5J0ZA

Crystal structure of glic in complex with dha
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of membrane protein.
rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Membrane protein
molecule keywords Proton-gated ion channel
total genus 87
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5j0zA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j0zA01
2LKHA 2BG9A 3RI5A 5AFJA 2XQ9A 4ALXA 3LSVA 3UU6A 3C79A 4TNWA 2XNVA 4UM1A 2BR8A 2WN9A 3WTIA 5BP0A 5L47A 2XZ5A 5HCJA 4D01A 2PGZA 5IUXA 1UW6A 4AFHA 4HFDA 2YMDA 2WNLA 3WTNA 4HFBA 2BG9B 4XHEA 4QABA 3U8KA 2XQ5A 3RQUA 4A97A 5J5IA 4LMLA 5AFHA 1UV6A 5HEOA 5L4HA 2X00D 5BW2A 3P50A 3JADA 4HFCA 5AFKA 3GUAA 4HQPA 4IREA 4EZ1A 3EHZA 1OEDA 4QACA 4QH4A 3UU5A 4ZK1A 2BYRA 5AFMB 4AFTA 3TLTA 4NPPA 2BR7A 2ZJVA 5HEGA 5AFNA 4LMKA 2YN6A 5SYOA 4PIRA 5J5GA 4UXUA 4DBMA 5HCMA 5J5FA 2YKSA 2Y7YA 1OEDB 4NZBA 3U8JA 4HFEA 4ZZCA 5HEJA 2XNUA 4WV9A 1OEDC 2YOEA 4HFIA 2M6BA 4ILAA 4ZJSA 2LLYA 2XNTA 4BFQA 5HEUA 3WTMA 4TNVA 2WNJA 4TWDA 4UM3P 3SH1A 3UU3A 5LG3A 3JAEA 2UZ6A 4HFHA 4ILCA 4IL9A 3SIOA 4Z91A 3RIFA 3UU8A 2Y57A 3UQ4A 2XYTA 3WTHA 4ZJTA 4X5TA 4ZZBA 5FJVA 2VL0A 3SQ6A 2ZJUA 3WTLA 4ILBA 4Z90A 3PEOA 5BRXA 2YMEA 3RHWA 4UM3A 4UM3S 3PMZA 4FRRA 3IGQA 4F8HA 2LM2A 4IL4A 4ZRUA 2MAWA 4ZR6A 3ZDHA 4A98A 5CO5A 3TLUA 4TWFA 2Y54A 5TVCA 2BJ0A 5AFLA 4LMJA 4QH1A 3TLSA 5CFBA 2QC1B 2XQ8A 3WTKA 5KZUA 5L4EA 5J0ZA 5J5HA 2W8GA 3TLVA 5LXBA 3JAFA 2BYQA 3ZKRA 2XYSA 3WTOA 3UUBA 3ZDGA 2KSRA 2PH9A 2XQ7A 3TLWA 2X00A 5AFMA 3C84A 3SQ9A 3EI0A 2C9TA 3P4WA 4XK9A 1I9BA 2XQ6A 2BYPA 4BQTA 2WZYA 2WNCA 3RQWA 5AINA 2BG9C 4QAAA 5KE4A 5HEHA 4COFA 3UU4A 3WIPA 2Y58A 4ZK4A 2XQ3A 5JMEA 2XZ6A 2XQ4A 4UY2A 4QH5A 3U8NA 2BYNA 4B5DA 2W8FA 4AFGA 4TWHA 3WTJA 3EAMA 3UQ7A 2LKGA 3T4MA 2Y56A 2BG9E 2M6IA 2BYSA 2XQAA 3RIAA 3U8LA 3U8MA 1OEDE 1UX2A
chains in the Genus database with same CATH superfamily
5CA1E 2XM1A 2D0TA 4KBMB 3FXEB 3JC6C 3RH3A 4K0KT 3U8KA 3GN5B 4WBNE 3ONJA 5FXZA 1UK5A 3H3AA 2CE7A 2WS3A 2NTXA 3TLTA 3AE5A 4NXMT 2PTFA 3ETVA 5HCMA 2E9XD 5LGNB 4X62T 2WCAA 5HEJA 3N2GE 1HX1B 2OLTA 2YEVC 1UURA 2LLYA 2YK0A 3Q2MA 4U33A 4YTNA 3B5MA 1U5PA 3D0TA 3AE6A 3OYXA 2ZJUA 2C5IT 2KWIB 3WTLA 1SUMB 3QC9A 3BK9A 4UM3A 3C98B 2V8SV 4ZI3C 5DQWA 4WZXA 4A98A 5LHIB 4H9NC 1IAPA 3AVSA 3GN5A 4CQIA 1ZEEA 5F3JA 5JR9C 3EDUA 2J62A 2JPFA 1BR0A 2NW8A 2Y8DA 2C9TA 3PUYF 2LJLA 3UFGA 5CA0E 5IYZE 3Q5EA 2Z6EA 4JI0T 3UU4A 4DV3T 3CK6A 3CKDA 3OBVE 4AFGA 3V5SA 3OPCA 2V7LA 2UXBT 4DVDA 4GKKT 2IC6A 4UELA 1UGOA 2VVNA 3ZMVB 3FZMB 4U2ZA 4P1NA 3CMLA 3ZYMA 4H9RC 5AQMB 4ZI2C 4PFPA 4JI1T 1VOMA 4LF4T 4AKLA 2FJAA 4I50E 4EYYR 3ONLC 2LEHA 2ZLYA 4NPPA 1G73A 2DL1A 2DWKA 1X9BA 1H7CA 1MMNA 5JRCB 1BR2A 2FBWA 2M6BA 2W63A 5L3EB 2X0HA 3C51A 4IDQA 4BJMA 3RIFA 3WTHA 1MNDA 1OXZA 3HA4A 5C3JA 4JI5T 3KFWX 4I0UA 4ISTA 2PJQA 2JMHA 3AEEA 3OVUA 3ZT5A 3DTOA 2CBIA 4DR7T 5JDFA 2V7JA 3KDSE 3ZCIA 4EEDA 5J0ZA 3TLVA 4JI8T 2XYSA 4HWIB 1LKXA 2X68A 3HKBE 4UVAB 4MFRA 2LHNA 1VCSA 1Z8UA 1ZP0A 2QRXA 4ZK4A 5JR9A 1ZHCA 4HE8A 4QH5A 4TWHA 3LBXB 3OTOT 5LNKA 3UQ7A 5LJMA 2WU2A 3ZYLA 4ZI3D 2DCFA 2NP9A 5HCJA 2WDVA 3LK42 4HFBA 3CWZB 2VKHA 2VWAA 5FVKA 4DR1T 4O4JE 4ADZA 5LCYA 4P0AA 3N9PA 3LK3B 1U4QA 3MK7C 2BYRA 2PBIA 4IDOA 1HNWT 4EYUA 2XNTA 5JDMA 2Q9QA 5IHYA 4O4IE 4ILCA 2Y57A 5J1GA 2PG8A 2WZHA 2WM9A 1Y01A 3ZLIA 4QX8B 4U72A 3AE1A 1KK7A 2B76A 2V6YB 3ZEFB 4JYAT 1LRZA 2ZM0A 4X1IE 3TLWA 3RC8A 3SQ9A 1JNRA 4AKRB 3LK2B 3AAIA 2BYPA 2XAGB 3RX6A 4DR4T 4PJLA 2VKOA 4NUUA 4GKJT 3R6NA 3KVAA 2IC9A 3I0QA 2E2AA 1HG5A 2XQAA 5J2TE 5ETWA 4YHHT 2BDEA 5AQJB 4JEHB 4AFHA 3C50A 1QUUA 3P4PA 4IE5A 5AQFB 3IA3A 4AXPA 5LYJE 3E22E 4JI2T 2V26A 2WSSV 4YJ3E 2XPKA 3UUMA 2XSBA 4WBOA 3PUSA 1ZOYA 4QXCB 4DO0A 2LSIA 2KNDA 2LHRA 2ODVA 4G2AA 5AQSB 2CPTA 2XQYA 2WNJA 3MXZA 1KNPA 3UFEA 2D9DA 3ANWA 4EAHA 4AKIA 3ZMSB 2YDRA 2KWHA 2I59A 4JI6T 4J2CA 5AQLB 3A5XA 4Z8XA 3AEBA 4OYKA 4LF7T 4TWFA 1YXRA 3LJCA 4MHCA 1EZ3A 4GYRA 3WTKA 5HXRA 5BR8T 3FZLB 4L0RA 2CA5A 3JAFA 2M67A 3N9LA 1HS7A 1SE7A 4BQTA 2WZYA 2V7IA 2NW9A 3RYFE 3UULA 1OWAA 1HNZT 2K5BB 4JLEA 2X9YA 4TN7B 2Q9QD 3C64A 2MTQA 4ZI7E 3BQLA 2W4XA 3KBUA 2C5JA 4DUYT 1XDOA 2XQ9A 1LVKA 2XNVA 3WTIA 4P0BA 4B3RT 1W0BA 2KLQA 2YU2A 5HAXA 5FKYA 2L8KA 3WAKA 3P50A 3FXDB 4FI5A 4HWHA 1BR1A 5LGTB 3N9QA 2NWBA 4NZBA 2E9XB 1XNQT 4WV9A 2MYSA 1OEDC 1MIVA 3PUVF 5DQVA 2JQ9A 4PAGA 4HFHA 5LMNT 1J5ET 3UU8A 1M62A 3RYCE 1E7PA 3PV0F 2KINB 2K24A 5CGMA 4UM3S 1HTJF 3MACA 4HWCA 3N5LA 3RRCA 2QC1B 1T98A 2WP9A 3FZKB 2ZM8A 5L4EA 4L9IA 5LXBA 4PJJA 2A9UA 3QB5K 4DV1T 3EI0A 5TAOA 4U7IA 4UXNB 2N2NA 4P09A 3PUWF 4AKHA 5H6QB 4ZI2D 4DMWA 2LKGA 3NBXX 4G63A 4XZCA 2Y56A 4IDNA 3U8MA 1KF6A 3PJAA 2WAUA 3C79A 1IZNB 2BR8A 3R84B 2J1DG 1HFAA 4HFDA 1HX8A 2W67A 3RYIE 3F57A 2WDRA 4HFCA 1CHUA 2B1EA 3KV5A 4BAYB 3EHZA 4DV6T 3UU5A 4AFTA 2X9WA 5HWYA 2WQYA 5EZYE 4B3MT 4PIRA 4EV6A 2BS2A 2YKSA 1KFYA 4UVCB 2W62A 2VB6A 5AFKA 4LF9T 2D5UA 3FB2A 3OYZA 1QSDA 2NR4A 5ABFA 5JRCA 4X5TA 3EVYA 4PJMA 2EHOB 2IAKA 3RIUA 3ZT7A 4EB6E 4PW8A 3S4UA 4Z90A 3AVRA 1MIYA 4GIWA 1GQEA 1WYBA 3ZDHA 5CO5A 3RGLA 2V1DB 2BVMA 3GWHA 2EHOD 2CLYC 4O4HE 3U78A 3UUXB 1T7SA 2XQ7A 4KP3C 4U2YA 2PFVA 4ZXLA 2P9BA 4B3TT 1IJ5A 4OK0A 3SS1A 4COFA 4YT0A 2XZ6A 2VKJA 2IIUA 2XAJB 4DR3T 2C5KT 4NUVA 3T4MA 1O3XA 1HF8A 4CI3B 2K48A 4DBQA 1OEDE 5ABFB 3PTRB 2H7OA 5JR9B 2HH7A 1UUSA 3N9NA 5L2LA 1FIOA 3DJBA 4ALXA 3K3QC 3PURA 2QGSA 5BP0A 4MLKA 3T1YT 2E8IA 3LG7A 3PUXF 5HEOA 4EZ4A 3P4QA 2W0GA 2XM2A 1W09A 4QKNA 3C4ZA 1JNZA 2VKDA 2L3LA 4JI7T 5AFMB 1YW0A 4K0UA 2CHOA 3ZYKA 5AQNB 2ZM2A 4I4TE 1YKHB 2K3WA 4H9PC 5M4YA 3IBPA 3NRYA 3ZMUB 2H88A 3W15B 3PJAJ 4TWDA 4UM3P 3NZPA 4IL9A 4NIQA 1V9DA 1T8BA 4DR6T 2QVAA 2Q9QB 3NRXA 3J9X1 5LXTE 3VU7H 3KBTA 4WW0A 1D1BA 4FRRA 3PU8A 2XY8B 2I6HA 4QH1A 3AEFA 5EK2A 2V5CA 5FL1A 5J5HA 4AIUA 4HWDA 3KV6A 5AFMA 3CPZA 2IW5B 2YINA 3NWIA 4PNIA 4XK9A 1I9BA 2KMFA 4NXNT 2WNCA 4IE4A 3AE3A 3RPUA 1D1AA 2LSGA 3P8CD 5F8PA 2XAFB 4AQFC 5FY7A 1WFDA 3AE9A 1NENA 1KNRA 2AXDS 5IUXA 3KV4A 1WLXA 3PUQA 4L5GA 5JTGA 4QABA 5AQOB 1UV6A 3WAJA 2N1GA 4EEBA 4HGAA 2ZJVA 2Q9QC 3IF8B 1E1HB 2BBJA 4HEAA 4LMKA 4TUYE 3MJXA 2MBGA 3U8JA 4ZZCA 4IE0A 4TV9E 4QXBB 4ILAA 3ZSTA 3BQKA 2Y48B 2WMOA 3O4XE 3ZN0B 3VHLA 5AQVB 3AAEB 5GONE 2VL0A 2QYWA 1DU2A 3PEOA 2NW7A 5BRXA 1N36T 4EIWA 3PMZA 3IGQA 4F8HA 2MAWA 2FUPA 3ANWB 4KHZF 2UUBT 4I43B 4DR2T 5KZUA 4A56A 1KNZA 2BYQA 3WTOA 4ZHQE 1SHZC 4IHJE 2PH9A 3QNUA 4O8SA 5LOVE 4PK5A 3C4WA 5HXSA 3UTKA 4AQGA 4ZOLE 3L39A 1WYCA 3VKHA 4B5DA 3B57A 3V5UA 5LA6E 2V7KA 4UVBB 2W61A 4H63V 3CX8B 4CXXA 2LKHA 4OHFA 2BG9A 1Z0PA 1WCRA 3UUNA 1UW6A 2K9AA 5AQUB 2NTYA 2WNLA 3LDQB 5C2TA 3KVBA 3NZQA 4CZZB 5J5IA 3O1IA 2WWUA 3K1SA 1UX5A 4WNKA 4HQPA 4UV9B 4V1Av 4LFAT 5JH7E 5FVLA 1I6ZA 3PE0A 5KXJA 3ZMZB 2JRKA 1D1CA 3HKDE 4UF0B 4ZEYA 4ZJSA 4U31A 5J2UE 5HEUA 4N78D 4IE6A 1XNRT 4XAXB 3IHRA 5EK3A 5AQRB 2UZ6A 3SIOA 1HR0T 4ZJTA 2BKOA 3RRWA 2D0UA 3VRAA 1D0YA 1N33T 3AXJA 2V5DA 3O1JA 3Q5WA 5FXWA 3AA7B 3HKEE 2LSKA 3FZHB 5HXCA 3ZJ1A 4E7ZA 4ILUA 4LMJA 2WBLA 3BQIA 3UT5E 5FYMA 3UUBA 2XSAA 3ZN1B 3C84A 2JIWA 3JC6D 3ZJ2A 4O2AE 4PJNA 5C8YE 2XUEA 4M1PA 3AEGA 4X1YE 3GA8A 3PDYA 3RI5A 3AXJB 4LF5T 4KHPT 3UU6A 3DP7A 3H3MA 3E0ZA 2WN9A 1KEYA 4U7YA 4D01A 2ZMAA 3ONXA 3RQUA 5FY1A 3VR9A 3VRBA 3GUAA 1OEDA 5HYAA 1NEKA 2CXFA 2YU1A 5E0OA 4HFEA 2UUCT 5HXEA 1VCTA 2X9XA 2YOEA 3M3ZB 4ERRA 2X9HA 4YSYA 4TNVA 4KI0F 1Y64B 5A1LA 4X64T 5H6RB 2UXXB 2EHOC 2VQFT 2BS4A 2X0YA 3B13A 2WY2A 3RKOA 2A3DA 2MPKA 4UIGA 4GYSA 5FY0A 1UCUA 3I0OA 2RP4A 4JEUB 2X51A 4ZRUA 5AFLA 2HPJA 2CLYB 4OX9T 3I9WA 4JI3T 2FJBA 4CXWA 3PU3A 5AQTB 3IEEA 1N34T 3ZDGA 1IBMT 2CMRA 2XQ6A 3O9XA 5JREA 2Y6XA 5JMEA 2LOPA 4UY2A 4HFVA 4X20E 4DV0T 3FHNA 3HI2A 1YD8G 3AECA 2HN1A 1AJ3A 5L3GB 4HKAA 4B6XA 1XMQT 4IGUA 4EZHA 2NOXA 2V6YA 2V6XA 5DABA 3HL6A 1IJ6A 1YQ3A 3ZMTB 1MNEA 4KUMB 4LF8T 2N9DA 2IUBA 3P4SA 5F5WA 2DHRA 4YSXA 4H63H 4DV5T 4LFCT 5BMVE 2HHHT 3ESLA 2CBJA 4EZ1A 5LBQB 2A72A 5LGUB 3G06A 4ZK1A 2ZM6T 2YN6A 4JI4T 4QHOA 2HPLA 2Y7YA 2H89A 3I9YA 4OYJA 4O4LE 4CN6A 4BFQA 4AQFA 3QB5A 3JAEA 3K3OA 3O1HA 2AE9A 2OV9A 4BA9A 2BBHA 2JQQA 1W9RA 5ABEA 4C91A 4TX5A 4ZR6A 3ZC0A 4KX6A 2Y54A 3TLSA 2KT9A 2IDOB 2UUAT 2DWGA 5JDQA 1US7B 5JDLA 2JQKA 4BJNA 4YTPA 2LE8A 2DI4A 2IMLA 3RKGA 2ACZA 2XQ3A 4TZ4C 2XQ4A 3U8NA 3J7Yq 2E5LT 4DUZT 1D0ZA 4CN4A 4A5XA 3LSVA 4UM1A 4X65T 3E08A 5JQGE 2YMDA 3WTNA 2JMKA 3EABA 2UXCT 3CX6B 1R8IA 3RF1A 5L3FB 4IDPA 4A97A 5AFHA 2X00D 2WB5A 2CM0A 2DLRA 3L8RA 5LG4A 3KV9A 5HEGA 3FZFB 3I1AA 1WRDA 2CEAA 3Q5DA 4C90A 4YJ2E 2XJ7A 3X1DA 3LFMA 3AAAB 3ZC1A 3Q9DA 3ZPOA 4YTMA 1SA0E 5L3BB 3QK6A 2YMEA 4UV8B 3M65A 2WU5A 5AQIB 3L09A 2E9XA 1IBLT 4QX7B 3SFDA 4DIDB 2XQ8A 3AEDA 5LB7B 3P4RA 3N2KE 4LF6T 2X00A 5ABGA 1FMWA 2CWOA 2JQHA 2W00A 3RQWA 2Y58A 2G0UA 3OKQA 4HN9A 4YLHA 3EAMA 3ABVA 2BG9E 2BYSA 1LVFA 1VRBA 3RLFF 1S35A 2VURA 4CN1A 4PK4A 4HTEA 4ZS2A 2X66A 1S94A 4QXHB 5L47A 2PGZA 5LHHB 5AQHB 3AB3B 2J4GA 3TKLB 4DV7T 5LHGB 4JV5T 2V7MA 3T1HT 2W2UA 3L3PA 4DBRA 1M7KA 5ADXL 4YFSA 3AE2A 4IDZA 3RC3A 2QA7A 4MALA 3MZKB 5LP6E 2VVSA 2OA5A 5L3DB 5J5GA 5JDGA 4JUYA 2FJDA 3AE7A 3ETUA 4CXYA 2SPCA 2BKNA 3AA0B 1HCIA 2W66A 2LT3A 2H3RA 5IWAT 3CX7B 3UU3A 5LG3A 4X1KE 5EK4A 1D0XA 1IBKT 4ZZBA 1MMDA 3SWHA 3EDVA 1MMGA 1MIWA 5LMUT 1XMOT 2WDQA 3MA9A 2R6GF 3EUHA 3KINB 2W8GA 3SRZA 3CQCB 4WYVA 3LBXA 2CWYA 4DV4T 1W0AA 3PUZF 4E7SA 3ZT6A 3Q5XA 3PUGA 2W8FA 2KXPB 3WTJA 3U3IA 1FMVA 2JJ9A 2IHR1 2CXDA 3U8LA 5J5FA 4KMCA 2BKPA 5HWXA 4ISSA 3F31A 4XBFB 3VKGA 2XZ5A 2ODUA 3VR8A 3NKZA 2BG9B 2RA1A 1XWMA 4PFOA 2XQ5A 4UEMA 3A7MA 3HR0A 2BVLA 2J47A 5KX5E 3JADA 4IREA 2UXNB 4U74A 2LOSA 3OJAA 4B3ST 2BR7A 1G8XA 5AFNA 5SYOA 1NAFA 1E2AA 3F2EA 1HG2A 4F6RC 3RYHE 1UX4A 4GOUA 4YY3T 4ANJA 2CRBA 2L9QA 5HXHA 4Z91A 3UQ4A 4UF0A 2XYTA 5JVDE 2XTLA 4ILBA 1L0VA 4GK0E 4EGWA 2LM2A 3MKDA 3JCFA 3CVRA 4UR9A 5CFBA 1J5WA 3NVOA 4H9SE 3N9MA 1T72A 3QOFA 2UU9T 4AKGA 2MOZA 4JBWF 4CI1B 2WZIA 3FBZA 2BG9C 5HEHA 3WIPA 4OFZA 2KZ7B 3FBLA 5JDHA 4DR5T 2D2SA 4IIJE 2UXDT 5LJNA 3AEAA 4YHJA 3RIAA 4ZS3A 3AE4A 5KDMC 4TNWA 4LFBT 2DNXA 2HN2A 4EXTA 3GMIA 5JDNA 4XHEA 4YXDA 4DNDA 2BZBA 4FJOA 4QWNB 4O2BE 2XAHB 5L3CB 3HKCE 4TV8E 2EHOA 4QH4A 1ZKEA 2WWVA 3C4XA 4DBMA 2FJEA 4UXUA 3AA6B 4H9OC 4AQYT 2CCQA 1OEDB 3SFEA 5FMNA 4GK5E 4HFIA 2VK9A 3CQGB 3WTMA 4X66T 2X67A 3K8PC 3SQ6A 4CI2B 1MMAA 1WR0A 2XZEA 3RHWA 3CQXC 3WI3A 5AQQB 3TLUA 5TVCA 3CIRA 5FXVA 2CHNA 4YSZA 1CUNA 4IE7A 5AQPB 2KSRA 4AI6A 3QUJA 3P4WA 3AA1B 3P7IA 1J1JA 4EOZB 2H7VC 2XAQB 3PUAA 5AINA 4QAAA 2YDSA 5FNVE 2E9XC 2BYNA 3N9OA 2CXLA 1HNXT 5FP3A 5CB4E 2VASA 1N32T 2RPAA 4ASKA 2WMNA 1FJGT 5CJ5A 5AFUL 2LM9A 5AFJA 2XASB 1WR6A 2BS3A 1BR4A 1X79A 4Q25A 5KMGP 2E5VA 2XHEB 3N2OA 4LMLA 4DMVA 5L4HA 3RIUC 1YQ4A 5BW2A 2VL8A 3A8YC 2I0MA 3T8OA 4QACA 2C0SA 2LRKA 4AISA 4HWFA 4IT4A 3H37A 2XNUA 1XDPA 3K3NA 2LRLA 5LBMA 3SH1A 4I55E 2LSJA 5DJQC 4U3CA 5ABHA 2VQET 4H9QC 3AE8A 1YKEB 1QLBA 5FJVA 1I94T 3ZSSA 5AQKB 2ES0A 4PK6A 4IL4A 2A2FX 2X0LB 3SOLA 2BJ0A 2YDQA 5FXXA 2F4VT 5AQGB 3ZKRA 1NWMX 3ZCJA 1ZV4X 1FEWA 5KE4A 1XZYA 2ACXA 2LSYA 5FL0A 2GK9A 4MBQA 2M6IA 1B7TA 4DV2T 1UX2A
chains in the Genus database with same CATH topology
2LKHA 2BG9A 3RI5A 5AFJA 2XQ9A 4ALXA 3LSVA 3UU6A 3C79A 4TNWA 2XNVA 4UM1A 2BR8A 2WN9A 3WTIA 5BP0A 5L47A 2XZ5A 5HCJA 4D01A 2PGZA 5IUXA 1UW6A 4AFHA 4HFDA 2YMDA 2WNLA 3WTNA 4HFBA 2BG9B 4XHEA 4QABA 3U8KA 2XQ5A 3RQUA 4A97A 5J5IA 4LMLA 5AFHA 1UV6A 5HEOA 5L4HA 2X00D 5BW2A 3P50A 3JADA 4HFCA 5AFKA 3GUAA 4HQPA 4IREA 4EZ1A 3EHZA 1OEDA 4QACA 4QH4A 3UU5A 4ZK1A 2BYRA 5AFMB 4AFTA 3TLTA 4NPPA 2BR7A 2ZJVA 5HEGA 5AFNA 4LMKA 2YN6A 5SYOA 4PIRA 5J5GA 4UXUA 4DBMA 5HCMA 5J5FA 2YKSA 2Y7YA 1OEDB 4NZBA 3U8JA 4HFEA 4ZZCA 5HEJA 2XNUA 4WV9A 1OEDC 2YOEA 4HFIA 2M6BA 4ILAA 4ZJSA 2LLYA 2XNTA 4BFQA 5HEUA 3WTMA 4TNVA 2WNJA 4TWDA 4UM3P 3SH1A 3UU3A 5LG3A 3JAEA 2UZ6A 4HFHA 4ILCA 4IL9A 3SIOA 4Z91A 3RIFA 3UU8A 2Y57A 3UQ4A 2XYTA 3WTHA 4ZJTA 4X5TA 4ZZBA 5FJVA 2VL0A 3SQ6A 2ZJUA 3WTLA 4ILBA 4Z90A 3PEOA 5BRXA 2YMEA 3RHWA 4UM3A 4UM3S 3PMZA 4FRRA 3IGQA 4F8HA 2LM2A 4IL4A 4ZRUA 2MAWA 4ZR6A 3ZDHA 4A98A 5CO5A 3TLUA 4TWFA 2Y54A 5TVCA 2BJ0A 5AFLA 4LMJA 4QH1A 3TLSA 5CFBA 2QC1B 2XQ8A 3WTKA 5KZUA 5L4EA 5J0ZA 5J5HA 2W8GA 3TLVA 5LXBA 3JAFA 2BYQA 3ZKRA 2XYSA 3WTOA 3UUBA 3ZDGA 2KSRA 2PH9A 2XQ7A 3TLWA 2X00A 5AFMA 3C84A 3SQ9A 3EI0A 2C9TA 3P4WA 4XK9A 1I9BA 2XQ6A 2BYPA 4BQTA 2WZYA 2WNCA 3RQWA 5AINA 2BG9C 4QAAA 5KE4A 5HEHA 4COFA 3UU4A 3WIPA 2Y58A 4ZK4A 2XQ3A 5JMEA 2XZ6A 2XQ4A 4UY2A 4QH5A 3U8NA 2BYNA 4B5DA 2W8FA 4AFGA 4TWHA 3WTJA 3EAMA 3UQ7A 2LKGA 3T4MA 2Y56A 2BG9E 2M6IA 2BYSA 2XQAA 3RIAA 3U8LA 3U8MA 1OEDE 1UX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKH A;  2BG9 A;  3RI5 A;  5AFJ A;  2XQ9 A;  4ALX A;  3LSV A;  3UU6 A;  3C79 A;  4TNW A;  2XNV A;  4UM1 A;  2BR8 A;  2WN9 A;  3WTI A;  5BP0 A;  5L47 A;  2XZ5 A;  5HCJ A;  4D01 A;  2PGZ A;  5IUX A;  1UW6 A;  4AFH A;  4HFD A;  2YMD A;  2WNL A;  3WTN A;  4HFB A;  2BG9 B;  4XHE A;  4QAB A;  3U8K A;  2XQ5 A;  3RQU A;  4A97 A;  5J5I A;  4LML A;  5AFH A;  1UV6 A;  5HEO A;  5L4H A;  2X00 D;  5BW2 A;  3P50 A;  3JAD A;  4HFC A;  5AFK A;  3GUA A;  4HQP A;  4IRE A;  4EZ1 A;  3EHZ A;  1OED A;  4QAC A;  4QH4 A;  3UU5 A;  4ZK1 A;  2BYR A;  5AFM B;  4AFT A;  3TLT A;  4NPP A;  2BR7 A;  2ZJV A;  5HEG A;  5AFN A;  4LMK A;  2YN6 A;  5SYO A;  4PIR A;  5J5G A;  4UXU A;  4DBM A;  5HCM A;  5J5F A;  2YKS A;  2Y7Y A;  1OED B;  4NZB A;  3U8J A;  4HFE A;  4ZZC A;  5HEJ A;  2XNU A;  4WV9 A;  1OED C;  2YOE A;  4HFI A;  2M6B A;  4ILA A;  4ZJS A;  2LLY A;  2XNT A;  4BFQ A;  5HEU A;  3WTM A;  4TNV A;  2WNJ A;  4TWD A;  4UM3 P;  3SH1 A;  3UU3 A;  5LG3 A;  3JAE A;  2UZ6 A;  4HFH A;  4ILC A;  4IL9 A;  3SIO A;  4Z91 A;  3RIF A;  3UU8 A;  2Y57 A;  3UQ4 A;  2XYT A;  3WTH A;  4ZJT A;  4X5T A;  4ZZB A;  5FJV A;  2VL0 A;  3SQ6 A;  2ZJU A;  3WTL A;  4ILB A;  4Z90 A;  3PEO A;  5BRX A;  2YME A;  3RHW A;  4UM3 A;  4UM3 S;  3PMZ A;  4FRR A;  3IGQ A;  4F8H A;  2LM2 A;  4IL4 A;  4ZRU A;  2MAW A;  4ZR6 A;  3ZDH A;  4A98 A;  5CO5 A;  3TLU A;  4TWF A;  2Y54 A;  5TVC A;  2BJ0 A;  5AFL A;  4LMJ A;  4QH1 A;  3TLS A;  5CFB A;  2QC1 B;  2XQ8 A;  3WTK A;  5KZU A;  5L4E A;  5J0Z A;  5J5H A;  2W8G A;  3TLV A;  5LXB A;  3JAF A;  2BYQ A;  3ZKR A;  2XYS A;  3WTO A;  3UUB A;  3ZDG A;  2KSR A;  2PH9 A;  2XQ7 A;  3TLW A;  2X00 A;  5AFM A;  3C84 A;  3SQ9 A;  3EI0 A;  2C9T A;  3P4W A;  4XK9 A;  1I9B A;  2XQ6 A;  2BYP A;  4BQT A;  2WZY A;  2WNC A;  3RQW A;  5AIN A;  2BG9 C;  4QAA A;  5KE4 A;  5HEH A;  4COF A;  3UU4 A;  3WIP A;  2Y58 A;  4ZK4 A;  2XQ3 A;  5JME A;  2XZ6 A;  2XQ4 A;  4UY2 A;  4QH5 A;  3U8N A;  2BYN A;  4B5D A;  2W8F A;  4AFG A;  4TWH A;  3WTJ A;  3EAM A;  3UQ7 A;  2LKG A;  3T4M A;  2Y56 A;  2BG9 E;  2M6I A;  2BYS A;  2XQA A;  3RIA A;  3U8L A;  3U8M A;  1OED E;  1UX2 A; 
#chains in the Genus database with same CATH topology
 5CA1 E;  2XM1 A;  2D0T A;  4KBM B;  3FXE B;  3JC6 C;  3RH3 A;  4K0K T;  3U8K A;  3GN5 B;  4WBN E;  3ONJ A;  5FXZ A;  1UK5 A;  3H3A A;  2CE7 A;  2WS3 A;  2NTX A;  3TLT A;  3AE5 A;  4NXM T;  2PTF A;  3ETV A;  5HCM A;  2E9X D;  5LGN B;  4X62 T;  2WCA A;  5HEJ A;  3N2G E;  1HX1 B;  2OLT A;  2YEV C;  1UUR A;  2LLY A;  2YK0 A;  3Q2M A;  4U33 A;  4YTN A;  3B5M A;  1U5P A;  3D0T A;  3AE6 A;  3OYX A;  2ZJU A;  2C5I T;  2KWI B;  3WTL A;  1SUM B;  3QC9 A;  3BK9 A;  4UM3 A;  3C98 B;  2V8S V;  4ZI3 C;  5DQW A;  4WZX A;  4A98 A;  5LHI B;  4H9N C;  1IAP A;  3AVS A;  3GN5 A;  4CQI A;  1ZEE A;  5F3J A;  5JR9 C;  3EDU A;  2J62 A;  2JPF A;  1BR0 A;  2NW8 A;  2Y8D A;  2C9T A;  3PUY F;  2LJL A;  3UFG A;  5CA0 E;  5IYZ E;  3Q5E A;  2Z6E A;  4JI0 T;  3UU4 A;  4DV3 T;  3CK6 A;  3CKD A;  3OBV E;  4AFG A;  3V5S A;  3OPC A;  2V7L A;  2UXB T;  4DVD A;  4GKK T;  2IC6 A;  4UEL A;  1UGO A;  2VVN A;  3ZMV B;  3FZM B;  4U2Z A;  4P1N A;  3CML A;  3ZYM A;  4H9R C;  5AQM B;  4ZI2 C;  4PFP A;  4JI1 T;  1VOM A;  4LF4 T;  4AKL A;  2FJA A;  4I50 E;  4EYY R;  3ONL C;  2LEH A;  2ZLY A;  4NPP A;  1G73 A;  2DL1 A;  2DWK A;  1X9B A;  1H7C A;  1MMN A;  5JRC B;  1BR2 A;  2FBW A;  2M6B A;  2W63 A;  5L3E B;  2X0H A;  3C51 A;  4IDQ A;  4BJM A;  3RIF A;  3WTH A;  1MND A;  1OXZ A;  3HA4 A;  5C3J A;  4JI5 T;  3KFW X;  4I0U A;  4IST A;  2PJQ A;  2JMH A;  3AEE A;  3OVU A;  3ZT5 A;  3DTO A;  2CBI A;  4DR7 T;  5JDF A;  2V7J A;  3KDS E;  3ZCI A;  4EED A;  5J0Z A;  3TLV A;  4JI8 T;  2XYS A;  4HWI B;  1LKX A;  2X68 A;  3HKB E;  4UVA B;  4MFR A;  2LHN A;  1VCS A;  1Z8U A;  1ZP0 A;  2QRX A;  4ZK4 A;  5JR9 A;  1ZHC A;  4HE8 A;  4QH5 A;  4TWH A;  3LBX B;  3OTO T;  5LNK A;  3UQ7 A;  5LJM A;  2WU2 A;  3ZYL A;  4ZI3 D;  2DCF A;  2NP9 A;  5HCJ A;  2WDV A;  3LK4 2;  4HFB A;  3CWZ B;  2VKH A;  2VWA A;  5FVK A;  4DR1 T;  4O4J E;  4ADZ A;  5LCY A;  4P0A A;  3N9P A;  3LK3 B;  1U4Q A;  3MK7 C;  2BYR A;  2PBI A;  4IDO A;  1HNW T;  4EYU A;  2XNT A;  5JDM A;  2Q9Q A;  5IHY A;  4O4I E;  4ILC A;  2Y57 A;  5J1G A;  2PG8 A;  2WZH A;  2WM9 A;  1Y01 A;  3ZLI A;  4QX8 B;  4U72 A;  3AE1 A;  1KK7 A;  2B76 A;  2V6Y B;  3ZEF B;  4JYA T;  1LRZ A;  2ZM0 A;  4X1I E;  3TLW A;  3RC8 A;  3SQ9 A;  1JNR A;  4AKR B;  3LK2 B;  3AAI A;  2BYP A;  2XAG B;  3RX6 A;  4DR4 T;  4PJL A;  2VKO A;  4NUU A;  4GKJ T;  3R6N A;  3KVA A;  2IC9 A;  3I0Q A;  2E2A A;  1HG5 A;  2XQA A;  5J2T E;  5ETW A;  4YHH T;  2BDE A;  5AQJ B;  4JEH B;  4AFH A;  3C50 A;  1QUU A;  3P4P A;  4IE5 A;  5AQF B;  3IA3 A;  4AXP A;  5LYJ E;  3E22 E;  4JI2 T;  2V26 A;  2WSS V;  4YJ3 E;  2XPK A;  3UUM A;  2XSB A;  4WBO A;  3PUS A;  1ZOY A;  4QXC B;  4DO0 A;  2LSI A;  2KND A;  2LHR A;  2ODV A;  4G2A A;  5AQS B;  2CPT A;  2XQY A;  2WNJ A;  3MXZ A;  1KNP A;  3UFE A;  2D9D A;  3ANW A;  4EAH A;  4AKI A;  3ZMS B;  2YDR A;  2KWH A;  2I59 A;  4JI6 T;  4J2C A;  5AQL B;  3A5X A;  4Z8X A;  3AEB A;  4OYK A;  4LF7 T;  4TWF A;  1YXR A;  3LJC A;  4MHC A;  1EZ3 A;  4GYR A;  3WTK A;  5HXR A;  5BR8 T;  3FZL B;  4L0R A;  2CA5 A;  3JAF A;  2M67 A;  3N9L A;  1HS7 A;  1SE7 A;  4BQT A;  2WZY A;  2V7I A;  2NW9 A;  3RYF E;  3UUL A;  1OWA A;  1HNZ T;  2K5B B;  4JLE A;  2X9Y A;  4TN7 B;  2Q9Q D;  3C64 A;  2MTQ A;  4ZI7 E;  3BQL A;  2W4X A;  3KBU A;  2C5J A;  4DUY T;  1XDO A;  2XQ9 A;  1LVK A;  2XNV A;  3WTI A;  4P0B A;  4B3R T;  1W0B A;  2KLQ A;  2YU2 A;  5HAX A;  5FKY A;  2L8K A;  3WAK A;  3P50 A;  3FXD B;  4FI5 A;  4HWH A;  1BR1 A;  5LGT B;  3N9Q A;  2NWB A;  4NZB A;  2E9X B;  1XNQ T;  4WV9 A;  2MYS A;  1OED C;  1MIV A;  3PUV F;  5DQV A;  2JQ9 A;  4PAG A;  4HFH A;  5LMN T;  1J5E T;  3UU8 A;  1M62 A;  3RYC E;  1E7P A;  3PV0 F;  2KIN B;  2K24 A;  5CGM A;  4UM3 S;  1HTJ F;  3MAC A;  4HWC A;  3N5L A;  3RRC A;  2QC1 B;  1T98 A;  2WP9 A;  3FZK B;  2ZM8 A;  5L4E A;  4L9I A;  5LXB A;  4PJJ A;  2A9U A;  3QB5 K;  4DV1 T;  3EI0 A;  5TAO A;  4U7I A;  4UXN B;  2N2N A;  4P09 A;  3PUW F;  4AKH A;  5H6Q B;  4ZI2 D;  4DMW A;  2LKG A;  3NBX X;  4G63 A;  4XZC A;  2Y56 A;  4IDN A;  3U8M A;  1KF6 A;  3PJA A;  2WAU A;  3C79 A;  1IZN B;  2BR8 A;  3R84 B;  2J1D G;  1HFA A;  4HFD A;  1HX8 A;  2W67 A;  3RYI E;  3F57 A;  2WDR A;  4HFC A;  1CHU A;  2B1E A;  3KV5 A;  4BAY B;  3EHZ A;  4DV6 T;  3UU5 A;  4AFT A;  2X9W A;  5HWY A;  2WQY A;  5EZY E;  4B3M T;  4PIR A;  4EV6 A;  2BS2 A;  2YKS A;  1KFY A;  4UVC B;  2W62 A;  2VB6 A;  5AFK A;  4LF9 T;  2D5U A;  3FB2 A;  3OYZ A;  1QSD A;  2NR4 A;  5ABF A;  5JRC A;  4X5T A;  3EVY A;  4PJM A;  2EHO B;  2IAK A;  3RIU A;  3ZT7 A;  4EB6 E;  4PW8 A;  3S4U A;  4Z90 A;  3AVR A;  1MIY A;  4GIW A;  1GQE A;  1WYB A;  3ZDH A;  5CO5 A;  3RGL A;  2V1D B;  2BVM A;  3GWH A;  2EHO D;  2CLY C;  4O4H E;  3U78 A;  3UUX B;  1T7S A;  2XQ7 A;  4KP3 C;  4U2Y A;  2PFV A;  4ZXL A;  2P9B A;  4B3T T;  1IJ5 A;  4OK0 A;  3SS1 A;  4COF A;  4YT0 A;  2XZ6 A;  2VKJ A;  2IIU A;  2XAJ B;  4DR3 T;  2C5K T;  4NUV A;  3T4M A;  1O3X A;  1HF8 A;  4CI3 B;  2K48 A;  4DBQ A;  1OED E;  5ABF B;  3PTR B;  2H7O A;  5JR9 B;  2HH7 A;  1UUS A;  3N9N A;  5L2L A;  1FIO A;  3DJB A;  4ALX A;  3K3Q C;  3PUR A;  2QGS A;  5BP0 A;  4MLK A;  3T1Y T;  2E8I A;  3LG7 A;  3PUX F;  5HEO A;  4EZ4 A;  3P4Q A;  2W0G A;  2XM2 A;  1W09 A;  4QKN A;  3C4Z A;  1JNZ A;  2VKD A;  2L3L A;  4JI7 T;  5AFM B;  1YW0 A;  4K0U A;  2CHO A;  3ZYK A;  5AQN B;  2ZM2 A;  4I4T E;  1YKH B;  2K3W A;  4H9P C;  5M4Y A;  3IBP A;  3NRY A;  3ZMU B;  2H88 A;  3W15 B;  3PJA J;  4TWD A;  4UM3 P;  3NZP A;  4IL9 A;  4NIQ A;  1V9D A;  1T8B A;  4DR6 T;  2QVA A;  2Q9Q B;  3NRX A;  3J9X 1;  5LXT E;  3VU7 H;  3KBT A;  4WW0 A;  1D1B A;  4FRR A;  3PU8 A;  2XY8 B;  2I6H A;  4QH1 A;  3AEF A;  5EK2 A;  2V5C A;  5FL1 A;  5J5H A;  4AIU A;  4HWD A;  3KV6 A;  5AFM A;  3CPZ A;  2IW5 B;  2YIN A;  3NWI A;  4PNI A;  4XK9 A;  1I9B A;  2KMF A;  4NXN T;  2WNC A;  4IE4 A;  3AE3 A;  3RPU A;  1D1A A;  2LSG A;  3P8C D;  5F8P A;  2XAF B;  4AQF C;  5FY7 A;  1WFD A;  3AE9 A;  1NEN A;  1KNR A;  2AXD S;  5IUX A;  3KV4 A;  1WLX A;  3PUQ A;  4L5G A;  5JTG A;  4QAB A;  5AQO B;  1UV6 A;  3WAJ A;  2N1G A;  4EEB A;  4HGA A;  2ZJV A;  2Q9Q C;  3IF8 B;  1E1H B;  2BBJ A;  4HEA A;  4LMK A;  4TUY E;  3MJX A;  2MBG A;  3U8J A;  4ZZC A;  4IE0 A;  4TV9 E;  4QXB B;  4ILA A;  3ZST A;  3BQK A;  2Y48 B;  2WMO A;  3O4X E;  3ZN0 B;  3VHL A;  5AQV B;  3AAE B;  5GON E;  2VL0 A;  2QYW A;  1DU2 A;  3PEO A;  2NW7 A;  5BRX A;  1N36 T;  4EIW A;  3PMZ A;  3IGQ A;  4F8H A;  2MAW A;  2FUP A;  3ANW B;  4KHZ F;  2UUB T;  4I43 B;  4DR2 T;  5KZU A;  4A56 A;  1KNZ A;  2BYQ A;  3WTO A;  4ZHQ E;  1SHZ C;  4IHJ E;  2PH9 A;  3QNU A;  4O8S A;  5LOV E;  4PK5 A;  3C4W A;  5HXS A;  3UTK A;  4AQG A;  4ZOL E;  3L39 A;  1WYC A;  3VKH A;  4B5D A;  3B57 A;  3V5U A;  5LA6 E;  2V7K A;  4UVB B;  2W61 A;  4H63 V;  3CX8 B;  4CXX A;  2LKH A;  4OHF A;  2BG9 A;  1Z0P A;  1WCR A;  3UUN A;  1UW6 A;  2K9A A;  5AQU B;  2NTY A;  2WNL A;  3LDQ B;  5C2T A;  3KVB A;  3NZQ A;  4CZZ B;  5J5I A;  3O1I A;  2WWU A;  3K1S A;  1UX5 A;  4WNK A;  4HQP A;  4UV9 B;  4V1A v;  4LFA T;  5JH7 E;  5FVL A;  1I6Z A;  3PE0 A;  5KXJ A;  3ZMZ B;  2JRK A;  1D1C A;  3HKD E;  4UF0 B;  4ZEY A;  4ZJS A;  4U31 A;  5J2U E;  5HEU A;  4N78 D;  4IE6 A;  1XNR T;  4XAX B;  3IHR A;  5EK3 A;  5AQR B;  2UZ6 A;  3SIO A;  1HR0 T;  4ZJT A;  2BKO A;  3RRW A;  2D0U A;  3VRA A;  1D0Y A;  1N33 T;  3AXJ A;  2V5D A;  3O1J A;  3Q5W A;  5FXW A;  3AA7 B;  3HKE E;  2LSK A;  3FZH B;  5HXC A;  3ZJ1 A;  4E7Z A;  4ILU A;  4LMJ A;  2WBL A;  3BQI A;  3UT5 E;  5FYM A;  3UUB A;  2XSA A;  3ZN1 B;  3C84 A;  2JIW A;  3JC6 D;  3ZJ2 A;  4O2A E;  4PJN A;  5C8Y E;  2XUE A;  4M1P A;  3AEG A;  4X1Y E;  3GA8 A;  3PDY A;  3RI5 A;  3AXJ B;  4LF5 T;  4KHP T;  3UU6 A;  3DP7 A;  3H3M A;  3E0Z A;  2WN9 A;  1KEY A;  4U7Y A;  4D01 A;  2ZMA A;  3ONX A;  3RQU A;  5FY1 A;  3VR9 A;  3VRB A;  3GUA A;  1OED A;  5HYA A;  1NEK A;  2CXF A;  2YU1 A;  5E0O A;  4HFE A;  2UUC T;  5HXE A;  1VCT A;  2X9X A;  2YOE A;  3M3Z B;  4ERR A;  2X9H A;  4YSY A;  4TNV A;  4KI0 F;  1Y64 B;  5A1L A;  4X64 T;  5H6R B;  2UXX B;  2EHO C;  2VQF T;  2BS4 A;  2X0Y A;  3B13 A;  2WY2 A;  3RKO A;  2A3D A;  2MPK A;  4UIG A;  4GYS A;  5FY0 A;  1UCU A;  3I0O A;  2RP4 A;  4JEU B;  2X51 A;  4ZRU A;  5AFL A;  2HPJ A;  2CLY B;  4OX9 T;  3I9W A;  4JI3 T;  2FJB A;  4CXW A;  3PU3 A;  5AQT B;  3IEE A;  1N34 T;  3ZDG A;  1IBM T;  2CMR A;  2XQ6 A;  3O9X A;  5JRE A;  2Y6X A;  5JME A;  2LOP A;  4UY2 A;  4HFV A;  4X20 E;  4DV0 T;  3FHN A;  3HI2 A;  1YD8 G;  3AEC A;  2HN1 A;  1AJ3 A;  5L3G B;  4HKA A;  4B6X A;  1XMQ T;  4IGU A;  4EZH A;  2NOX A;  2V6Y A;  2V6X A;  5DAB A;  3HL6 A;  1IJ6 A;  1YQ3 A;  3ZMT B;  1MNE A;  4KUM B;  4LF8 T;  2N9D A;  2IUB A;  3P4S A;  5F5W A;  2DHR A;  4YSX A;  4H63 H;  4DV5 T;  4LFC T;  5BMV E;  2HHH T;  3ESL A;  2CBJ A;  4EZ1 A;  5LBQ B;  2A72 A;  5LGU B;  3G06 A;  4ZK1 A;  2ZM6 T;  2YN6 A;  4JI4 T;  4QHO A;  2HPL A;  2Y7Y A;  2H89 A;  3I9Y A;  4OYJ A;  4O4L E;  4CN6 A;  4BFQ A;  4AQF A;  3QB5 A;  3JAE A;  3K3O A;  3O1H A;  2AE9 A;  2OV9 A;  4BA9 A;  2BBH A;  2JQQ A;  1W9R A;  5ABE A;  4C91 A;  4TX5 A;  4ZR6 A;  3ZC0 A;  4KX6 A;  2Y54 A;  3TLS A;  2KT9 A;  2IDO B;  2UUA T;  2DWG A;  5JDQ A;  1US7 B;  5JDL A;  2JQK A;  4BJN A;  4YTP A;  2LE8 A;  2DI4 A;  2IML A;  3RKG A;  2ACZ A;  2XQ3 A;  4TZ4 C;  2XQ4 A;  3U8N A;  3J7Y q;  2E5L T;  4DUZ T;  1D0Z A;  4CN4 A;  4A5X A;  3LSV A;  4UM1 A;  4X65 T;  3E08 A;  5JQG E;  2YMD A;  3WTN A;  2JMK A;  3EAB A;  2UXC T;  3CX6 B;  1R8I A;  3RF1 A;  5L3F B;  4IDP A;  4A97 A;  5AFH A;  2X00 D;  2WB5 A;  2CM0 A;  2DLR A;  3L8R A;  5LG4 A;  3KV9 A;  5HEG A;  3FZF B;  3I1A A;  1WRD A;  2CEA A;  3Q5D A;  4C90 A;  4YJ2 E;  2XJ7 A;  3X1D A;  3LFM A;  3AAA B;  3ZC1 A;  3Q9D A;  3ZPO A;  4YTM A;  1SA0 E;  5L3B B;  3QK6 A;  2YME A;  4UV8 B;  3M65 A;  2WU5 A;  5AQI B;  3L09 A;  2E9X A;  1IBL T;  4QX7 B;  3SFD A;  4DID B;  2XQ8 A;  3AED A;  5LB7 B;  3P4R A;  3N2K E;  4LF6 T;  2X00 A;  5ABG A;  1FMW A;  2CWO A;  2JQH A;  2W00 A;  3RQW A;  2Y58 A;  2G0U A;  3OKQ A;  4HN9 A;  4YLH A;  3EAM A;  3ABV A;  2BG9 E;  2BYS A;  1LVF A;  1VRB A;  3RLF F;  1S35 A;  2VUR A;  4CN1 A;  4PK4 A;  4HTE A;  4ZS2 A;  2X66 A;  1S94 A;  4QXH B;  5L47 A;  2PGZ A;  5LHH B;  5AQH B;  3AB3 B;  2J4G A;  3TKL B;  4DV7 T;  5LHG B;  4JV5 T;  2V7M A;  3T1H T;  2W2U A;  3L3P A;  4DBR A;  1M7K A;  5ADX L;  4YFS A;  3AE2 A;  4IDZ A;  3RC3 A;  2QA7 A;  4MAL A;  3MZK B;  5LP6 E;  2VVS A;  2OA5 A;  5L3D B;  5J5G A;  5JDG A;  4JUY A;  2FJD A;  3AE7 A;  3ETU A;  4CXY A;  2SPC A;  2BKN A;  3AA0 B;  1HCI A;  2W66 A;  2LT3 A;  2H3R A;  5IWA T;  3CX7 B;  3UU3 A;  5LG3 A;  4X1K E;  5EK4 A;  1D0X A;  1IBK T;  4ZZB A;  1MMD A;  3SWH A;  3EDV A;  1MMG A;  1MIW A;  5LMU T;  1XMO T;  2WDQ A;  3MA9 A;  2R6G F;  3EUH A;  3KIN B;  2W8G A;  3SRZ A;  3CQC B;  4WYV A;  3LBX A;  2CWY A;  4DV4 T;  1W0A A;  3PUZ F;  4E7S A;  3ZT6 A;  3Q5X A;  3PUG A;  2W8F A;  2KXP B;  3WTJ A;  3U3I A;  1FMV A;  2JJ9 A;  2IHR 1;  2CXD A;  3U8L A;  5J5F A;  4KMC A;  2BKP A;  5HWX A;  4ISS A;  3F31 A;  4XBF B;  3VKG A;  2XZ5 A;  2ODU A;  3VR8 A;  3NKZ A;  2BG9 B;  2RA1 A;  1XWM A;  4PFO A;  2XQ5 A;  4UEM A;  3A7M A;  3HR0 A;  2BVL A;  2J47 A;  5KX5 E;  3JAD A;  4IRE A;  2UXN B;  4U74 A;  2LOS A;  3OJA A;  4B3S T;  2BR7 A;  1G8X A;  5AFN A;  5SYO A;  1NAF A;  1E2A A;  3F2E A;  1HG2 A;  4F6R C;  3RYH E;  1UX4 A;  4GOU A;  4YY3 T;  4ANJ A;  2CRB A;  2L9Q A;  5HXH A;  4Z91 A;  3UQ4 A;  4UF0 A;  2XYT A;  5JVD E;  2XTL A;  4ILB A;  1L0V A;  4GK0 E;  4EGW A;  2LM2 A;  3MKD A;  3JCF A;  3CVR A;  4UR9 A;  5CFB A;  1J5W A;  3NVO A;  4H9S E;  3N9M A;  1T72 A;  3QOF A;  2UU9 T;  4AKG A;  2MOZ A;  4JBW F;  4CI1 B;  2WZI A;  3FBZ A;  2BG9 C;  5HEH A;  3WIP A;  4OFZ A;  2KZ7 B;  3FBL A;  5JDH A;  4DR5 T;  2D2S A;  4IIJ E;  2UXD T;  5LJN A;  3AEA A;  4YHJ A;  3RIA A;  4ZS3 A;  3AE4 A;  5KDM C;  4TNW A;  4LFB T;  2DNX A;  2HN2 A;  4EXT A;  3GMI A;  5JDN A;  4XHE A;  4YXD A;  4DND A;  2BZB A;  4FJO A;  4QWN B;  4O2B E;  2XAH B;  5L3C B;  3HKC E;  4TV8 E;  2EHO A;  4QH4 A;  1ZKE A;  2WWV A;  3C4X A;  4DBM A;  2FJE A;  4UXU A;  3AA6 B;  4H9O C;  4AQY T;  2CCQ A;  1OED B;  3SFE A;  5FMN A;  4GK5 E;  4HFI A;  2VK9 A;  3CQG B;  3WTM A;  4X66 T;  2X67 A;  3K8P C;  3SQ6 A;  4CI2 B;  1MMA A;  1WR0 A;  2XZE A;  3RHW A;  3CQX C;  3WI3 A;  5AQQ B;  3TLU A;  5TVC A;  3CIR A;  5FXV A;  2CHN A;  4YSZ A;  1CUN A;  4IE7 A;  5AQP B;  2KSR A;  4AI6 A;  3QUJ A;  3P4W A;  3AA1 B;  3P7I A;  1J1J A;  4EOZ B;  2H7V C;  2XAQ B;  3PUA A;  5AIN A;  4QAA A;  2YDS A;  5FNV E;  2E9X C;  2BYN A;  3N9O A;  2CXL A;  1HNX T;  5FP3 A;  5CB4 E;  2VAS A;  1N32 T;  2RPA A;  4ASK A;  2WMN A;  1FJG T;  5CJ5 A;  5AFU L;  2LM9 A;  5AFJ A;  2XAS B;  1WR6 A;  2BS3 A;  1BR4 A;  1X79 A;  4Q25 A;  5KMG P;  2E5V A;  2XHE B;  3N2O A;  4LML A;  4DMV A;  5L4H A;  3RIU C;  1YQ4 A;  5BW2 A;  2VL8 A;  3A8Y C;  2I0M A;  3T8O A;  4QAC A;  2C0S A;  2LRK A;  4AIS A;  4HWF A;  4IT4 A;  3H37 A;  2XNU A;  1XDP A;  3K3N A;  2LRL A;  5LBM A;  3SH1 A;  4I55 E;  2LSJ A;  5DJQ C;  4U3C A;  5ABH A;  2VQE T;  4H9Q C;  3AE8 A;  1YKE B;  1QLB A;  5FJV A;  1I94 T;  3ZSS A;  5AQK B;  2ES0 A;  4PK6 A;  4IL4 A;  2A2F X;  2X0L B;  3SOL A;  2BJ0 A;  2YDQ A;  5FXX A;  2F4V T;  5AQG B;  3ZKR A;  1NWM X;  3ZCJ A;  1ZV4 X;  1FEW A;  5KE4 A;  1XZY A;  2ACX A;  2LSY A;  5FL0 A;  2GK9 A;  4MBQ A;  2M6I A;  1B7T A;  4DV2 T;  1UX2 A; 
#chains in the Genus database with same CATH homology
 2LKH A;  2BG9 A;  3RI5 A;  5AFJ A;  2XQ9 A;  4ALX A;  3LSV A;  3UU6 A;  3C79 A;  4TNW A;  2XNV A;  4UM1 A;  2BR8 A;  2WN9 A;  3WTI A;  5BP0 A;  5L47 A;  2XZ5 A;  5HCJ A;  4D01 A;  2PGZ A;  5IUX A;  1UW6 A;  4AFH A;  4HFD A;  2YMD A;  2WNL A;  3WTN A;  4HFB A;  2BG9 B;  4XHE A;  4QAB A;  3U8K A;  2XQ5 A;  3RQU A;  4A97 A;  5J5I A;  4LML A;  5AFH A;  1UV6 A;  5HEO A;  5L4H A;  2X00 D;  5BW2 A;  3P50 A;  3JAD A;  4HFC A;  5AFK A;  3GUA A;  4HQP A;  4IRE A;  4EZ1 A;  3EHZ A;  1OED A;  4QAC A;  4QH4 A;  3UU5 A;  4ZK1 A;  2BYR A;  5AFM B;  4AFT A;  3TLT A;  4NPP A;  2BR7 A;  2ZJV A;  5HEG A;  5AFN A;  4LMK A;  2YN6 A;  5SYO A;  4PIR A;  5J5G A;  4UXU A;  4DBM A;  5HCM A;  5J5F A;  2YKS A;  2Y7Y A;  1OED B;  4NZB A;  3U8J A;  4HFE A;  4ZZC A;  5HEJ A;  2XNU A;  4WV9 A;  1OED C;  2YOE A;  4HFI A;  2M6B A;  4ILA A;  4ZJS A;  2LLY A;  2XNT A;  4BFQ A;  5HEU A;  3WTM A;  4TNV A;  2WNJ A;  4TWD A;  4UM3 P;  3SH1 A;  3UU3 A;  5LG3 A;  3JAE A;  2UZ6 A;  4HFH A;  4ILC A;  4IL9 A;  3SIO A;  4Z91 A;  3RIF A;  3UU8 A;  2Y57 A;  3UQ4 A;  2XYT A;  3WTH A;  4ZJT A;  4X5T A;  4ZZB A;  5FJV A;  2VL0 A;  3SQ6 A;  2ZJU A;  3WTL A;  4ILB A;  4Z90 A;  3PEO A;  5BRX A;  2YME A;  3RHW A;  4UM3 A;  4UM3 S;  3PMZ A;  4FRR A;  3IGQ A;  4F8H A;  2LM2 A;  4IL4 A;  4ZRU A;  2MAW A;  4ZR6 A;  3ZDH A;  4A98 A;  5CO5 A;  3TLU A;  4TWF A;  2Y54 A;  5TVC A;  2BJ0 A;  5AFL A;  4LMJ A;  4QH1 A;  3TLS A;  5CFB A;  2QC1 B;  2XQ8 A;  3WTK A;  5KZU A;  5L4E A;  5J0Z A;  5J5H A;  2W8G A;  3TLV A;  5LXB A;  3JAF A;  2BYQ A;  3ZKR A;  2XYS A;  3WTO A;  3UUB A;  3ZDG A;  2KSR A;  2PH9 A;  2XQ7 A;  3TLW A;  2X00 A;  5AFM A;  3C84 A;  3SQ9 A;  3EI0 A;  2C9T A;  3P4W A;  4XK9 A;  1I9B A;  2XQ6 A;  2BYP A;  4BQT A;  2WZY A;  2WNC A;  3RQW A;  5AIN A;  2BG9 C;  4QAA A;  5KE4 A;  5HEH A;  4COF A;  3UU4 A;  3WIP A;  2Y58 A;  4ZK4 A;  2XQ3 A;  5JME A;  2XZ6 A;  2XQ4 A;  4UY2 A;  4QH5 A;  3U8N A;  2BYN A;  4B5D A;  2W8F A;  4AFG A;  4TWH A;  3WTJ A;  3EAM A;  3UQ7 A;  2LKG A;  3T4M A;  2Y56 A;  2BG9 E;  2M6I A;  2BYS A;  2XQA A;  3RIA A;  3U8L A;  3U8M A;  1OED E;  1UX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...