5J0ZA

Crystal structure of glic in complex with dha
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Proton-gated ion channel
publication title Crystal Structure of membrane protein.
rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
total genus 87
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5j0zA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j0zA01
2WNCA 2W8GA 1OEDB 4ILBA 5HEUA 2YOEA 4UM1A 4ZJSA 2LKGA 3JAEA 3UU5A 3UU6A 1OEDA 2KSRA 2WNJA 5J5GA 4BFQA 4BQTA 5HCMA 2C9TA 3U8NA 3RQUA 2BYQA 5AFKA 5J5IA 3SQ9A 2BYNA 3SH1A 3SQ6A 2WNLA 4TNWA 5HEHA 2Y57A 5HEGA 2YN6A 4HFCA 4QAAA 4ZK4A 3WTNA 4B5DA 5JMEA 4UM3S 4F8HA 4XK9A 3TLVA 2XNUA 2XZ6A 3UQ4A 4COFA 5HEJA 3C84A 4ZZBA 2Y54A 5HCJA 5CO5A 3PEOA 5AFHA 3WTLA 1OEDC 5CFBA 3TLWA 2ZJVA 4LMJA 2XQAA 3EHZA 2X00D 2XYSA 3WTHA 4TNVA 4FRRA 5KZUA 2WZYA 3PMZA 2LKHA 4NPPA 2YMEA 2ZJUA 3U8KA 2BYSA 4XHEA 4HFDA 3ZDGA 5AINA 2XQ4A 4HFBA 4D01A 4QH5A 4ALXA 2XQ8A 4TWHA 4ILAA 3GUAA 3WTMA 4IL9A 4IL4A 5J5HA 4ZJTA 2YMDA 5BRXA 3U8JA 2BG9C 4TWFA 4HFHA 4UM3A 2BYPA 3WTKA 2PH9A 5BW2A 4LMKA 2XQ7A 4UM3P 4HFIA 2M6IA 5LG3A 3ZDHA 2BYRA 4Z90A 5AFJA 1UW6A 3T4MA 4QABA 3C79A 1I9BA 2BG9E 2XQ6A 3WIPA 2Y58A 5J5FA 1OEDE 4Z91A 4ILCA 5LXBA 4ZR6A 1UV6A 2BR8A 2XQ5A 3WTOA 4TWDA 2WN9A 3WTIA 3SIOA 4LMLA 3LSVA 5SYOA 2VL0A 3P50A 2XYTA 3UU4A 2XQ3A 3RHWA 4AFTA 3P4WA 3JAFA 1UX2A 4A98A 2XNVA 5L4EA 3TLSA 4PIRA 4ZK1A 5BP0A 4NZBA 4QACA 3WTJA 5HEOA 2X00A 2XQ9A 5L4HA 2BJ0A 3U8MA 4A97A 2LM2A 2PGZA 2W8FA 4AFGA 2XZ5A 5AFMB 3RI5A 2M6BA 3RQWA 5IUXA 5AFMA 4HQPA 4AFHA 5J0ZA 4ZRUA 3UUBA 5KE4A 3TLUA 5AFLA 4WV9A 5TVCA 4QH4A 4EZ1A 2YKSA 2Y7YA 3UU8A 5L47A 3IGQA 3JADA 4UXUA 4IREA 3ZKRA 2XNTA 3TLTA 4X5TA 3UU3A 3RIAA 2MAWA 2BR7A 2QC1B 4QH1A 3U8LA 2Y56A 4ZZCA 5FJVA 3UQ7A 5AFNA 2LLYA 4DBMA 2BG9B 3EI0A 3RIFA 4HFEA 4UY2A 2UZ6A 2BG9A 3EAMA
chains in the Genus database with same CATH superfamily
2WNJA 4F6RC 3ZYLA 5J5IA 4DV5T 2KNDA 1MMDA 2N9DA 2XNUA 5J1GA 4DV0T 4OYKA 1QUUA 3L3PA 4YJ3E 1VCSA 4LMJA 1MNDA 2XSBA 2H88A 2LKHA 2YMEA 3U8KA 1WFDA 4DBRA 2NW8A 2OV9A 4PK6A 3C4ZA 3B13A 5EK2A 3KINB 1MIVA 3U8JA 2BG9C 4AIUA 5BW2A 3HKBE 1Z8UA 3RIUC 2KINB 1I9BA 4HKAA 2CE7A 1QLBA 2YU2A 3AXJB 2E9XB 1FIOA 4E7ZA 3N9MA 3RHWA 1UX4A 2MBGA 4JI6T 1YD8G 2VURA 1O3XA 5JREA 2W8FA 1GQEA 3FHNA 5LHGB 4U72A 1HNWT 4EEBA 1S35A 4ZS2A 3AEGA 3ANWB 1Y01A 4YHJA 4QH1A 4BA9A 3UQ7A 2KWHA 5AQLB 4GYRA 2BVLA 4FI5A 2E9XC 4DR1T 4L0RA 3AA1B 5CJ5A 4H63H 5FXVA 1HCIA 3I9WA 3PURA 2WDQA 2UU9T 4IE5A 2ACZA 3CX6B 5CA0E 2IUBA 3H3AA 2IIUA 2XQAA 3Q2MA 4TNVA 3P7IA 2MTQA 2JRKA 3PUWF 1QSDA 3PTRB 3AE7A 1R8IA 4OK0A 1MMNA 5AQQB 3UUXB 4DMVA 5J5HA 4ZJTA 5BRXA 1YXRA 3N5LA 4DV1T 5ABGA 2D5UA 1BR2A 2CM0A 5J5FA 5CGMA 3S4UA 3FZLB 2XYTA 4AFTA 4A98A 2CHNA 2XJ7A 5ADXL 3EVYA 4HWIB 2UUCT 2ZM6T 2F4VT 4QKNA 4JI0T 2V7MA 3EDVA 4AKHA 2W67A 4WYVA 2Q9QA 4EZ1A 2RPAA 4UXUA 2VB6A 3H3MA 2MAWA 2AXDS 3EAMA 2WNCA 2JPFA 3UU5A 2BS2A 2LSJA 4F8HA 5HEJA 1E1HB 5L3FB 2H89A 2I6HA 5AFHA 3E22E 4H9NC 2A2FX 3U3IA 3NRXA 1CHUA 3SFEA 1X79A 2DL1A 5LGUB 5HXSA 1YKEB 2W66A 2M67A 2VVNA 2K3WA 1VRBA 4WNKA 2LOPA 3A8YC 4DR7T 5GONE 5FYMA 4YTPA 2KZ7B 1UV6A 2BR8A 2XQ5A 5FKYA 3AE4A 3UU4A 3CPZA 5HXCA 4PJMA 5JTGA 3RH3A 2RP4A 2X9HA 4PW8A 5BP0A 5LMNT 3KV9A 3UUMA 1XMQT 3RC3A 1N36T 2XAGB 4AFGA 3GWHA 2XAFB 4UIGA 4O4LE 1JNZA 5AFLA 2Q9QB 1WLXA 3V5UA 3UUNA 4DV7T 2J47A 5TAOA 3OVUA 3UU3A 3OJAA 5LP6E 3ETUA 2V5DA 5LGTB 5AFNA 4KHPT 3R84B 2W4XA 3MZKB 3PV0F 3GMIA 4ZI2D 4B3TT 3CKDA 4QWNB 4ANJA 3HI2A 2C5JA 3QNUA 4PJLA 1BR4A 2K48A 2D0TA 2LSKA 5CFBA 2ZJVA 1L0VA 5HXRA 2Q9QC 3DP7A 5HWXA 4YSZA 3ZDGA 2XQ4A 3K3QC 2UXDT 4UVAB 4YTNA 5FY1A 2Y6XA 2BBHA 3KVBA 1FMWA 1WR6A 2FUPA 4JUYA 4ZR6A 2LHRA 3H37A 4LMLA 4EGWA 2E5VA 2XQ3A 3ZT5A 4WBOA 1ZHCA 2VQET 2V6XA 2V7JA 5FL0A 5HEOA 3U8MA 4EEDA 2N1GA 5KMGP 3FZKB 3AEEA 2C5IT 2VKDA 3U78A 1OWAA 1FEWA 5FXWA 1SA0E 5TVCA 2YKSA 2CXLA 3UU8A 4AI6A 4TV8E 1D1BA 5DABA 2MYSA 4U7YA 1HX8A 2WQYA 1W09A 5LGNB 1J5ET 2D0UA 4KUMB 4X1IE 4X64T 3MACA 4YSXA 2WZHA 2C9TA 2WBLA 2WNLA 4ZK4A 2V5CA 3M3ZB 2D2SA 2CPTA 1T8BA 5JH7E 2BKPA 3X1DA 3LDQB 2X0YA 2LOSA 2IW5B 3HKEE 2W62A 3B57A 4UXNB 1XNRT 4D01A 3GA8A 2HN2A 4ALXA 5JDNA 2Z6EA 3N2GE 5AQUB 4HFHA 5FMNA 4ERRA 4I55E 5EK3A 2BYRA 4Z90A 5AFJA 3PUAA 5LXTE 4QABA 2XHEB 2JMKA 4X65T 3ZYMA 3ZSTA 2WM9A 3RYIE 1FJGT 2BVMA 3CWZB 3P4RA 2JQKA 2XNVA 3CX7B 4TZ4C 3E08A 2LRLA 4DUYT 4OX9T 1UUSA 5A1LA 3FZHB 2EHOD 2XZ5A 2WDVA 5IUXA 2CWOA 4JI5T 3AAEB 2VWAA 3AE6A 4IDPA 3MA9A 2FJBA 2UUBT 2MPKA 3CQGB 5ETWA 2CRBA 3RIAA 3PUSA 3VKGA 4ZZCA 4YY3T 2DCFA 3N2KE 4HFVA 4BQTA 4KBMB 2BYQA 3L09A 3A7MA 2UXCT 5JMEA 5ABHA 2QA7A 3QC9A 2LHNA 4HWFA 2V7KA 2Y48B 3ZEFB 2CMRA 4WZXA 5F8PA 2CHOA 4FRRA 3AE9A 3ONLC 4EYYR 1NENA 2RA1A 4HFBA 2PJQA 3OYXA 2AE9A 4PK5A 5AFUL 2FBWA 2KT9A 3I9YA 5LG3A 3D0TA 1XDPA 1G73A 1VCTA 5FL1A 2WMOA 2XQ6A 4LF9T 3GN5A 4EXTA 2LSGA 4ILCA 3RLFF 1MMAA 5AQKB 2WS3A 3F31A 4NZBA 2WSSV 4EOZB 5AQTB 4JBWF 2X00A 4Q25A 4AQFA 4DNDA 4EZ4A 2ZLYA 4GIWA 4ILUA 5DQVA 4U3CA 3UUBA 3TLUA 3AE1A 5FXZA 2H7VC 2ODUA 5L47A 3K3NA 5AQIB 2UXXB 2FJEA 2XNTA 2Y56A 5J2TE 3Q5EA 5JDFA 2WMNA 4ZJSA 4ILBA 4IDZA 1YQ4A 2X0LB 3SQ9A 4JI8T 3I0OA 2BYNA 4NXMT 4ZI3C 2CCQA 3T1HT 4QXCB 4LFBT 4P0AA 2OLTA 2YDQA 1D1AA 4COFA 3PUYF 2ES0A 2W2UA 3WAJA 5KXJA 3RRWA 4TX5A 4MBQA 2CBJA 3KV6A 3TKLB 4NPPA 3AECA 2BYSA 4GOUA 2BS4A 4HWDA 4C91A 1IJ5A 5AINA 4DV4T 3ZT7A 1W0AA 3AEBA 3VR8A 2XM1A 1MIYA 2NR4A 3R6NA 5L3BB 1J5WA 4QX7B 2A72A 4HFIA 2M6IA 4B3RT 5FNVE 3GN5B 3C4WA 1HG2A 4FJOA 4EYUA 2LM9A 5L3EB 4IGUA 4JEUB 3BK9A 4IHJE 4UVBB 4H63V 3JC6D 3WTJA 1HG5A 4LFCT 3DJBA 4CI1B 1M62A 2JMHA 4I43B 4ZHQE 2WB5A 3OBVE 2W63A 3V5SA 3C98B 4M1PA 2CXFA 4IREA 3TLTA 4DR2T 3FZMB 2A3DA 5AQHB 4CN1A 5JDGA 2UZ6A 3G06A 2XPKA 5HEUA 4UM1A 3IA3A 1UURA 4J2CA 1N34T 4P0BA 3AVSA 4B5DA 4HFCA 3LFMA 5JRCA 4AXPA 2XM2A 3C64A 5CO5A 4O4IE 4ZI7E 4AQFC 4O2AE 3NKZA 2V6YA 3AE2A 3P4SA 3VKHA 4DVDA 4EV6A 2XAJB 4UV8B 2DI4A 3LK2B 3MK7C 5BMVE 4G2AA 2CXDA 2G0UA 2X0HA 3RKGA 1IBMT 3RYFE 2KWIB 4UM3A 2VQFT 2XQ7A 3I0QA 5CA1E 3LK3B 3OKQA 3T4MA 2ZM8A 3EUHA 3PUQA 1LVFA 3CMLA 1EZ3A 3N9LA 2WZIA 4XAXB 1XNQT 3AE5A 3LK42 4NUUA 1XMOT 1I6ZA 4ISSA 4G63A 4CI3B 2JIWA 3AE3A 1T7SA 3RX6A 3QUJA 2DHRA 5J0ZA 1HNZT 1IJ6A 4WV9A 3F2EA 4QH4A 2K24A 3KVAA 4PNIA 3ZKRA 1SE7A 2QC1B 3EI0A 3IBPA 1WYCA 2DNXA 4LFAT 2X9WA 2V1DB 2NWBA 2LKGA 1IZNB 2KSRA 2JQHA 4BFQA 4L5GA 3K8PC 1NEKA 5JRCB 4BJMA 2E9XD 3AAAB 3ZN0B 2IAKA 2Y54A 4X20E 3FBLA 1B7TA 4U74A 3TLWA 5IWAT 2V6YB 4TN7B 5HXEA 4U7IA 1IAPA 1WCRA 5C8YE 2WZYA 3ZMZB 2CBIA 1WRDA 4GKJT 3ETVA 4UR9A 3QB5A 2VL8A 2OA5A 1U5PA 4H9OC 2DWGA 2XY8B 2BYPA 3WTKA 3SFDA 2WAUA 3I1AA 5M4YA 3VRBA 3N9QA 4ISTA 2NOXA 4CZZB 4LF5T 3WTIA 4TWDA 4K0KT 2CLYB 2VL0A 3O1JA 2IC9A 4DBQA 5BR8T 2ODVA 5L4EA 3WI3A 3KV5A 3VU7H 4OHFA 2HN1A 4MFRA 4PJNA 4OYJA 3FZFB 3JADA 2NTXA 3PJAJ 2HHHT 5LNKA 2WU2A 1CUNA 4JI3T 2I0MA 3O4XE 2VASA 2W8GA 2CLYC 3AVRA 2MOZA 2ZM0A 4IE7A 2YDRA 3ZC0A 4AKIA 4TNWA 3NBXX 3C84A 2YINA 1W9RA 3UTKA 1OEDC 2KLQA 3OYZA 3EHZA 4JI2T 2XYSA 1KK7A 5EK4A 3KV4A 1US7B 4YJ2E 1KNRA 2HH7A 4U33A 4BJNA 4QXHB 5LJMA 4ADZA 3JCFA 4DV3T 3CK6A 5FY7A 4DIDB 4LF8T 2NW7A 3M65A 2QRXA 2J4GA 4DR5T 3HKCE 1XZYA 4C90A 3QB5K 4IT4A 1OXZA 3PDYA 3BQIA 3LJCA 1OEDE 3N9PA 2YU1A 3RF1A 2PBIA 4N78D 2ZMAA 1UX2A 4KX6A 2LE8A 1E2AA 2BBJA 5KDMC 3WAKA 3BQLA 5AQGB 3NWIA 3RI5A 4I0UA 2M6BA 1Z0PA 5AFMA 5JDLA 5AQVB 1W0BA 3PU3A 5AQJB 3LG7A 3HKDE 5FXXA 4PFOA 2XUEA 2X9XA 3F57A 1UX5A 1KNPA 2W0GA 3OTOT 4CN6A 2BS3A 1NAFA 4TV9E 3KBTA 1HR0T 3AA6B 3OPCA 5KX5E 4JYAT 2Y57A 3RRCA 4QAAA 3UQ4A 3NVOA 4CI2B 2LSYA 2CA5A 4PK4A 1KEYA 2FJAA 4YXDA 2WWUA 3PMZA 2ZJUA 3HR0A 4DV2T 4HFDA 4XBFB 1WR0A 2CWYA 2XQ8A 2X67A 4WW0A 4PFPA 2Q9QD 4MLKA 4UELA 2YMDA 3W15B 3QK6A 3P4PA 4MALA 1YKHB 1D0YA 4B3MT 4HE8A 3KFWX 4PJJA 3AEFA 3RC8A 3WTOA 3B5MA 3L39A 1IBKT 5HYAA 2Y8DA 3QOFA 2KXPB 2C0SA 2BJ0A 4AQYT 2L8KA 2PGZA 2K9AA 5AFMB 4LF6T 2XASB 3N9OA 2XZEA 4IIJE 4KMCA 3N2OA 5LOVE 4P1NA 2ACXA 4DBMA 3ZCJA 4UY2A 3T1YT 4LF7T 3RGLA 3U8NA 3J9X1 3RQUA 5AFKA 5HXHA 2L3LA 3SQ6A 5HEGA 2YN6A 1BR1A 2ZM2A 2P9BA 1AJ3A 3TLVA 3ZMTB 2YK0A 1KNZA 1HNXT 2W00A 2H3RA 3FB2A 5C3JA 5JDMA 4A5XA 3P4QA 4AKGA 2K5BB 4CQIA 4JI7T 5DJQC 2XSAA 3ZN1B 4JLEA 3WTMA 4ILAA 4AQGA 2HPLA 4YHHT 2DWKA 1KF6A 4HGAA 4TWFA 2PH9A 4LMKA 3ZMSB 3C79A 3NZQA 4GYSA 2BG9E 4P09A 2UXBT 3BQKA 2Y58A 1U4QA 4IDQA 3HL6A 5LXBA 3EDUA 4JEHB 5F5WA 5JQGE 2VK9A 2QVAA 4PIRA 1S94A 1KFYA 1T98A 1HFAA 2X9YA 5L4HA 3FXDB 4YSYA 1ZP0A 3J7Yq 3ZYKA 4YT0A 4IDNA 4ZOLE 3RQWA 4E7SA 5ABEA 2XTLA 2UUAT 5DQWA 3IHRA 4NUVA 5AQSB 4B3ST 3MXZA 5LJNA 5FVLA 5AQOB 2BR7A 3ZLIA 5J2UE 4ZI2C 5L3GB 2C5KT 2VKOA 3UFGA 3RIFA 2XAHB 3L8RA 4QX8B 3UU6A 1YW0A 3JAEA 3VRAA 3SS1A 5JDHA 2V7LA 2V8SV 1ZKEA 3CX8B 4DUZT 2WWVA 4XK9A 1X9BA 4ZZBA 4CN4A 3PEOA 3AEDA 3WTLA 3O9XA 5LCYA 2BKNA 2WP9A 3UT5E 3C4XA 4X1YE 3AB3B 4UEMA 2EHOA 2PTFA 3NZPA 4WBNE 2JJ9A 4DV6T 5H6RB 3GUAA 4X1KE 4JI1T 5JDQA 2WCAA 4KHZF 4UM3P 2NP9A 4K0UA 3Q9DA 1DU2A 3UFEA 2PG8A 4O4HE 4H9RC 3E0ZA 3KBUA 3KDSE 5JVDE 4YLHA 4ZS3A 4LF4T 4IDOA 5E0OA 5L3DB 4O2BE 3ZMVB 4CXXA 2WDRA 2L9QA 5ABFA 2E5LT 3JAFA 3A5XA 4YTMA 3N9NA 5AQRB 4KP3C 4TUYE 3AAIA 3PE0A 4A97A 3EABA 5FY0A 3K3OA 4HEAA 1LVKA 4AFHA 4IE6A 4UF0A 4HTEA 3Q5WA 2LJLA 4ZXLA 2Y7YA 5LYJE 2HPJA 4X5TA 5LBQB 2BDEA 4I4TE 1D0ZA 1HS7A 3VHLA 4DR6T 1ZV4X 2PFVA 5H6QB 3U8LA 3PUGA 1OEDA 3RYCE 4UV9B 3CVRA 1NWMX 3SH1A 1XDOA 1I94T 4OFZA 4EB6E 5LHIB 2XZ6A 2GK9A 4ZI3D 3PJAA 4NIQA 2V7IA 3CQXC 3NRYA 2XQYA 4QHOA 2B1EA 2J1DG 3ZPOA 3PUZF 1Y64B 2EHOB 3O1IA 3ZT6A 1SHZC 4XHEA 1ZEEA 3P8CD 4IE4A 4IE0A 2IC6A 4IL9A 1FMVA 1BR0A 5LBMA 3MJXA 5HWYA 4PAGA 2E2AA 2D9DA 2IDOB 5LA6E 3AA0B 3SRZA 5AQFB 5JR9A 4NXNT 3T8OA 3SIOA 5ABFB 4GK5E 2FJDA 3C50A 3CQCB 4YFSA 3UULA 3Q5DA 2SPCA 3TLSA 2EHOC 5LHHB 5IHYA 4XZCA 2X66A 4U31A 4GK0E 2LSIA 4CXWA 4JV5T 2LM2A 5FP3A 3RPUA 2J62A 4UF0B 4HQPA 2JQ9A 4ZRUA 4KI0F 3ZJ2A 4BAYB 1N33T 3ZJ1A 4O4JE 2LLYA 1HX1B 4HFEA 5EZYE 3ZMUB 3FXEB 1OEDB 2W61A 5J5GA 5HCMA 4ASKA 1JNRA 2KMFA 3LBXA 5HEHA 3WTNA 2JQQA 4UM3S 4X66T 4V1Av 3FBZA 5L2LA 3K1SA 1UGOA 1SUMB 2E8IA 1N32T 2X00D 2XAQB 2BKOA 1E7PA 1UK5A 2IMLA 1MIWA 3O1HA 2A9UA 4QH5A 2B76A 2WU5A 3PUVF 2NTYA 3ZC1A 5HAXA 1MMGA 4EIWA 1M7KA 1XWMA 2BZBA 2LRKA 4UVCB 1UW6A 4HWCA 5IYZE 1ZOYA 4U2ZA 5JR9B 3PUXF 4HWHA 3DTOA 2YEVC 3LSVA 1YQ3A 3Q5XA 1HTJF 3MKDA 5LG4A 3SOLA 2YDSA 4X62T 3AEAA 3IF8B 4QXBB 2VKHA 1UCUA 3ZCIA 4I50E 4DR3T 5KE4A 2NW9A 1IBLT 4DO0A 2IHR1 2V26A 5C2TA 1G8XA 2I59A 4JI4T 5JR9C 5FJVA 3C51A 4DR4T 4MHCA 3VR9A 5AQMB 2BG9A 5AQNB 2YOEA 3LBXB 3RIUA 1LRZA 3ESLA 3RKOA 5CB4E 5HCJA 3ONXA 4L9IA 4EAHA 1V9DA 4A56A 4AKLA 4H9QC 2X51A 2R6GF 3WTHA 5KZUA 3RYHE 2X68A 4DMWA 4GKKT 1J1JA 5LMUT 5FVKA 2QYWA 1VOMA 3AE8A 4HN9A 1HF8A 2DLRA 3CIRA 4TWHA 5F3JA 4IL4A 4H9SE 2LT3A 3SWHA 4ZEYA 3ZDHA 3ONJA 3PU8A 4O8SA 4AISA 3ZSSA 3WIPA 3HA4A 1D0XA 4Z91A 4AKRB 5L3CB 3AXJA 3IEEA 2WN9A 2VKJA 2E9XA 5SYOA 1WYBA 3JC6C 3P50A 3P4WA 4ZK1A 4QACA 1D1CA 2LEHA 1H7CA 2XQ9A 4EZHA 4B6XA 2N2NA 4CXYA 4Z8XA 1LKXA 1T72A 2CEAA 5LB7B 4U2YA 2H7OA 2UXNB 5AQPB 2QGSA 3IGQA 3ANWA 3AA7B 1MNEA 3ABVA 2VVSA 2WY2A 4H9PC 2BG9B
chains in the Genus database with same CATH topology
2WNCA 2W8GA 1OEDB 4ILBA 5HEUA 2YOEA 4UM1A 4ZJSA 2LKGA 3JAEA 3UU5A 3UU6A 1OEDA 2KSRA 2WNJA 5J5GA 4BFQA 4BQTA 5HCMA 2C9TA 3U8NA 3RQUA 2BYQA 5AFKA 5J5IA 3SQ9A 2BYNA 3SH1A 3SQ6A 2WNLA 4TNWA 5HEHA 2Y57A 5HEGA 2YN6A 4HFCA 4QAAA 4ZK4A 3WTNA 4B5DA 5JMEA 4UM3S 4F8HA 4XK9A 3TLVA 2XNUA 2XZ6A 3UQ4A 4COFA 5HEJA 3C84A 4ZZBA 2Y54A 5HCJA 5CO5A 3PEOA 5AFHA 3WTLA 1OEDC 5CFBA 3TLWA 2ZJVA 4LMJA 2XQAA 3EHZA 2X00D 2XYSA 3WTHA 4TNVA 4FRRA 5KZUA 2WZYA 3PMZA 2LKHA 4NPPA 2YMEA 2ZJUA 3U8KA 2BYSA 4XHEA 4HFDA 3ZDGA 5AINA 2XQ4A 4HFBA 4D01A 4QH5A 4ALXA 2XQ8A 4TWHA 4ILAA 3GUAA 3WTMA 4IL9A 4IL4A 5J5HA 4ZJTA 2YMDA 5BRXA 3U8JA 2BG9C 4TWFA 4HFHA 4UM3A 2BYPA 3WTKA 2PH9A 5BW2A 4LMKA 2XQ7A 4UM3P 4HFIA 2M6IA 5LG3A 3ZDHA 2BYRA 4Z90A 5AFJA 1UW6A 3T4MA 4QABA 3C79A 1I9BA 2BG9E 2XQ6A 3WIPA 2Y58A 5J5FA 1OEDE 4Z91A 4ILCA 5LXBA 4ZR6A 1UV6A 2BR8A 2XQ5A 3WTOA 4TWDA 2WN9A 3WTIA 3SIOA 4LMLA 3LSVA 5SYOA 2VL0A 3P50A 2XYTA 3UU4A 2XQ3A 3RHWA 4AFTA 3P4WA 3JAFA 1UX2A 4A98A 2XNVA 5L4EA 3TLSA 4PIRA 4ZK1A 5BP0A 4NZBA 4QACA 3WTJA 5HEOA 2X00A 2XQ9A 5L4HA 2BJ0A 3U8MA 4A97A 2LM2A 2PGZA 2W8FA 4AFGA 2XZ5A 5AFMB 3RI5A 2M6BA 3RQWA 5IUXA 5AFMA 4HQPA 4AFHA 5J0ZA 4ZRUA 3UUBA 5KE4A 3TLUA 5AFLA 4WV9A 5TVCA 4QH4A 4EZ1A 2YKSA 2Y7YA 3UU8A 5L47A 3IGQA 3JADA 4UXUA 4IREA 3ZKRA 2XNTA 3TLTA 4X5TA 3UU3A 3RIAA 2MAWA 2BR7A 2QC1B 4QH1A 3U8LA 2Y56A 4ZZCA 5FJVA 3UQ7A 5AFNA 2LLYA 4DBMA 2BG9B 3EI0A 3RIFA 4HFEA 4UY2A 2UZ6A 2BG9A 3EAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNC A;  2W8G A;  1OED B;  4ILB A;  5HEU A;  2YOE A;  4UM1 A;  4ZJS A;  2LKG A;  3JAE A;  3UU5 A;  3UU6 A;  1OED A;  2KSR A;  2WNJ A;  5J5G A;  4BFQ A;  4BQT A;  5HCM A;  2C9T A;  3U8N A;  3RQU A;  2BYQ A;  5AFK A;  5J5I A;  3SQ9 A;  2BYN A;  3SH1 A;  3SQ6 A;  2WNL A;  4TNW A;  5HEH A;  2Y57 A;  5HEG A;  2YN6 A;  4HFC A;  4QAA A;  4ZK4 A;  3WTN A;  4B5D A;  5JME A;  4UM3 S;  4F8H A;  4XK9 A;  3TLV A;  2XNU A;  2XZ6 A;  3UQ4 A;  4COF A;  5HEJ A;  3C84 A;  4ZZB A;  2Y54 A;  5HCJ A;  5CO5 A;  3PEO A;  5AFH A;  3WTL A;  1OED C;  5CFB A;  3TLW A;  2ZJV A;  4LMJ A;  2XQA A;  3EHZ A;  2X00 D;  2XYS A;  3WTH A;  4TNV A;  4FRR A;  5KZU A;  2WZY A;  3PMZ A;  2LKH A;  4NPP A;  2YME A;  2ZJU A;  3U8K A;  2BYS A;  4XHE A;  4HFD A;  3ZDG A;  5AIN A;  2XQ4 A;  4HFB A;  4D01 A;  4QH5 A;  4ALX A;  2XQ8 A;  4TWH A;  4ILA A;  3GUA A;  3WTM A;  4IL9 A;  4IL4 A;  5J5H A;  4ZJT A;  2YMD A;  5BRX A;  3U8J A;  2BG9 C;  4TWF A;  4HFH A;  4UM3 A;  2BYP A;  3WTK A;  2PH9 A;  5BW2 A;  4LMK A;  2XQ7 A;  4UM3 P;  4HFI A;  2M6I A;  5LG3 A;  3ZDH A;  2BYR A;  4Z90 A;  5AFJ A;  1UW6 A;  3T4M A;  4QAB A;  3C79 A;  1I9B A;  2BG9 E;  2XQ6 A;  3WIP A;  2Y58 A;  5J5F A;  1OED E;  4Z91 A;  4ILC A;  5LXB A;  4ZR6 A;  1UV6 A;  2BR8 A;  2XQ5 A;  3WTO A;  4TWD A;  2WN9 A;  3WTI A;  3SIO A;  4LML A;  3LSV A;  5SYO A;  2VL0 A;  3P50 A;  2XYT A;  3UU4 A;  2XQ3 A;  3RHW A;  4AFT A;  3P4W A;  3JAF A;  1UX2 A;  4A98 A;  2XNV A;  5L4E A;  3TLS A;  4PIR A;  4ZK1 A;  5BP0 A;  4NZB A;  4QAC A;  3WTJ A;  5HEO A;  2X00 A;  2XQ9 A;  5L4H A;  2BJ0 A;  3U8M A;  4A97 A;  2LM2 A;  2PGZ A;  2W8F A;  4AFG A;  2XZ5 A;  5AFM B;  3RI5 A;  2M6B A;  3RQW A;  5IUX A;  5AFM A;  4HQP A;  4AFH A;  5J0Z A;  4ZRU A;  3UUB A;  5KE4 A;  3TLU A;  5AFL A;  4WV9 A;  5TVC A;  4QH4 A;  4EZ1 A;  2YKS A;  2Y7Y A;  3UU8 A;  5L47 A;  3IGQ A;  3JAD A;  4UXU A;  4IRE A;  3ZKR A;  2XNT A;  3TLT A;  4X5T A;  3UU3 A;  3RIA A;  2MAW A;  2BR7 A;  2QC1 B;  4QH1 A;  3U8L A;  2Y56 A;  4ZZC A;  5FJV A;  3UQ7 A;  5AFN A;  2LLY A;  4DBM A;  2BG9 B;  3EI0 A;  3RIF A;  4HFE A;  4UY2 A;  2UZ6 A;  2BG9 A;  3EAM A; 
#chains in the Genus database with same CATH topology
 2WNJ A;  4F6R C;  3ZYL A;  5J5I A;  4DV5 T;  2KND A;  1MMD A;  2N9D A;  2XNU A;  5J1G A;  4DV0 T;  4OYK A;  1QUU A;  3L3P A;  4YJ3 E;  1VCS A;  4LMJ A;  1MND A;  2XSB A;  2H88 A;  2LKH A;  2YME A;  3U8K A;  1WFD A;  4DBR A;  2NW8 A;  2OV9 A;  4PK6 A;  3C4Z A;  3B13 A;  5EK2 A;  3KIN B;  1MIV A;  3U8J A;  2BG9 C;  4AIU A;  5BW2 A;  3HKB E;  1Z8U A;  3RIU C;  2KIN B;  1I9B A;  4HKA A;  2CE7 A;  1QLB A;  2YU2 A;  3AXJ B;  2E9X B;  1FIO A;  4E7Z A;  3N9M A;  3RHW A;  1UX4 A;  2MBG A;  4JI6 T;  1YD8 G;  2VUR A;  1O3X A;  5JRE A;  2W8F A;  1GQE A;  3FHN A;  5LHG B;  4U72 A;  1HNW T;  4EEB A;  1S35 A;  4ZS2 A;  3AEG A;  3ANW B;  1Y01 A;  4YHJ A;  4QH1 A;  4BA9 A;  3UQ7 A;  2KWH A;  5AQL B;  4GYR A;  2BVL A;  4FI5 A;  2E9X C;  4DR1 T;  4L0R A;  3AA1 B;  5CJ5 A;  4H63 H;  5FXV A;  1HCI A;  3I9W A;  3PUR A;  2WDQ A;  2UU9 T;  4IE5 A;  2ACZ A;  3CX6 B;  5CA0 E;  2IUB A;  3H3A A;  2IIU A;  2XQA A;  3Q2M A;  4TNV A;  3P7I A;  2MTQ A;  2JRK A;  3PUW F;  1QSD A;  3PTR B;  3AE7 A;  1R8I A;  4OK0 A;  1MMN A;  5AQQ B;  3UUX B;  4DMV A;  5J5H A;  4ZJT A;  5BRX A;  1YXR A;  3N5L A;  4DV1 T;  5ABG A;  2D5U A;  1BR2 A;  2CM0 A;  5J5F A;  5CGM A;  3S4U A;  3FZL B;  2XYT A;  4AFT A;  4A98 A;  2CHN A;  2XJ7 A;  5ADX L;  3EVY A;  4HWI B;  2UUC T;  2ZM6 T;  2F4V T;  4QKN A;  4JI0 T;  2V7M A;  3EDV A;  4AKH A;  2W67 A;  4WYV A;  2Q9Q A;  4EZ1 A;  2RPA A;  4UXU A;  2VB6 A;  3H3M A;  2MAW A;  2AXD S;  3EAM A;  2WNC A;  2JPF A;  3UU5 A;  2BS2 A;  2LSJ A;  4F8H A;  5HEJ A;  1E1H B;  5L3F B;  2H89 A;  2I6H A;  5AFH A;  3E22 E;  4H9N C;  2A2F X;  3U3I A;  3NRX A;  1CHU A;  3SFE A;  1X79 A;  2DL1 A;  5LGU B;  5HXS A;  1YKE B;  2W66 A;  2M67 A;  2VVN A;  2K3W A;  1VRB A;  4WNK A;  2LOP A;  3A8Y C;  4DR7 T;  5GON E;  5FYM A;  4YTP A;  2KZ7 B;  1UV6 A;  2BR8 A;  2XQ5 A;  5FKY A;  3AE4 A;  3UU4 A;  3CPZ A;  5HXC A;  4PJM A;  5JTG A;  3RH3 A;  2RP4 A;  2X9H A;  4PW8 A;  5BP0 A;  5LMN T;  3KV9 A;  3UUM A;  1XMQ T;  3RC3 A;  1N36 T;  2XAG B;  4AFG A;  3GWH A;  2XAF B;  4UIG A;  4O4L E;  1JNZ A;  5AFL A;  2Q9Q B;  1WLX A;  3V5U A;  3UUN A;  4DV7 T;  2J47 A;  5TAO A;  3OVU A;  3UU3 A;  3OJA A;  5LP6 E;  3ETU A;  2V5D A;  5LGT B;  5AFN A;  4KHP T;  3R84 B;  2W4X A;  3MZK B;  3PV0 F;  3GMI A;  4ZI2 D;  4B3T T;  3CKD A;  4QWN B;  4ANJ A;  3HI2 A;  2C5J A;  3QNU A;  4PJL A;  1BR4 A;  2K48 A;  2D0T A;  2LSK A;  5CFB A;  2ZJV A;  1L0V A;  5HXR A;  2Q9Q C;  3DP7 A;  5HWX A;  4YSZ A;  3ZDG A;  2XQ4 A;  3K3Q C;  2UXD T;  4UVA B;  4YTN A;  5FY1 A;  2Y6X A;  2BBH A;  3KVB A;  1FMW A;  1WR6 A;  2FUP A;  4JUY A;  4ZR6 A;  2LHR A;  3H37 A;  4LML A;  4EGW A;  2E5V A;  2XQ3 A;  3ZT5 A;  4WBO A;  1ZHC A;  2VQE T;  2V6X A;  2V7J A;  5FL0 A;  5HEO A;  3U8M A;  4EED A;  2N1G A;  5KMG P;  3FZK B;  3AEE A;  2C5I T;  2VKD A;  3U78 A;  1OWA A;  1FEW A;  5FXW A;  1SA0 E;  5TVC A;  2YKS A;  2CXL A;  3UU8 A;  4AI6 A;  4TV8 E;  1D1B A;  5DAB A;  2MYS A;  4U7Y A;  1HX8 A;  2WQY A;  1W09 A;  5LGN B;  1J5E T;  2D0U A;  4KUM B;  4X1I E;  4X64 T;  3MAC A;  4YSX A;  2WZH A;  2C9T A;  2WBL A;  2WNL A;  4ZK4 A;  2V5C A;  3M3Z B;  2D2S A;  2CPT A;  1T8B A;  5JH7 E;  2BKP A;  3X1D A;  3LDQ B;  2X0Y A;  2LOS A;  2IW5 B;  3HKE E;  2W62 A;  3B57 A;  4UXN B;  1XNR T;  4D01 A;  3GA8 A;  2HN2 A;  4ALX A;  5JDN A;  2Z6E A;  3N2G E;  5AQU B;  4HFH A;  5FMN A;  4ERR A;  4I55 E;  5EK3 A;  2BYR A;  4Z90 A;  5AFJ A;  3PUA A;  5LXT E;  4QAB A;  2XHE B;  2JMK A;  4X65 T;  3ZYM A;  3ZST A;  2WM9 A;  3RYI E;  1FJG T;  2BVM A;  3CWZ B;  3P4R A;  2JQK A;  2XNV A;  3CX7 B;  4TZ4 C;  3E08 A;  2LRL A;  4DUY T;  4OX9 T;  1UUS A;  5A1L A;  3FZH B;  2EHO D;  2XZ5 A;  2WDV A;  5IUX A;  2CWO A;  4JI5 T;  3AAE B;  2VWA A;  3AE6 A;  4IDP A;  3MA9 A;  2FJB A;  2UUB T;  2MPK A;  3CQG B;  5ETW A;  2CRB A;  3RIA A;  3PUS A;  3VKG A;  4ZZC A;  4YY3 T;  2DCF A;  3N2K E;  4HFV A;  4BQT A;  4KBM B;  2BYQ A;  3L09 A;  3A7M A;  2UXC T;  5JME A;  5ABH A;  2QA7 A;  3QC9 A;  2LHN A;  4HWF A;  2V7K A;  2Y48 B;  3ZEF B;  2CMR A;  4WZX A;  5F8P A;  2CHO A;  4FRR A;  3AE9 A;  3ONL C;  4EYY R;  1NEN A;  2RA1 A;  4HFB A;  2PJQ A;  3OYX A;  2AE9 A;  4PK5 A;  5AFU L;  2FBW A;  2KT9 A;  3I9Y A;  5LG3 A;  3D0T A;  1XDP A;  1G73 A;  1VCT A;  5FL1 A;  2WMO A;  2XQ6 A;  4LF9 T;  3GN5 A;  4EXT A;  2LSG A;  4ILC A;  3RLF F;  1MMA A;  5AQK B;  2WS3 A;  3F31 A;  4NZB A;  2WSS V;  4EOZ B;  5AQT B;  4JBW F;  2X00 A;  4Q25 A;  4AQF A;  4DND A;  4EZ4 A;  2ZLY A;  4GIW A;  4ILU A;  5DQV A;  4U3C A;  3UUB A;  3TLU A;  3AE1 A;  5FXZ A;  2H7V C;  2ODU A;  5L47 A;  3K3N A;  5AQI B;  2UXX B;  2FJE A;  2XNT A;  2Y56 A;  5J2T E;  3Q5E A;  5JDF A;  2WMN A;  4ZJS A;  4ILB A;  4IDZ A;  1YQ4 A;  2X0L B;  3SQ9 A;  4JI8 T;  3I0O A;  2BYN A;  4NXM T;  4ZI3 C;  2CCQ A;  3T1H T;  4QXC B;  4LFB T;  4P0A A;  2OLT A;  2YDQ A;  1D1A A;  4COF A;  3PUY F;  2ES0 A;  2W2U A;  3WAJ A;  5KXJ A;  3RRW A;  4TX5 A;  4MBQ A;  2CBJ A;  3KV6 A;  3TKL B;  4NPP A;  3AEC A;  2BYS A;  4GOU A;  2BS4 A;  4HWD A;  4C91 A;  1IJ5 A;  5AIN A;  4DV4 T;  3ZT7 A;  1W0A A;  3AEB A;  3VR8 A;  2XM1 A;  1MIY A;  2NR4 A;  3R6N A;  5L3B B;  1J5W A;  4QX7 B;  2A72 A;  4HFI A;  2M6I A;  4B3R T;  5FNV E;  3GN5 B;  3C4W A;  1HG2 A;  4FJO A;  4EYU A;  2LM9 A;  5L3E B;  4IGU A;  4JEU B;  3BK9 A;  4IHJ E;  4UVB B;  4H63 V;  3JC6 D;  3WTJ A;  1HG5 A;  4LFC T;  3DJB A;  4CI1 B;  1M62 A;  2JMH A;  4I43 B;  4ZHQ E;  2WB5 A;  3OBV E;  2W63 A;  3V5S A;  3C98 B;  4M1P A;  2CXF A;  4IRE A;  3TLT A;  4DR2 T;  3FZM B;  2A3D A;  5AQH B;  4CN1 A;  5JDG A;  2UZ6 A;  3G06 A;  2XPK A;  5HEU A;  4UM1 A;  3IA3 A;  1UUR A;  4J2C A;  1N34 T;  4P0B A;  3AVS A;  4B5D A;  4HFC A;  3LFM A;  5JRC A;  4AXP A;  2XM2 A;  3C64 A;  5CO5 A;  4O4I E;  4ZI7 E;  4AQF C;  4O2A E;  3NKZ A;  2V6Y A;  3AE2 A;  3P4S A;  3VKH A;  4DVD A;  4EV6 A;  2XAJ B;  4UV8 B;  2DI4 A;  3LK2 B;  3MK7 C;  5BMV E;  4G2A A;  2CXD A;  2G0U A;  2X0H A;  3RKG A;  1IBM T;  3RYF E;  2KWI B;  4UM3 A;  2VQF T;  2XQ7 A;  3I0Q A;  5CA1 E;  3LK3 B;  3OKQ A;  3T4M A;  2ZM8 A;  3EUH A;  3PUQ A;  1LVF A;  3CML A;  1EZ3 A;  3N9L A;  2WZI A;  4XAX B;  1XNQ T;  3AE5 A;  3LK4 2;  4NUU A;  1XMO T;  1I6Z A;  4ISS A;  4G63 A;  4CI3 B;  2JIW A;  3AE3 A;  1T7S A;  3RX6 A;  3QUJ A;  2DHR A;  5J0Z A;  1HNZ T;  1IJ6 A;  4WV9 A;  3F2E A;  4QH4 A;  2K24 A;  3KVA A;  4PNI A;  3ZKR A;  1SE7 A;  2QC1 B;  3EI0 A;  3IBP A;  1WYC A;  2DNX A;  4LFA T;  2X9W A;  2V1D B;  2NWB A;  2LKG A;  1IZN B;  2KSR A;  2JQH A;  4BFQ A;  4L5G A;  3K8P C;  1NEK A;  5JRC B;  4BJM A;  2E9X D;  3AAA B;  3ZN0 B;  2IAK A;  2Y54 A;  4X20 E;  3FBL A;  1B7T A;  4U74 A;  3TLW A;  5IWA T;  2V6Y B;  4TN7 B;  5HXE A;  4U7I A;  1IAP A;  1WCR A;  5C8Y E;  2WZY A;  3ZMZ B;  2CBI A;  1WRD A;  4GKJ T;  3ETV A;  4UR9 A;  3QB5 A;  2VL8 A;  2OA5 A;  1U5P A;  4H9O C;  2DWG A;  2XY8 B;  2BYP A;  3WTK A;  3SFD A;  2WAU A;  3I1A A;  5M4Y A;  3VRB A;  3N9Q A;  4IST A;  2NOX A;  4CZZ B;  4LF5 T;  3WTI A;  4TWD A;  4K0K T;  2CLY B;  2VL0 A;  3O1J A;  2IC9 A;  4DBQ A;  5BR8 T;  2ODV A;  5L4E A;  3WI3 A;  3KV5 A;  3VU7 H;  4OHF A;  2HN1 A;  4MFR A;  4PJN A;  4OYJ A;  3FZF B;  3JAD A;  2NTX A;  3PJA J;  2HHH T;  5LNK A;  2WU2 A;  1CUN A;  4JI3 T;  2I0M A;  3O4X E;  2VAS A;  2W8G A;  2CLY C;  3AVR A;  2MOZ A;  2ZM0 A;  4IE7 A;  2YDR A;  3ZC0 A;  4AKI A;  4TNW A;  3NBX X;  3C84 A;  2YIN A;  1W9R A;  3UTK A;  1OED C;  2KLQ A;  3OYZ A;  3EHZ A;  4JI2 T;  2XYS A;  1KK7 A;  5EK4 A;  3KV4 A;  1US7 B;  4YJ2 E;  1KNR A;  2HH7 A;  4U33 A;  4BJN A;  4QXH B;  5LJM A;  4ADZ A;  3JCF A;  4DV3 T;  3CK6 A;  5FY7 A;  4DID B;  4LF8 T;  2NW7 A;  3M65 A;  2QRX A;  2J4G A;  4DR5 T;  3HKC E;  1XZY A;  4C90 A;  3QB5 K;  4IT4 A;  1OXZ A;  3PDY A;  3BQI A;  3LJC A;  1OED E;  3N9P A;  2YU1 A;  3RF1 A;  2PBI A;  4N78 D;  2ZMA A;  1UX2 A;  4KX6 A;  2LE8 A;  1E2A A;  2BBJ A;  5KDM C;  3WAK A;  3BQL A;  5AQG B;  3NWI A;  3RI5 A;  4I0U A;  2M6B A;  1Z0P A;  5AFM A;  5JDL A;  5AQV B;  1W0B A;  3PU3 A;  5AQJ B;  3LG7 A;  3HKD E;  5FXX A;  4PFO A;  2XUE A;  2X9X A;  3F57 A;  1UX5 A;  1KNP A;  2W0G A;  3OTO T;  4CN6 A;  2BS3 A;  1NAF A;  4TV9 E;  3KBT A;  1HR0 T;  3AA6 B;  3OPC A;  5KX5 E;  4JYA T;  2Y57 A;  3RRC A;  4QAA A;  3UQ4 A;  3NVO A;  4CI2 B;  2LSY A;  2CA5 A;  4PK4 A;  1KEY A;  2FJA A;  4YXD A;  2WWU A;  3PMZ A;  2ZJU A;  3HR0 A;  4DV2 T;  4HFD A;  4XBF B;  1WR0 A;  2CWY A;  2XQ8 A;  2X67 A;  4WW0 A;  4PFP A;  2Q9Q D;  4MLK A;  4UEL A;  2YMD A;  3W15 B;  3QK6 A;  3P4P A;  4MAL A;  1YKH B;  1D0Y A;  4B3M T;  4HE8 A;  3KFW X;  4PJJ A;  3AEF A;  3RC8 A;  3WTO A;  3B5M A;  3L39 A;  1IBK T;  5HYA A;  2Y8D A;  3QOF A;  2KXP B;  2C0S A;  2BJ0 A;  4AQY T;  2L8K A;  2PGZ A;  2K9A A;  5AFM B;  4LF6 T;  2XAS B;  3N9O A;  2XZE A;  4IIJ E;  4KMC A;  3N2O A;  5LOV E;  4P1N A;  2ACX A;  4DBM A;  3ZCJ A;  4UY2 A;  3T1Y T;  4LF7 T;  3RGL A;  3U8N A;  3J9X 1;  3RQU A;  5AFK A;  5HXH A;  2L3L A;  3SQ6 A;  5HEG A;  2YN6 A;  1BR1 A;  2ZM2 A;  2P9B A;  1AJ3 A;  3TLV A;  3ZMT B;  2YK0 A;  1KNZ A;  1HNX T;  2W00 A;  2H3R A;  3FB2 A;  5C3J A;  5JDM A;  4A5X A;  3P4Q A;  4AKG A;  2K5B B;  4CQI A;  4JI7 T;  5DJQ C;  2XSA A;  3ZN1 B;  4JLE A;  3WTM A;  4ILA A;  4AQG A;  2HPL A;  4YHH T;  2DWK A;  1KF6 A;  4HGA A;  4TWF A;  2PH9 A;  4LMK A;  3ZMS B;  3C79 A;  3NZQ A;  4GYS A;  2BG9 E;  4P09 A;  2UXB T;  3BQK A;  2Y58 A;  1U4Q A;  4IDQ A;  3HL6 A;  5LXB A;  3EDU A;  4JEH B;  5F5W A;  5JQG E;  2VK9 A;  2QVA A;  4PIR A;  1S94 A;  1KFY A;  1T98 A;  1HFA A;  2X9Y A;  5L4H A;  3FXD B;  4YSY A;  1ZP0 A;  3J7Y q;  3ZYK A;  4YT0 A;  4IDN A;  4ZOL E;  3RQW A;  4E7S A;  5ABE A;  2XTL A;  2UUA T;  5DQW A;  3IHR A;  4NUV A;  5AQS B;  4B3S T;  3MXZ A;  5LJN A;  5FVL A;  5AQO B;  2BR7 A;  3ZLI A;  5J2U E;  4ZI2 C;  5L3G B;  2C5K T;  2VKO A;  3UFG A;  3RIF A;  2XAH B;  3L8R A;  4QX8 B;  3UU6 A;  1YW0 A;  3JAE A;  3VRA A;  3SS1 A;  5JDH A;  2V7L A;  2V8S V;  1ZKE A;  3CX8 B;  4DUZ T;  2WWV A;  4XK9 A;  1X9B A;  4ZZB A;  4CN4 A;  3PEO A;  3AED A;  3WTL A;  3O9X A;  5LCY A;  2BKN A;  2WP9 A;  3UT5 E;  3C4X A;  4X1Y E;  3AB3 B;  4UEM A;  2EHO A;  2PTF A;  3NZP A;  4WBN E;  2JJ9 A;  4DV6 T;  5H6R B;  3GUA A;  4X1K E;  4JI1 T;  5JDQ A;  2WCA A;  4KHZ F;  4UM3 P;  2NP9 A;  4K0U A;  3Q9D A;  1DU2 A;  3UFE A;  2PG8 A;  4O4H E;  4H9R C;  3E0Z A;  3KBU A;  3KDS E;  5JVD E;  4YLH A;  4ZS3 A;  4LF4 T;  4IDO A;  5E0O A;  5L3D B;  4O2B E;  3ZMV B;  4CXX A;  2WDR A;  2L9Q A;  5ABF A;  2E5L T;  3JAF A;  3A5X A;  4YTM A;  3N9N A;  5AQR B;  4KP3 C;  4TUY E;  3AAI A;  3PE0 A;  4A97 A;  3EAB A;  5FY0 A;  3K3O A;  4HEA A;  1LVK A;  4AFH A;  4IE6 A;  4UF0 A;  4HTE A;  3Q5W A;  2LJL A;  4ZXL A;  2Y7Y A;  5LYJ E;  2HPJ A;  4X5T A;  5LBQ B;  2BDE A;  4I4T E;  1D0Z A;  1HS7 A;  3VHL A;  4DR6 T;  1ZV4 X;  2PFV A;  5H6Q B;  3U8L A;  3PUG A;  1OED A;  3RYC E;  4UV9 B;  3CVR A;  1NWM X;  3SH1 A;  1XDO A;  1I94 T;  4OFZ A;  4EB6 E;  5LHI B;  2XZ6 A;  2GK9 A;  4ZI3 D;  3PJA A;  4NIQ A;  2V7I A;  3CQX C;  3NRY A;  2XQY A;  4QHO A;  2B1E A;  2J1D G;  3ZPO A;  3PUZ F;  1Y64 B;  2EHO B;  3O1I A;  3ZT6 A;  1SHZ C;  4XHE A;  1ZEE A;  3P8C D;  4IE4 A;  4IE0 A;  2IC6 A;  4IL9 A;  1FMV A;  1BR0 A;  5LBM A;  3MJX A;  5HWY A;  4PAG A;  2E2A A;  2D9D A;  2IDO B;  5LA6 E;  3AA0 B;  3SRZ A;  5AQF B;  5JR9 A;  4NXN T;  3T8O A;  3SIO A;  5ABF B;  4GK5 E;  2FJD A;  3C50 A;  3CQC B;  4YFS A;  3UUL A;  3Q5D A;  2SPC A;  3TLS A;  2EHO C;  5LHH B;  5IHY A;  4XZC A;  2X66 A;  4U31 A;  4GK0 E;  2LSI A;  4CXW A;  4JV5 T;  2LM2 A;  5FP3 A;  3RPU A;  2J62 A;  4UF0 B;  4HQP A;  2JQ9 A;  4ZRU A;  4KI0 F;  3ZJ2 A;  4BAY B;  1N33 T;  3ZJ1 A;  4O4J E;  2LLY A;  1HX1 B;  4HFE A;  5EZY E;  3ZMU B;  3FXE B;  1OED B;  2W61 A;  5J5G A;  5HCM A;  4ASK A;  1JNR A;  2KMF A;  3LBX A;  5HEH A;  3WTN A;  2JQQ A;  4UM3 S;  4X66 T;  4V1A v;  3FBZ A;  5L2L A;  3K1S A;  1UGO A;  1SUM B;  2E8I A;  1N32 T;  2X00 D;  2XAQ B;  2BKO A;  1E7P A;  1UK5 A;  2IML A;  1MIW A;  3O1H A;  2A9U A;  4QH5 A;  2B76 A;  2WU5 A;  3PUV F;  2NTY A;  3ZC1 A;  5HAX A;  1MMG A;  4EIW A;  1M7K A;  1XWM A;  2BZB A;  2LRK A;  4UVC B;  1UW6 A;  4HWC A;  5IYZ E;  1ZOY A;  4U2Z A;  5JR9 B;  3PUX F;  4HWH A;  3DTO A;  2YEV C;  3LSV A;  1YQ3 A;  3Q5X A;  1HTJ F;  3MKD A;  5LG4 A;  3SOL A;  2YDS A;  4X62 T;  3AEA A;  3IF8 B;  4QXB B;  2VKH A;  1UCU A;  3ZCI A;  4I50 E;  4DR3 T;  5KE4 A;  2NW9 A;  1IBL T;  4DO0 A;  2IHR 1;  2V26 A;  5C2T A;  1G8X A;  2I59 A;  4JI4 T;  5JR9 C;  5FJV A;  3C51 A;  4DR4 T;  4MHC A;  3VR9 A;  5AQM B;  2BG9 A;  5AQN B;  2YOE A;  3LBX B;  3RIU A;  1LRZ A;  3ESL A;  3RKO A;  5CB4 E;  5HCJ A;  3ONX A;  4L9I A;  4EAH A;  1V9D A;  4A56 A;  4AKL A;  4H9Q C;  2X51 A;  2R6G F;  3WTH A;  5KZU A;  3RYH E;  2X68 A;  4DMW A;  4GKK T;  1J1J A;  5LMU T;  5FVK A;  2QYW A;  1VOM A;  3AE8 A;  4HN9 A;  1HF8 A;  2DLR A;  3CIR A;  4TWH A;  5F3J A;  4IL4 A;  4H9S E;  2LT3 A;  3SWH A;  4ZEY A;  3ZDH A;  3ONJ A;  3PU8 A;  4O8S A;  4AIS A;  3ZSS A;  3WIP A;  3HA4 A;  1D0X A;  4Z91 A;  4AKR B;  5L3C B;  3AXJ A;  3IEE A;  2WN9 A;  2VKJ A;  2E9X A;  5SYO A;  1WYB A;  3JC6 C;  3P50 A;  3P4W A;  4ZK1 A;  4QAC A;  1D1C A;  2LEH A;  1H7C A;  2XQ9 A;  4EZH A;  4B6X A;  2N2N A;  4CXY A;  4Z8X A;  1LKX A;  1T72 A;  2CEA A;  5LB7 B;  4U2Y A;  2H7O A;  2UXN B;  5AQP B;  2QGS A;  3IGQ A;  3ANW A;  3AA7 B;  1MNE A;  3ABV A;  2VVS A;  2WY2 A;  4H9P C;  2BG9 B; 
#chains in the Genus database with same CATH homology
 2WNC A;  2W8G A;  1OED B;  4ILB A;  5HEU A;  2YOE A;  4UM1 A;  4ZJS A;  2LKG A;  3JAE A;  3UU5 A;  3UU6 A;  1OED A;  2KSR A;  2WNJ A;  5J5G A;  4BFQ A;  4BQT A;  5HCM A;  2C9T A;  3U8N A;  3RQU A;  2BYQ A;  5AFK A;  5J5I A;  3SQ9 A;  2BYN A;  3SH1 A;  3SQ6 A;  2WNL A;  4TNW A;  5HEH A;  2Y57 A;  5HEG A;  2YN6 A;  4HFC A;  4QAA A;  4ZK4 A;  3WTN A;  4B5D A;  5JME A;  4UM3 S;  4F8H A;  4XK9 A;  3TLV A;  2XNU A;  2XZ6 A;  3UQ4 A;  4COF A;  5HEJ A;  3C84 A;  4ZZB A;  2Y54 A;  5HCJ A;  5CO5 A;  3PEO A;  5AFH A;  3WTL A;  1OED C;  5CFB A;  3TLW A;  2ZJV A;  4LMJ A;  2XQA A;  3EHZ A;  2X00 D;  2XYS A;  3WTH A;  4TNV A;  4FRR A;  5KZU A;  2WZY A;  3PMZ A;  2LKH A;  4NPP A;  2YME A;  2ZJU A;  3U8K A;  2BYS A;  4XHE A;  4HFD A;  3ZDG A;  5AIN A;  2XQ4 A;  4HFB A;  4D01 A;  4QH5 A;  4ALX A;  2XQ8 A;  4TWH A;  4ILA A;  3GUA A;  3WTM A;  4IL9 A;  4IL4 A;  5J5H A;  4ZJT A;  2YMD A;  5BRX A;  3U8J A;  2BG9 C;  4TWF A;  4HFH A;  4UM3 A;  2BYP A;  3WTK A;  2PH9 A;  5BW2 A;  4LMK A;  2XQ7 A;  4UM3 P;  4HFI A;  2M6I A;  5LG3 A;  3ZDH A;  2BYR A;  4Z90 A;  5AFJ A;  1UW6 A;  3T4M A;  4QAB A;  3C79 A;  1I9B A;  2BG9 E;  2XQ6 A;  3WIP A;  2Y58 A;  5J5F A;  1OED E;  4Z91 A;  4ILC A;  5LXB A;  4ZR6 A;  1UV6 A;  2BR8 A;  2XQ5 A;  3WTO A;  4TWD A;  2WN9 A;  3WTI A;  3SIO A;  4LML A;  3LSV A;  5SYO A;  2VL0 A;  3P50 A;  2XYT A;  3UU4 A;  2XQ3 A;  3RHW A;  4AFT A;  3P4W A;  3JAF A;  1UX2 A;  4A98 A;  2XNV A;  5L4E A;  3TLS A;  4PIR A;  4ZK1 A;  5BP0 A;  4NZB A;  4QAC A;  3WTJ A;  5HEO A;  2X00 A;  2XQ9 A;  5L4H A;  2BJ0 A;  3U8M A;  4A97 A;  2LM2 A;  2PGZ A;  2W8F A;  4AFG A;  2XZ5 A;  5AFM B;  3RI5 A;  2M6B A;  3RQW A;  5IUX A;  5AFM A;  4HQP A;  4AFH A;  5J0Z A;  4ZRU A;  3UUB A;  5KE4 A;  3TLU A;  5AFL A;  4WV9 A;  5TVC A;  4QH4 A;  4EZ1 A;  2YKS A;  2Y7Y A;  3UU8 A;  5L47 A;  3IGQ A;  3JAD A;  4UXU A;  4IRE A;  3ZKR A;  2XNT A;  3TLT A;  4X5T A;  3UU3 A;  3RIA A;  2MAW A;  2BR7 A;  2QC1 B;  4QH1 A;  3U8L A;  2Y56 A;  4ZZC A;  5FJV A;  3UQ7 A;  5AFN A;  2LLY A;  4DBM A;  2BG9 B;  3EI0 A;  3RIF A;  4HFE A;  4UY2 A;  2UZ6 A;  2BG9 A;  3EAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...