSA 2Y56A 5J5HA 2ZJVA 5IUXA 5CO5A 5L47A 5HCJA 4F8HA
chains in the Genus database with same CATH superfamily
5HEHA 5J5IA 4H63H 2MBGA 3M65A 3L8RA 3SRZA 1I9BA 4YLHA 2XQYA 3K8PC 1XDPA 1Z0PA 2E2AA 2UXDT 4O4HE 4UV8B 1HR0T 3LK3B 3ZSTA 3IF8B 2KWIB 5EK4A 3KV6A 2C5IT 2YEVC 2FUPA 3AXJB 4AQFC 4UM1A 2KINB 4IDZA 5LB7B 2XAFB 4B3RT 4PK4A 3PEOA 4WBNE 3AE8A 4YSYA 4TNWA 5AQFB 3UULA 5JDHA 2AE9A 4HN9A 4NPPA 3RF1A 4UM3A 3JAEA 3KINB 4GK5E 4HFIA 5AFHA 1MIYA 4YFSA 1E7PA 1E1HB 3TLTA 5EZYE 3ZT6A 2NWBA 3B13A 4H9QC 4PNIA 4FJOA 3AAEB 2V7IA 4YT0A 4D01A 4TUYE 2WZIA 4DR3T 4HFDA 3AEEA 3J9X1 3MXZA 3ETUA 1US7B 4COFA 2W8FA 5FP3A 1D1AA 3PURA 4CI1B 4M1PA 2WAUA 4AFGA 2Y58A 3AAIA 1BR4A 4HFBA 2XQ5A 2YKSA 5J2UE 3LDQB 1OEDE 4JI8T 5JDFA 3I0QA 3PMZA 3K3QC 2W67A 3UUNA 2BG9A 1MNDA 2IC6A 5GONE 3K3OA 5HEUA 4EB6E 2BBHA 2KXPB 4JI7T 4E7ZA 2DHRA 3UUBA 2HN2A 1WCRA 4DV1T 3HI2A 3S4UA 2PGZA 2PTFA 2XQ7A 2QA7A 3JC6D 2W62A 4EZHA 5HXCA 5F3JA 4YJ2E 2DLRA 4UY2A 3ZEFB 1GQEA 4EYUA 5LXBA 2V7MA 3PE0A 4QWNB 2BKPA 5JDGA 2W4XA 1LVKA 3AEAA 2BKNA 4ISSA 4Q25A 2BS2A 2UXXB 3T4MA 3NZQA 3P4SA 5J5GA 3CIRA 4A97A 2J47A 3VU7H 3ZMUB 4TV8E 2HPLA 3KV4A 1OEDB 2CBIA 4JI4T 2B76A 4ZJTA 2J4GA 4DVDA 3QOFA 3UU5A 1W09A 1OWAA 3ZT7A 3PTRB 5ABFA 1UX2A 4DBMA 4EOZB 2XQ8A 5LMNT 5J5HA 2ZM0A 2OLTA 2FJDA 4G2AA 3GA8A 5LHHB 5IHYA 3F31A 1Y01A 2W66A 2YDRA 2LSGA 4ILBA 2IIUA 2Q9QB 1WRDA 3SH1A 4JLEA 2E5VA 5HYAA 5ABHA 4QH4A 3PJAJ 4ILUA 2EHOD 3ZDGA 2RPAA 2OV9A 3J7Yq 3GN5A 1FMWA 2BVLA 5CA1E 4NZBA 4DV3T 3ANWA 5JR9A 2J1DG 2P9BA 3TLVA 3IA3A 4JI3T 3AEBA 5LBQB 5AQOB 5JDNA 5JTGA 1XZYA 2XNTA 2HPJA 3AEGA 3RYHE 3VHLA 1J1JA 2CXLA 5JDMA 1YKEB 4H9PC 3RKOA 5BMVE 3C4XA 4N78D 4DR7T 5EK2A 4NXNT 1N33T 5KDMC 3FZLB 2I59A 5FXWA 3N9MA 1HX1B 4GK0E 5HEOA 1Z8UA 2VVNA 5JVDE 2C9TA 3ZJ2A 4EAHA 4P0BA 3KV9A 1WYCA 1HNXT 2LJLA 3C50A 4I43B 2KNDA 2BKOA 3HKBE 3BQLA 2YK0A 4ERRA 4IE0A 1N36T 4JI2T 3AVSA 2BZBA 2XQ9A 4K0UA 2N2NA 3WTJA 4ISTA 4I0UA 2M67A 3LSVA 3OVUA 1S94A 3WAJA 3ZN1B 2KT9A 4EXTA 2JMHA 5LG4A 1XMOT 2QRXA 3QB5A 4YTNA 3CQXC 2BDEA 3Q5WA 4XK9A 4PAGA 2XZ6A 3PU8A 2YOEA 4B6XA 3MA9A 4JI5T 3ZCJA 5FYMA 3VKGA 1IZNB 2JQQA 2X51A 3T8OA 3MZKB 3Q9DA 4UEMA 3WTNA 5AFJA 2JMKA 4TWHA 1KK7A 4XZCA 3CX6B 3OBVE 4DUZT 5FL1A 5L3FB 3U8LA 1I94T 1OXZA 1H7CA 2N9DA 2MPKA 3VRAA 3EI0A 2XYTA 4LF5T 3AA0B 3O1JA 4HWCA 5L3GB 5F5WA 3LFMA 2CLYC 3KFWX 4PJMA 3ZT5A 2K5BB 2LKGA 2XSAA 4AFHA 3PUQA 4A98A 2NR4A 4O4LE 4X1KE 3Q2MA 2D0UA 4K0KT 4AQFA 4QACA 3V5UA 5AFKA 3N9LA 3PUGA 5J5FA 2D9DA 4I55E 4ZHQE 2E8IA 1HF8A 5C3JA 2LKHA 4YTMA 2CE7A 4TZ4C 2J62A 2OA5A 3FBLA 2DCFA 4DR2T 4WYVA 4TX5A 4EZ1A 1FJGT 2L3LA 4BJNA 4X20E 3AVRA 5H6QB 3PU3A 4H9RC 5TAOA 1KNPA 2WDQA 4DMWA 5CA0E 3PV0F 5ABGA 3BQIA 2K24A 3JC6C 5FL0A 5AQGB 4GIWA 3P4WA 1HFAA 2XPKA 3CWZB 3CQCB 1S35A 1LKXA 3NZPA 2CXDA 4U3CA 2VQET 4UM3P 5LHGB 3ZMVB 2QGSA 3L39A 4DR4T 4GKKT 3SIOA 3AECA 4AIUA 2C5KT 3AE1A 3H3MA 3M3ZB 3PUVF 5AQLB 4FI5A 3LG7A 3OYZA 3ONXA 3P50A 4DV5T 2XNUA 3PDYA 1D1BA 2QYWA 3E0ZA 4ZRUA 3ZYKA 4LFCT 2LHRA 4BA9A 4ADZA 2IC9A 3EABA 4PFPA 2LLYA 1D1CA 3NBXX 1KEYA 3L09A 3EDUA 5EK3A 3ESLA 5J2TE 4JEUB 2V7KA 3JCFA 4ILCA 5H6RB 1IBMT 2XAQB 2NW7A 4EEBA 3BK9A 4AKHA 2JIWA 3KBTA 2WMOA 4QX7B 4V1Av 5LJNA 5AFMB 2FJAA 4PFOA 1IBLT 1IJ6A 2DNXA 3N2GE 1EZ3A 4KHZF 5J1GA 4LMLA 2EHOC 4UVCB 4DV0T 2MTQA 3P8CD 3CK6A 2YMDA 3R6NA 3RRCA 4ZI2D 4GKJT 4HFVA 3LK2B 3B57A 2BR7A 1UK5A 4LF4T 3R84B 2CCQA 4CXXA 5FY1A 1UUSA 1YQ3A 4DR1T 4IE6A 2ODVA 3CKDA 4X1IE 2IAKA 2XNVA 5FMNA 2JQKA 2XHEB 2BYNA 1MIVA 3C4ZA 2LOSA 2QVAA 3I9WA 1HNWT 3RQWA 2WSSV 2E5LT 5HWXA 2JQ9A 2JPFA 4WZXA 3LJCA 3SS1A 3ZJ1A 4AKLA 1UGOA 2VL8A 2ZJUA 2VASA 4TV9E 3MKDA 2V8SV 3NRYA 2VKHA 4QABA 2ZM2A 5L3CB 2RA1A 3OPCA 4IDPA 3MK7C 1NWMX 1DU2A 1WFDA 5JRCB 2V1DB 2WB5A 1MNEA 2E9XC 2KZ7B 4P1NA 3ZC0A 2V6YB 3W15B 3FZMB 5L47A 3UTKA 3DP7A 4ZS3A 1SHZC 5AINA 4HFHA 4HWFA 4QXHB 3RYFE 3K1SA 4ANJA 3C79A 5AQSB 4L9IA 1HTJF 2A2FX 2NW8A 4YHJA 2MYSA 1NENA 4XHEA 3I0OA 3P7IA 4GYRA 2YDQA 3QB5K 1BR0A 1MMAA 4X62T 2XSBA 3QK6A 3WI3A 2A9UA 3JAFA 2NTYA 4JI6T 3AA6B 4WW0A 5FVLA 3NWIA 1CUNA 3WTIA 5KZUA 5DJQC 4JUYA 3PUXF 4NXMT 4ALXA 1SUMB 3RRWA 1NAFA 5LYJE 2WMNA 3FXEB 2KWHA 2CPTA 4MHCA 2XYSA 2JRKA 2G0UA 1JNZA 3TLSA 2WBLA 2BG9E 2KLQA 3ZN0B 1D0YA 1ZEEA 5AQKB 2Y8DA 2ZLYA 4IT4A 4JI1T 2WU5A 1XNRT 4U31A 3EUHA 2XZ5A 1J5WA 4OX9T 3TKLB 4X65T 5L3BB 3IGQA 2NW9A 1XDOA 4DV7T 2Y56A 2XUEA 5FKYA 4DIDB 2ZM8A 4AKIA 3SQ6A 3RI5A 3U8KA 1YQ4A 4NIQA 3SFEA 4WV9A 2SPCA 1D0ZA 4EZ4A 3SFDA 1N32T 3QNUA 3RGLA 3UU6A 3RYIE 3C84A 3RKGA 3U3IA 1XMQT 4GYSA 2ZMAA 4CXYA 1X9BA 4QAAA 3D0TA 2V26A 5KE4A 2BG9B 3JADA 1O3XA 3LBXA 3Q5EA 1UW6A 3T1HT 2M6IA 2W63A 4X66T 3U8JA 4OYKA 3PUSA 4O4IE 2A3DA 4O2AE 3IBPA 2UU9T 5CJ5A 2H89A 2LOPA 3AE7A 2BYRA 3WTLA 4ZS2A 5LJMA 4HKAA 3PJAA 1OEDC 5L3EB 3RPUA 2V7LA 3AEFA 2V5DA 3A7MA 3KBUA 2BS3A 2D0TA 3OYXA 3H37A 3SOLA 3HR0A 2ACXA 3MACA 5BR8T 2JJ9A 5LGTB 3U8NA 2VKJA 2BYSA 3ZC1A 2XY8B 3V5SA 4KUMB 3ONLC 2X67A 4MALA 4ZI2C 1NEKA 2Q9QC 4EGWA 3GWHA 3RYCE 2MAWA 4EEDA 1WYBA 5ABFB 5HWYA 2BVMA 4LF8T 4B3TT 3UUMA 2E9XD 4KHPT 5JDQA 2VVSA 1MIWA 2D5UA 1MMNA 2WM9A 3N9OA 3SQ9A 5LG3A 2LE8A 5A1LA 4UVAB 2LSJA 4PK6A 4NUUA 3NKZA 4G63A 2WNCA 1HNZT 2DWKA 3A8YC 4IL9A 3A5XA 3NVOA 2CMRA 2YU1A 3WAKA 3ZLIA 4PJLA 3GN5B 3ANWB 5JR9B 2CXFA 2EHOA 4UXNB 2VWAA 2BYPA 3OKQA 4EIWA 1IAPA 1ZKEA 1JNRA 4MFRA 5J0ZA 2V6XA 2VK9A 3GMIA 3UFEA 2WCAA 2YINA 4J2CA 2ZJVA 5HCJA 2ODUA 2I0MA 4XBFB 2VQFT 4GOUA 2IMLA 3G06A 4UF0A 5AQTB 1LVFA 4CN6A 1N34T 1W9RA 3ZMZB 2LT3A 5FXXA 1YKHB 4CN1A 5FXVA 4O4JE 2LEHA 4NUVA 3WTOA 2YN6A 4C91A 5C2TA 4YSXA 3BQKA 2V5CA 5JQGE 1WR0A 2CEAA 4PW8A 3RIFA 3ZKRA 4QX8B 3HL6A 2UUBT 4QXBB 5FY7A 4IL4A 2E9XA 3B5MA 2VURA 3ZSSA 1KNRA 4E7SA 3OJAA 5L4HA 4AKRB 3ZDHA 4HQPA 3O4XE 1FIOA 2D2SA 1L0VA 3RIUC 3DTOA 4KP3C 1W0BA 3HKEE 2XTLA 3AXJA 3P4PA 3EAMA 4AI6A 4U72A 1G73A 2WS3A 4P09A 4UVBB 3RC8A 1VCTA 3AEDA 3CX8B 3UU4A 4UR9A 5L4EA 1ZOYA 4ZI3D 4U33A 2VB6A 4HWIB 2K48A 5IUXA 5HAXA 5F8PA 4X1YE 4YJ3E 1Y64B 3VR9A 1XNQT 4LFBT 5HEGA 2H3RA 5FXZA 3AE9A 5LBMA 4EV6A 5JH7E 4IE7A 1ZP0A 2XM1A 5JREA 2ZM6T 4X5TA 4DO0A 3ZYMA 2UZ6A 3FXDB 3AE5A 2UUCT 3KV5A 1UV6A 4OK0A 4O8SA 4CI3B 2ACZA 2CBJA 3I9YA 4IHJE 2X9YA 2YMEA 1KFYA 2PG8A 4ZK1A 2K9AA 4KI0F 4B3MT 4PK5A 2N1GA 4UM3S 2Q9QD 2UUAT 3WIPA 3N9PA 4QH1A 4CN4A 3AB3B 2LM2A 4PJJA 4U74A 2IW5B 2A72A 1KF6A 4IE5A 5E0OA 5DABA 2CHOA 2LSIA 3ZCIA 1T8BA 5TVCA 1D0XA 1MMDA 2Y54A 4U7YA 3N2KE 4U2YA 2CWOA 2WN9A 3Q5DA 3WTMA 1QLBA 2W00A 4TN7B 2XJ7A 3OTOT 4KBMB 3HA4A 5HXEA 5ABEA 1CHUA 3C98B 3ZMTB 4X64T 4L0RA 1SA0E 2YU2A 4HFEA 2LHNA 2RP4A 2C5JA 5LMUT 4B3ST 5FY0A 5BW2A 4LFAT 4PIRA 3C51A 4Z90A 4DUYT 1G8XA 4ZZCA 3FHNA 2H88A 3ZPOA 4H63V 5ADXL 2BJ0A 1HG5A 2FJBA 2UXCT 2W0GA 1OEDA 2Y6XA 4QXCB 4UIGA 3RX6A 5HXRA 4QKNA 2L8KA 3SWHA 3AA1B 4U7IA 5JMEA 4I50E 2LRKA 1ZHCA 4C90A 2LM9A 4DV4T 3Q5XA 1IBKT 5AQPB 2H7OA 3PUYF 2Q9QA 3UFGA 1W0AA 5LHIB 2IDOB 3HKDE 4LMKA 2PBIA 2WNLA 1HX8A 3UUXB 5KMGP 2HH7A 1M62A 4CI2B 3T1YT 1VRBA 1YD8G 5CO5A 3VR8A 3FZHB 2X0LB 2WZYA 5AQUB 3EDVA 4IIJE 3U8MA 2FJEA 2C0SA 3N9NA 5AQVB 4YXDA 2DL1A 3O1IA 4P0AA 1QUUA 4ZOLE 5DQVA 5BP0A 3CVRA 1E2AA 4CXWA 2WWUA 4MBQA 1VOMA 1HCIA 4H9OC 3TLWA 4YTPA 2GK9A 3PUWF 2PH9A 2WWVA 3TLUA 4HFCA 1U5PA 3ONJA 1BR2A 3KVAA 1UURA 2V7JA 2BR8A 4IDQA 3DJBA 4HWHA 2M6BA 3FB2A 1T72A 2CM0A 1T7SA 2X9XA 4JEHB 4HE8A 5CB4E 2QC1B 4ZI7E 3AA7B 5HXHA 3VRBA 5L3DB 2X9HA 2X0HA 3MJXA 3ZMSB 1B7TA 3RH3A 2ES0A 2W2UA 5AFLA 1WR6A 2VL0A 3QC9A 4DNDA 3PUAA 5FNVE 2K3WA 4ZXLA 1SE7A 3EVYA 4ZI3C 3UU3A 4DBQA 4IGUA 2UXBT 3UQ7A 3UT5E 3ETVA 5FVKA 3FZFB 2Y57A 2FBWA 4F8HA 4YSZA 1HG2A 4ZZBA 4TWFA 2XQ3A 2XASB 4ZJSA 1XWMA 4U2ZA 1UX5A 5L2LA 3VKHA 5AQHB 5AQJB 3RIAA 3FZKB 1BR1A 3QUJA 2IUBA 4AKGA 1FEWA 3RC3A 5BRXA 3RIUA 2I6HA 4MLKA 2CWYA 2L9QA 2WDRA 4A5XA 2CA5A 5LGNB 3EHZA 4WNKA 5LNKA 1QSDA 3WTHA 4HGAA 4OFZA 3RHWA 5LXTE 2H7VC 4PJNA 4UV9B 3RQUA 4AQGA 2PFVA 2BG9C 3ABVA 5KX5E 4LF6T 4IE4A 4DBRA 5AQMB 4AQYT 2CLYB 4DMVA 2X00D 5AFNA 4QHOA 2LSKA 4DV6T 2VKDA 2XQ6A 4L5GA 4LMJA 3CPZA 3N5LA 2CHNA 3IEEA 2XM2A 3AE4A 4CQIA 3ZYLA 3WTKA 4UELA 4AISA 5SYOA 2WY2A 4KX6A 3IHRA 3FBZA 3I1AA 3AE3A 3LBXB 4DV2T 4ASKA 1U4QA 2WZHA 2DI4A 1X79A 4KMCA 3AAAB 1MMGA 1LRZA 4Z8XA 2LSYA 4BJMA 3O1HA 2IHR1 4EYYR 5HCMA 3LK42 2WQYA 5IWAT 5AQQB 5LA6E 1IJ5A 1KNZA 3N2OA 4FRRA 5KXJA 2WU2A 2B1EA 4BFQA 2WP9A 1YW0A 5AFUL 2NOXA 2NP9A 4XAXB 2X68A 4ZR6A 5JDLA 4OYJA 4B5DA 5HEJA 3AE2A 2R6GF 4TWDA 2DWGA 2X9WA 2NTXA 4JV5T 3NRXA 3RLFF 5CFBA 4I4TE 5HXSA 4CZZB 5IYZE 4YY3T 4JBWF 4WBOA 3E08A 2F4VT 4F6RC 4IDOA 1R8IA 4DR5T 2HHHT 2W8GA 3CMLA 3O9XA 1M7KA 4JI0T 3PUZF 4AXPA 5LGUB 4YHHT 3N9QA 2X0YA 4O2BE 2WNJA 2AXDS 5AFMA 2KMFA 1VCSA 1AJ3A 2X00A 3X1DA 5FJVA 2HN1A 1YXRA 5JR9C 2XQ4A 5AQRB 3GUAA 2W61A 2XAGB 3H3AA 4HTEA 4IREA 4ILAA 5ETWA 1WLXA 2LRLA 3C64A 1V9DA 2WDVA 1FMVA 3UQ4A 3F57A 5LOVE 3HKCE 1I6ZA 4ZEYA 2UXNB 2X66A 3KDSE 1HS7A 2EHOB 2XQAA 3C4WA 4HEAA 2XAJB 3K3NA 2XAHB 5C8YE 3E22E 3L3PA 2Z6EA 4H9NC 4DR6T 1J5ET 2XZEA 5CGMA 5M4YA 4LF7T 4JYAT 2BS4A 1ZV4X 2KSRA 4UF0B 4BAYB 4H9SE 3CX7B 4ZK4A 5AQIB 4HWDA 2CRBA 4OHFA 5JRCA 3P4RA 4UXUA 4A56A 2Y7YA 4BQTA 3UU8A 4QH5A 5LCYA 2V6YA 1T98A 4IDNA 5LP6E 3CQGB 3U78A 1UX4A 4AFTA 3F2EA 3KVBA 4TNVA 2PJQA 1UCUA 2VKOA 4Z91A 2JQHA 3P4QA 3AE6A 2MOZA 5DQWA 2BYQA 2E9XB 2Y48B 2BBJA 4LF9T 2YDSA 5AQNB
chains in the Genus database with same CATH topology
5HEHA 5J5IA 4ZZBA 3UQ4A 4TWFA 1OEDE 2XQ3A 5HCMA 2WZYA 1I9BA 4EZ1A 4ZJSA 3U8MA 3PMZA 2XQ9A 5AFMB 5AINA 4HFHA 3WTJA 4ILBA 3U8NA 2BG9A 3SQ6A 4HFEA 3LSVA 3RI5A 2XQAA 3C79A 4FRRA 5HEGA 2BYSA 3U8KA 5BP0A 5BW2A 5HEUA 4LMLA 4BFQA 4WV9A 4PIRA 4UM1A 3RIAA 3SH1A 4X5TA 4Z90A 3UUBA 4XHEA 2MAWA 4ZZCA 2YMDA 3PEOA 4XK9A 3P4WA 3UU6A 2YN6A 2UZ6A 2XZ6A 2YOEA 3TLWA 3C84A 4QH4A 4ZR6A 3WTOA 4B5DA 5HEJA 4TNWA 4UM3P 2PH9A 5BRXA 2PGZA 3ZDGA 2XQ7A 4TWDA 3JAFA 3TLUA 2BJ0A 3WTNA 5AFJA 4HFCA 4TWHA 2BR7A 4NZBA 4NPPA 1UV6A 4UM3A 5CFBA 1OEDA 3JAEA 4HFIA 3RIFA 3ZKRA 5AFHA 4UY2A 3TLVA 3EHZA 4QAAA 2KSRA 5KE4A 2BG9B 3JADA 2BR8A 2YMEA 3SQ9A 3WTHA 5LG3A 5LXBA 4ZK4A 4IL4A 3TLTA 3SIOA 3WTIA 3U8LA 4ZK1A 5KZUA 3RHWA 2W8GA 2M6BA 3RQUA 2XNTA 2BG9C 4ALXA 1UW6A 2XNVA 2WNCA 2M6IA 4D01A 2QC1B 4UXUA 3U8JA 3EI0A 2XYTA 2Y7YA 4BQTA 4UM3S 3UU8A 4QH5A 4IL9A 2BYNA 3T4MA 2X00D 5AFNA 3P50A 3WIPA 2BYRA 2XNUA 4QH1A 2XQ6A 4HFDA 5J5GA 3WTLA 4LMJA 5JMEA 3RQWA 2LM2A 5L4HA 2XYSA 4A97A 2LKGA 4ZRUA 3WTKA 3ZDHA 5AFLA 3TLSA 4AFHA 2BG9E 2WNJA 4HQPA 4AFTA 5AFMA 4A98A 2VL0A 4TNVA 2ZJUA 4COFA 5TVCA 2Y54A 1OEDB 2W8FA 5SYOA 4QACA 5HEOA 2X00A 4Z91A 5FJVA 2BYPA 4ZJTA 2XQ4A 2WN9A 3GUAA 4QABA 2LLYA 1OEDC 3EAMA 3WTMA 2C9TA 3UU5A 4IREA 5AFKA 4LMKA 3UU3A 2BYQA 4AFGA 2Y58A 5J5FA 4ILAA 5J0ZA 2XZ5A 3UQ7A 2WNLA 1UX2A 2LKHA 4DBMA 3UU4A 4ILCA 5L4EA 2XQ8A 4HFBA 2XQ5A 3IGQA 2Y57A 2YKSA 2Y56A 5J5HA 2ZJVA 5IUXA 5CO5A 5L47A 5HCJA 4F8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEH A;  5J5I A;  4ZZB A;  3UQ4 A;  4TWF A;  1OED E;  2XQ3 A;  5HCM A;  2WZY A;  1I9B A;  4EZ1 A;  4ZJS A;  3U8M A;  3PMZ A;  2XQ9 A;  5AFM B;  5AIN A;  4HFH A;  3WTJ A;  4ILB A;  3U8N A;  2BG9 A;  3SQ6 A;  4HFE A;  3LSV A;  3RI5 A;  2XQA A;  3C79 A;  4FRR A;  5HEG A;  2BYS A;  3U8K A;  5BP0 A;  5BW2 A;  5HEU A;  4LML A;  4BFQ A;  4WV9 A;  4PIR A;  4UM1 A;  3RIA A;  3SH1 A;  4X5T A;  4Z90 A;  3UUB A;  4XHE A;  2MAW A;  4ZZC A;  2YMD A;  3PEO A;  4XK9 A;  3P4W A;  3UU6 A;  2YN6 A;  2UZ6 A;  2XZ6 A;  2YOE A;  3TLW A;  3C84 A;  4QH4 A;  4ZR6 A;  3WTO A;  4B5D A;  5HEJ A;  4TNW A;  4UM3 P;  2PH9 A;  5BRX A;  2PGZ A;  3ZDG A;  2XQ7 A;  4TWD A;  3JAF A;  3TLU A;  2BJ0 A;  3WTN A;  5AFJ A;  4HFC A;  4TWH A;  2BR7 A;  4NZB A;  4NPP A;  1UV6 A;  4UM3 A;  5CFB A;  1OED A;  3JAE A;  4HFI A;  3RIF A;  3ZKR A;  5AFH A;  4UY2 A;  3TLV A;  3EHZ A;  4QAA A;  2KSR A;  5KE4 A;  2BG9 B;  3JAD A;  2BR8 A;  2YME A;  3SQ9 A;  3WTH A;  5LG3 A;  5LXB A;  4ZK4 A;  4IL4 A;  3TLT A;  3SIO A;  3WTI A;  3U8L A;  4ZK1 A;  5KZU A;  3RHW A;  2W8G A;  2M6B A;  3RQU A;  2XNT A;  2BG9 C;  4ALX A;  1UW6 A;  2XNV A;  2WNC A;  2M6I A;  4D01 A;  2QC1 B;  4UXU A;  3U8J A;  3EI0 A;  2XYT A;  2Y7Y A;  4BQT A;  4UM3 S;  3UU8 A;  4QH5 A;  4IL9 A;  2BYN A;  3T4M A;  2X00 D;  5AFN A;  3P50 A;  3WIP A;  2BYR A;  2XNU A;  4QH1 A;  2XQ6 A;  4HFD A;  5J5G A;  3WTL A;  4LMJ A;  5JME A;  3RQW A;  2LM2 A;  5L4H A;  2XYS A;  4A97 A;  2LKG A;  4ZRU A;  3WTK A;  3ZDH A;  5AFL A;  3TLS A;  4AFH A;  2BG9 E;  2WNJ A;  4HQP A;  4AFT A;  5AFM A;  4A98 A;  2VL0 A;  4TNV A;  2ZJU A;  4COF A;  5TVC A;  2Y54 A;  1OED B;  2W8F A;  5SYO A;  4QAC A;  5HEO A;  2X00 A;  4Z91 A;  5FJV A;  2BYP A;  4ZJT A;  2XQ4 A;  2WN9 A;  3GUA A;  4QAB A;  2LLY A;  1OED C;  3EAM A;  3WTM A;  2C9T A;  3UU5 A;  4IRE A;  5AFK A;  4LMK A;  3UU3 A;  2BYQ A;  4AFG A;  2Y58 A;  5J5F A;  4ILA A;  5J0Z A;  2XZ5 A;  3UQ7 A;  2WNL A;  1UX2 A;  2LKH A;  4DBM A;  3UU4 A;  4ILC A;  5L4E A;  2XQ8 A;  4HFB A;  2XQ5 A;  3IGQ A;  2Y57 A;  2YKS A;  2Y56 A;  5J5H A;  2ZJV A;  5IUX A;  5CO5 A;  5L47 A;  5HCJ A;  4F8H A; 
#chains in the Genus database with same CATH topology
 5HEH A;  5J5I A;  4H63 H;  2MBG A;  3M65 A;  3L8R A;  3SRZ A;  1I9B A;  4YLH A;  2XQY A;  3K8P C;  1XDP A;  1Z0P A;  2E2A A;  2UXD T;  4O4H E;  4UV8 B;  1HR0 T;  3LK3 B;  3ZST A;  3IF8 B;  2KWI B;  5EK4 A;  3KV6 A;  2C5I T;  2YEV C;  2FUP A;  3AXJ B;  4AQF C;  4UM1 A;  2KIN B;  4IDZ A;  5LB7 B;  2XAF B;  4B3R T;  4PK4 A;  3PEO A;  4WBN E;  3AE8 A;  4YSY A;  4TNW A;  5AQF B;  3UUL A;  5JDH A;  2AE9 A;  4HN9 A;  4NPP A;  3RF1 A;  4UM3 A;  3JAE A;  3KIN B;  4GK5 E;  4HFI A;  5AFH A;  1MIY A;  4YFS A;  1E7P A;  1E1H B;  3TLT A;  5EZY E;  3ZT6 A;  2NWB A;  3B13 A;  4H9Q C;  4PNI A;  4FJO A;  3AAE B;  2V7I A;  4YT0 A;  4D01 A;  4TUY E;  2WZI A;  4DR3 T;  4HFD A;  3AEE A;  3J9X 1;  3MXZ A;  3ETU A;  1US7 B;  4COF A;  2W8F A;  5FP3 A;  1D1A A;  3PUR A;  4CI1 B;  4M1P A;  2WAU A;  4AFG A;  2Y58 A;  3AAI A;  1BR4 A;  4HFB A;  2XQ5 A;  2YKS A;  5J2U E;  3LDQ B;  1OED E;  4JI8 T;  5JDF A;  3I0Q A;  3PMZ A;  3K3Q C;  2W67 A;  3UUN A;  2BG9 A;  1MND A;  2IC6 A;  5GON E;  3K3O A;  5HEU A;  4EB6 E;  2BBH A;  2KXP B;  4JI7 T;  4E7Z A;  2DHR A;  3UUB A;  2HN2 A;  1WCR A;  4DV1 T;  3HI2 A;  3S4U A;  2PGZ A;  2PTF A;  2XQ7 A;  2QA7 A;  3JC6 D;  2W62 A;  4EZH A;  5HXC A;  5F3J A;  4YJ2 E;  2DLR A;  4UY2 A;  3ZEF B;  1GQE A;  4EYU A;  5LXB A;  2V7M A;  3PE0 A;  4QWN B;  2BKP A;  5JDG A;  2W4X A;  1LVK A;  3AEA A;  2BKN A;  4ISS A;  4Q25 A;  2BS2 A;  2UXX B;  3T4M A;  3NZQ A;  3P4S A;  5J5G A;  3CIR A;  4A97 A;  2J47 A;  3VU7 H;  3ZMU B;  4TV8 E;  2HPL A;  3KV4 A;  1OED B;  2CBI A;  4JI4 T;  2B76 A;  4ZJT A;  2J4G A;  4DVD A;  3QOF A;  3UU5 A;  1W09 A;  1OWA A;  3ZT7 A;  3PTR B;  5ABF A;  1UX2 A;  4DBM A;  4EOZ B;  2XQ8 A;  5LMN T;  5J5H A;  2ZM0 A;  2OLT A;  2FJD A;  4G2A A;  3GA8 A;  5LHH B;  5IHY A;  3F31 A;  1Y01 A;  2W66 A;  2YDR A;  2LSG A;  4ILB A;  2IIU A;  2Q9Q B;  1WRD A;  3SH1 A;  4JLE A;  2E5V A;  5HYA A;  5ABH A;  4QH4 A;  3PJA J;  4ILU A;  2EHO D;  3ZDG A;  2RPA A;  2OV9 A;  3J7Y q;  3GN5 A;  1FMW A;  2BVL A;  5CA1 E;  4NZB A;  4DV3 T;  3ANW A;  5JR9 A;  2J1D G;  2P9B A;  3TLV A;  3IA3 A;  4JI3 T;  3AEB A;  5LBQ B;  5AQO B;  5JDN A;  5JTG A;  1XZY A;  2XNT A;  2HPJ A;  3AEG A;  3RYH E;  3VHL A;  1J1J A;  2CXL A;  5JDM A;  1YKE B;  4H9P C;  3RKO A;  5BMV E;  3C4X A;  4N78 D;  4DR7 T;  5EK2 A;  4NXN T;  1N33 T;  5KDM C;  3FZL B;  2I59 A;  5FXW A;  3N9M A;  1HX1 B;  4GK0 E;  5HEO A;  1Z8U A;  2VVN A;  5JVD E;  2C9T A;  3ZJ2 A;  4EAH A;  4P0B A;  3KV9 A;  1WYC A;  1HNX T;  2LJL A;  3C50 A;  4I43 B;  2KND A;  2BKO A;  3HKB E;  3BQL A;  2YK0 A;  4ERR A;  4IE0 A;  1N36 T;  4JI2 T;  3AVS A;  2BZB A;  2XQ9 A;  4K0U A;  2N2N A;  3WTJ A;  4IST A;  4I0U A;  2M67 A;  3LSV A;  3OVU A;  1S94 A;  3WAJ A;  3ZN1 B;  2KT9 A;  4EXT A;  2JMH A;  5LG4 A;  1XMO T;  2QRX A;  3QB5 A;  4YTN A;  3CQX C;  2BDE A;  3Q5W A;  4XK9 A;  4PAG A;  2XZ6 A;  3PU8 A;  2YOE A;  4B6X A;  3MA9 A;  4JI5 T;  3ZCJ A;  5FYM A;  3VKG A;  1IZN B;  2JQQ A;  2X51 A;  3T8O A;  3MZK B;  3Q9D A;  4UEM A;  3WTN A;  5AFJ A;  2JMK A;  4TWH A;  1KK7 A;  4XZC A;  3CX6 B;  3OBV E;  4DUZ T;  5FL1 A;  5L3F B;  3U8L A;  1I94 T;  1OXZ A;  1H7C A;  2N9D A;  2MPK A;  3VRA A;  3EI0 A;  2XYT A;  4LF5 T;  3AA0 B;  3O1J A;  4HWC A;  5L3G B;  5F5W A;  3LFM A;  2CLY C;  3KFW X;  4PJM A;  3ZT5 A;  2K5B B;  2LKG A;  2XSA A;  4AFH A;  3PUQ A;  4A98 A;  2NR4 A;  4O4L E;  4X1K E;  3Q2M A;  2D0U A;  4K0K T;  4AQF A;  4QAC A;  3V5U A;  5AFK A;  3N9L A;  3PUG A;  5J5F A;  2D9D A;  4I55 E;  4ZHQ E;  2E8I A;  1HF8 A;  5C3J A;  2LKH A;  4YTM A;  2CE7 A;  4TZ4 C;  2J62 A;  2OA5 A;  3FBL A;  2DCF A;  4DR2 T;  4WYV A;  4TX5 A;  4EZ1 A;  1FJG T;  2L3L A;  4BJN A;  4X20 E;  3AVR A;  5H6Q B;  3PU3 A;  4H9R C;  5TAO A;  1KNP A;  2WDQ A;  4DMW A;  5CA0 E;  3PV0 F;  5ABG A;  3BQI A;  2K24 A;  3JC6 C;  5FL0 A;  5AQG B;  4GIW A;  3P4W A;  1HFA A;  2XPK A;  3CWZ B;  3CQC B;  1S35 A;  1LKX A;  3NZP A;  2CXD A;  4U3C A;  2VQE T;  4UM3 P;  5LHG B;  3ZMV B;  2QGS A;  3L39 A;  4DR4 T;  4GKK T;  3SIO A;  3AEC A;  4AIU A;  2C5K T;  3AE1 A;  3H3M A;  3M3Z B;  3PUV F;  5AQL B;  4FI5 A;  3LG7 A;  3OYZ A;  3ONX A;  3P50 A;  4DV5 T;  2XNU A;  3PDY A;  1D1B A;  2QYW A;  3E0Z A;  4ZRU A;  3ZYK A;  4LFC T;  2LHR A;  4BA9 A;  4ADZ A;  2IC9 A;  3EAB A;  4PFP A;  2LLY A;  1D1C A;  3NBX X;  1KEY A;  3L09 A;  3EDU A;  5EK3 A;  3ESL A;  5J2T E;  4JEU B;  2V7K A;  3JCF A;  4ILC A;  5H6R B;  1IBM T;  2XAQ B;  2NW7 A;  4EEB A;  3BK9 A;  4AKH A;  2JIW A;  3KBT A;  2WMO A;  4QX7 B;  4V1A v;  5LJN A;  5AFM B;  2FJA A;  4PFO A;  1IBL T;  1IJ6 A;  2DNX A;  3N2G E;  1EZ3 A;  4KHZ F;  5J1G A;  4LML A;  2EHO C;  4UVC B;  4DV0 T;  2MTQ A;  3P8C D;  3CK6 A;  2YMD A;  3R6N A;  3RRC A;  4ZI2 D;  4GKJ T;  4HFV A;  3LK2 B;  3B57 A;  2BR7 A;  1UK5 A;  4LF4 T;  3R84 B;  2CCQ A;  4CXX A;  5FY1 A;  1UUS A;  1YQ3 A;  4DR1 T;  4IE6 A;  2ODV A;  3CKD A;  4X1I E;  2IAK A;  2XNV A;  5FMN A;  2JQK A;  2XHE B;  2BYN A;  1MIV A;  3C4Z A;  2LOS A;  2QVA A;  3I9W A;  1HNW T;  3RQW A;  2WSS V;  2E5L T;  5HWX A;  2JQ9 A;  2JPF A;  4WZX A;  3LJC A;  3SS1 A;  3ZJ1 A;  4AKL A;  1UGO A;  2VL8 A;  2ZJU A;  2VAS A;  4TV9 E;  3MKD A;  2V8S V;  3NRY A;  2VKH A;  4QAB A;  2ZM2 A;  5L3C B;  2RA1 A;  3OPC A;  4IDP A;  3MK7 C;  1NWM X;  1DU2 A;  1WFD A;  5JRC B;  2V1D B;  2WB5 A;  1MNE A;  2E9X C;  2KZ7 B;  4P1N A;  3ZC0 A;  2V6Y B;  3W15 B;  3FZM B;  5L47 A;  3UTK A;  3DP7 A;  4ZS3 A;  1SHZ C;  5AIN A;  4HFH A;  4HWF A;  4QXH B;  3RYF E;  3K1S A;  4ANJ A;  3C79 A;  5AQS B;  4L9I A;  1HTJ F;  2A2F X;  2NW8 A;  4YHJ A;  2MYS A;  1NEN A;  4XHE A;  3I0O A;  3P7I A;  4GYR A;  2YDQ A;  3QB5 K;  1BR0 A;  1MMA A;  4X62 T;  2XSB A;  3QK6 A;  3WI3 A;  2A9U A;  3JAF A;  2NTY A;  4JI6 T;  3AA6 B;  4WW0 A;  5FVL A;  3NWI A;  1CUN A;  3WTI A;  5KZU A;  5DJQ C;  4JUY A;  3PUX F;  4NXM T;  4ALX A;  1SUM B;  3RRW A;  1NAF A;  5LYJ E;  2WMN A;  3FXE B;  2KWH A;  2CPT A;  4MHC A;  2XYS A;  2JRK A;  2G0U A;  1JNZ A;  3TLS A;  2WBL A;  2BG9 E;  2KLQ A;  3ZN0 B;  1D0Y A;  1ZEE A;  5AQK B;  2Y8D A;  2ZLY A;  4IT4 A;  4JI1 T;  2WU5 A;  1XNR T;  4U31 A;  3EUH A;  2XZ5 A;  1J5W A;  4OX9 T;  3TKL B;  4X65 T;  5L3B B;  3IGQ A;  2NW9 A;  1XDO A;  4DV7 T;  2Y56 A;  2XUE A;  5FKY A;  4DID B;  2ZM8 A;  4AKI A;  3SQ6 A;  3RI5 A;  3U8K A;  1YQ4 A;  4NIQ A;  3SFE A;  4WV9 A;  2SPC A;  1D0Z A;  4EZ4 A;  3SFD A;  1N32 T;  3QNU A;  3RGL A;  3UU6 A;  3RYI E;  3C84 A;  3RKG A;  3U3I A;  1XMQ T;  4GYS A;  2ZMA A;  4CXY A;  1X9B A;  4QAA A;  3D0T A;  2V26 A;  5KE4 A;  2BG9 B;  3JAD A;  1O3X A;  3LBX A;  3Q5E A;  1UW6 A;  3T1H T;  2M6I A;  2W63 A;  4X66 T;  3U8J A;  4OYK A;  3PUS A;  4O4I E;  2A3D A;  4O2A E;  3IBP A;  2UU9 T;  5CJ5 A;  2H89 A;  2LOP A;  3AE7 A;  2BYR A;  3WTL A;  4ZS2 A;  5LJM A;  4HKA A;  3PJA A;  1OED C;  5L3E B;  3RPU A;  2V7L A;  3AEF A;  2V5D A;  3A7M A;  3KBU A;  2BS3 A;  2D0T A;  3OYX A;  3H37 A;  3SOL A;  3HR0 A;  2ACX A;  3MAC A;  5BR8 T;  2JJ9 A;  5LGT B;  3U8N A;  2VKJ A;  2BYS A;  3ZC1 A;  2XY8 B;  3V5S A;  4KUM B;  3ONL C;  2X67 A;  4MAL A;  4ZI2 C;  1NEK A;  2Q9Q C;  4EGW A;  3GWH A;  3RYC E;  2MAW A;  4EED A;  1WYB A;  5ABF B;  5HWY A;  2BVM A;  4LF8 T;  4B3T T;  3UUM A;  2E9X D;  4KHP T;  5JDQ A;  2VVS A;  1MIW A;  2D5U A;  1MMN A;  2WM9 A;  3N9O A;  3SQ9 A;  5LG3 A;  2LE8 A;  5A1L A;  4UVA B;  2LSJ A;  4PK6 A;  4NUU A;  3NKZ A;  4G63 A;  2WNC A;  1HNZ T;  2DWK A;  3A8Y C;  4IL9 A;  3A5X A;  3NVO A;  2CMR A;  2YU1 A;  3WAK A;  3ZLI A;  4PJL A;  3GN5 B;  3ANW B;  5JR9 B;  2CXF A;  2EHO A;  4UXN B;  2VWA A;  2BYP A;  3OKQ A;  4EIW A;  1IAP A;  1ZKE A;  1JNR A;  4MFR A;  5J0Z A;  2V6X A;  2VK9 A;  3GMI A;  3UFE A;  2WCA A;  2YIN A;  4J2C A;  2ZJV A;  5HCJ A;  2ODU A;  2I0M A;  4XBF B;  2VQF T;  4GOU A;  2IML A;  3G06 A;  4UF0 A;  5AQT B;  1LVF A;  4CN6 A;  1N34 T;  1W9R A;  3ZMZ B;  2LT3 A;  5FXX A;  1YKH B;  4CN1 A;  5FXV A;  4O4J E;  2LEH A;  4NUV A;  3WTO A;  2YN6 A;  4C91 A;  5C2T A;  4YSX A;  3BQK A;  2V5C A;  5JQG E;  1WR0 A;  2CEA A;  4PW8 A;  3RIF A;  3ZKR A;  4QX8 B;  3HL6 A;  2UUB T;  4QXB B;  5FY7 A;  4IL4 A;  2E9X A;  3B5M A;  2VUR A;  3ZSS A;  1KNR A;  4E7S A;  3OJA A;  5L4H A;  4AKR B;  3ZDH A;  4HQP A;  3O4X E;  1FIO A;  2D2S A;  1L0V A;  3RIU C;  3DTO A;  4KP3 C;  1W0B A;  3HKE E;  2XTL A;  3AXJ A;  3P4P A;  3EAM A;  4AI6 A;  4U72 A;  1G73 A;  2WS3 A;  4P09 A;  4UVB B;  3RC8 A;  1VCT A;  3AED A;  3CX8 B;  3UU4 A;  4UR9 A;  5L4E A;  1ZOY A;  4ZI3 D;  4U33 A;  2VB6 A;  4HWI B;  2K48 A;  5IUX A;  5HAX A;  5F8P A;  4X1Y E;  4YJ3 E;  1Y64 B;  3VR9 A;  1XNQ T;  4LFB T;  5HEG A;  2H3R A;  5FXZ A;  3AE9 A;  5LBM A;  4EV6 A;  5JH7 E;  4IE7 A;  1ZP0 A;  2XM1 A;  5JRE A;  2ZM6 T;  4X5T A;  4DO0 A;  3ZYM A;  2UZ6 A;  3FXD B;  3AE5 A;  2UUC T;  3KV5 A;  1UV6 A;  4OK0 A;  4O8S A;  4CI3 B;  2ACZ A;  2CBJ A;  3I9Y A;  4IHJ E;  2X9Y A;  2YME A;  1KFY A;  2PG8 A;  4ZK1 A;  2K9A A;  4KI0 F;  4B3M T;  4PK5 A;  2N1G A;  4UM3 S;  2Q9Q D;  2UUA T;  3WIP A;  3N9P A;  4QH1 A;  4CN4 A;  3AB3 B;  2LM2 A;  4PJJ A;  4U74 A;  2IW5 B;  2A72 A;  1KF6 A;  4IE5 A;  5E0O A;  5DAB A;  2CHO A;  2LSI A;  3ZCI A;  1T8B A;  5TVC A;  1D0X A;  1MMD A;  2Y54 A;  4U7Y A;  3N2K E;  4U2Y A;  2CWO A;  2WN9 A;  3Q5D A;  3WTM A;  1QLB A;  2W00 A;  4TN7 B;  2XJ7 A;  3OTO T;  4KBM B;  3HA4 A;  5HXE A;  5ABE A;  1CHU A;  3C98 B;  3ZMT B;  4X64 T;  4L0R A;  1SA0 E;  2YU2 A;  4HFE A;  2LHN A;  2RP4 A;  2C5J A;  5LMU T;  4B3S T;  5FY0 A;  5BW2 A;  4LFA T;  4PIR A;  3C51 A;  4Z90 A;  4DUY T;  1G8X A;  4ZZC A;  3FHN A;  2H88 A;  3ZPO A;  4H63 V;  5ADX L;  2BJ0 A;  1HG5 A;  2FJB A;  2UXC T;  2W0G A;  1OED A;  2Y6X A;  4QXC B;  4UIG A;  3RX6 A;  5HXR A;  4QKN A;  2L8K A;  3SWH A;  3AA1 B;  4U7I A;  5JME A;  4I50 E;  2LRK A;  1ZHC A;  4C90 A;  2LM9 A;  4DV4 T;  3Q5X A;  1IBK T;  5AQP B;  2H7O A;  3PUY F;  2Q9Q A;  3UFG A;  1W0A A;  5LHI B;  2IDO B;  3HKD E;  4LMK A;  2PBI A;  2WNL A;  1HX8 A;  3UUX B;  5KMG P;  2HH7 A;  1M62 A;  4CI2 B;  3T1Y T;  1VRB A;  1YD8 G;  5CO5 A;  3VR8 A;  3FZH B;  2X0L B;  2WZY A;  5AQU B;  3EDV A;  4IIJ E;  3U8M A;  2FJE A;  2C0S A;  3N9N A;  5AQV B;  4YXD A;  2DL1 A;  3O1I A;  4P0A A;  1QUU A;  4ZOL E;  5DQV A;  5BP0 A;  3CVR A;  1E2A A;  4CXW A;  2WWU A;  4MBQ A;  1VOM A;  1HCI A;  4H9O C;  3TLW A;  4YTP A;  2GK9 A;  3PUW F;  2PH9 A;  2WWV A;  3TLU A;  4HFC A;  1U5P A;  3ONJ A;  1BR2 A;  3KVA A;  1UUR A;  2V7J A;  2BR8 A;  4IDQ A;  3DJB A;  4HWH A;  2M6B A;  3FB2 A;  1T72 A;  2CM0 A;  1T7S A;  2X9X A;  4JEH B;  4HE8 A;  5CB4 E;  2QC1 B;  4ZI7 E;  3AA7 B;  5HXH A;  3VRB A;  5L3D B;  2X9H A;  2X0H A;  3MJX A;  3ZMS B;  1B7T A;  3RH3 A;  2ES0 A;  2W2U A;  5AFL A;  1WR6 A;  2VL0 A;  3QC9 A;  4DND A;  3PUA A;  5FNV E;  2K3W A;  4ZXL A;  1SE7 A;  3EVY A;  4ZI3 C;  3UU3 A;  4DBQ A;  4IGU A;  2UXB T;  3UQ7 A;  3UT5 E;  3ETV A;  5FVK A;  3FZF B;  2Y57 A;  2FBW A;  4F8H A;  4YSZ A;  1HG2 A;  4ZZB A;  4TWF A;  2XQ3 A;  2XAS B;  4ZJS A;  1XWM A;  4U2Z A;  1UX5 A;  5L2L A;  3VKH A;  5AQH B;  5AQJ B;  3RIA A;  3FZK B;  1BR1 A;  3QUJ A;  2IUB A;  4AKG A;  1FEW A;  3RC3 A;  5BRX A;  3RIU A;  2I6H A;  4MLK A;  2CWY A;  2L9Q A;  2WDR A;  4A5X A;  2CA5 A;  5LGN B;  3EHZ A;  4WNK A;  5LNK A;  1QSD A;  3WTH A;  4HGA A;  4OFZ A;  3RHW A;  5LXT E;  2H7V C;  4PJN A;  4UV9 B;  3RQU A;  4AQG A;  2PFV A;  2BG9 C;  3ABV A;  5KX5 E;  4LF6 T;  4IE4 A;  4DBR A;  5AQM B;  4AQY T;  2CLY B;  4DMV A;  2X00 D;  5AFN A;  4QHO A;  2LSK A;  4DV6 T;  2VKD A;  2XQ6 A;  4L5G A;  4LMJ A;  3CPZ A;  3N5L A;  2CHN A;  3IEE A;  2XM2 A;  3AE4 A;  4CQI A;  3ZYL A;  3WTK A;  4UEL A;  4AIS A;  5SYO A;  2WY2 A;  4KX6 A;  3IHR A;  3FBZ A;  3I1A A;  3AE3 A;  3LBX B;  4DV2 T;  4ASK A;  1U4Q A;  2WZH A;  2DI4 A;  1X79 A;  4KMC A;  3AAA B;  1MMG A;  1LRZ A;  4Z8X A;  2LSY A;  4BJM A;  3O1H A;  2IHR 1;  4EYY R;  5HCM A;  3LK4 2;  2WQY A;  5IWA T;  5AQQ B;  5LA6 E;  1IJ5 A;  1KNZ A;  3N2O A;  4FRR A;  5KXJ A;  2WU2 A;  2B1E A;  4BFQ A;  2WP9 A;  1YW0 A;  5AFU L;  2NOX A;  2NP9 A;  4XAX B;  2X68 A;  4ZR6 A;  5JDL A;  4OYJ A;  4B5D A;  5HEJ A;  3AE2 A;  2R6G F;  4TWD A;  2DWG A;  2X9W A;  2NTX A;  4JV5 T;  3NRX A;  3RLF F;  5CFB A;  4I4T E;  5HXS A;  4CZZ B;  5IYZ E;  4YY3 T;  4JBW F;  4WBO A;  3E08 A;  2F4V T;  4F6R C;  4IDO A;  1R8I A;  4DR5 T;  2HHH T;  2W8G A;  3CML A;  3O9X A;  1M7K A;  4JI0 T;  3PUZ F;  4AXP A;  5LGU B;  4YHH T;  3N9Q A;  2X0Y A;  4O2B E;  2WNJ A;  2AXD S;  5AFM A;  2KMF A;  1VCS A;  1AJ3 A;  2X00 A;  3X1D A;  5FJV A;  2HN1 A;  1YXR A;  5JR9 C;  2XQ4 A;  5AQR B;  3GUA A;  2W61 A;  2XAG B;  3H3A A;  4HTE A;  4IRE A;  4ILA A;  5ETW A;  1WLX A;  2LRL A;  3C64 A;  1V9D A;  2WDV A;  1FMV A;  3UQ4 A;  3F57 A;  5LOV E;  3HKC E;  1I6Z A;  4ZEY A;  2UXN B;  2X66 A;  3KDS E;  1HS7 A;  2EHO B;  2XQA A;  3C4W A;  4HEA A;  2XAJ B;  3K3N A;  2XAH B;  5C8Y E;  3E22 E;  3L3P A;  2Z6E A;  4H9N C;  4DR6 T;  1J5E T;  2XZE A;  5CGM A;  5M4Y A;  4LF7 T;  4JYA T;  2BS4 A;  1ZV4 X;  2KSR A;  4UF0 B;  4BAY B;  4H9S E;  3CX7 B;  4ZK4 A;  5AQI B;  4HWD A;  2CRB A;  4OHF A;  5JRC A;  3P4R A;  4UXU A;  4A56 A;  2Y7Y A;  4BQT A;  3UU8 A;  4QH5 A;  5LCY A;  2V6Y A;  1T98 A;  4IDN A;  5LP6 E;  3CQG B;  3U78 A;  1UX4 A;  4AFT A;  3F2E A;  3KVB A;  4TNV A;  2PJQ A;  1UCU A;  2VKO A;  4Z91 A;  2JQH A;  3P4Q A;  3AE6 A;  2MOZ A;  5DQW A;  2BYQ A;  2E9X B;  2Y48 B;  2BBJ A;  4LF9 T;  2YDS A;  5AQN B; 
#chains in the Genus database with same CATH homology
 5HEH A;  5J5I A;  4ZZB A;  3UQ4 A;  4TWF A;  1OED E;  2XQ3 A;  5HCM A;  2WZY A;  1I9B A;  4EZ1 A;  4ZJS A;  3U8M A;  3PMZ A;  2XQ9 A;  5AFM B;  5AIN A;  4HFH A;  3WTJ A;  4ILB A;  3U8N A;  2BG9 A;  3SQ6 A;  4HFE A;  3LSV A;  3RI5 A;  2XQA A;  3C79 A;  4FRR A;  5HEG A;  2BYS A;  3U8K A;  5BP0 A;  5BW2 A;  5HEU A;  4LML A;  4BFQ A;  4WV9 A;  4PIR A;  4UM1 A;  3RIA A;  3SH1 A;  4X5T A;  4Z90 A;  3UUB A;  4XHE A;  2MAW A;  4ZZC A;  2YMD A;  3PEO A;  4XK9 A;  3P4W A;  3UU6 A;  2YN6 A;  2UZ6 A;  2XZ6 A;  2YOE A;  3TLW A;  3C84 A;  4QH4 A;  4ZR6 A;  3WTO A;  4B5D A;  5HEJ A;  4TNW A;  4UM3 P;  2PH9 A;  5BRX A;  2PGZ A;  3ZDG A;  2XQ7 A;  4TWD A;  3JAF A;  3TLU A;  2BJ0 A;  3WTN A;  5AFJ A;  4HFC A;  4TWH A;  2BR7 A;  4NZB A;  4NPP A;  1UV6 A;  4UM3 A;  5CFB A;  1OED A;  3JAE A;  4HFI A;  3RIF A;  3ZKR A;  5AFH A;  4UY2 A;  3TLV A;  3EHZ A;  4QAA A;  2KSR A;  5KE4 A;  2BG9 B;  3JAD A;  2BR8 A;  2YME A;  3SQ9 A;  3WTH A;  5LG3 A;  5LXB A;  4ZK4 A;  4IL4 A;  3TLT A;  3SIO A;  3WTI A;  3U8L A;  4ZK1 A;  5KZU A;  3RHW A;  2W8G A;  2M6B A;  3RQU A;  2XNT A;  2BG9 C;  4ALX A;  1UW6 A;  2XNV A;  2WNC A;  2M6I A;  4D01 A;  2QC1 B;  4UXU A;  3U8J A;  3EI0 A;  2XYT A;  2Y7Y A;  4BQT A;  4UM3 S;  3UU8 A;  4QH5 A;  4IL9 A;  2BYN A;  3T4M A;  2X00 D;  5AFN A;  3P50 A;  3WIP A;  2BYR A;  2XNU A;  4QH1 A;  2XQ6 A;  4HFD A;  5J5G A;  3WTL A;  4LMJ A;  5JME A;  3RQW A;  2LM2 A;  5L4H A;  2XYS A;  4A97 A;  2LKG A;  4ZRU A;  3WTK A;  3ZDH A;  5AFL A;  3TLS A;  4AFH A;  2BG9 E;  2WNJ A;  4HQP A;  4AFT A;  5AFM A;  4A98 A;  2VL0 A;  4TNV A;  2ZJU A;  4COF A;  5TVC A;  2Y54 A;  1OED B;  2W8F A;  5SYO A;  4QAC A;  5HEO A;  2X00 A;  4Z91 A;  5FJV A;  2BYP A;  4ZJT A;  2XQ4 A;  2WN9 A;  3GUA A;  4QAB A;  2LLY A;  1OED C;  3EAM A;  3WTM A;  2C9T A;  3UU5 A;  4IRE A;  5AFK A;  4LMK A;  3UU3 A;  2BYQ A;  4AFG A;  2Y58 A;  5J5F A;  4ILA A;  5J0Z A;  2XZ5 A;  3UQ7 A;  2WNL A;  1UX2 A;  2LKH A;  4DBM A;  3UU4 A;  4ILC A;  5L4E A;  2XQ8 A;  4HFB A;  2XQ5 A;  3IGQ A;  2Y57 A;  2YKS A;  2Y56 A;  5J5H A;  2ZJV A;  5IUX A;  5CO5 A;  5L47 A;  5HCJ A;  4F8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...