5HCMA

The glic pentameric ligand-gated ion channel 2-21' cross-linked mutant complexed to bromoform
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Sites of Anesthetic Inhibitory Action on a Cationic Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hcmA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hcmA01
3U8MA 3EI0A 5HEJA 4LMLA 3EAMA 3LSVA 4TNVA 4A98A 4PIRA 4ZZCA 1UW6A 3ZDGA 4COFA 2YMEA 3RIFA 2X00D 5AFLA 4IREA 5AFHA 1OEDA 5BP0A 3WTNA 4LMJA 2BYQA 3WTIA 3JAFA 4ALXA 3WTOA 3TLVA 3PMZA 3GUAA 3ZKRA 4NZBA 4NPPA 4F8HA 3UUBA 4TWHA 2KSRA 2WNJA 2Y56A 3U8KA 3U8JA 5IUXA 3IGQA 2XQ4A 2ZJUA 5KZUA 4HFEA 1I9BA 2ZJVA 5BW2A 4XK9A 4A97A 3UU8A 5AFMA 3C84A 4EZ1A 4TNWA 2BG9E 4HFHA 3UQ7A 2WZYA 4BFQA 4AFGA 4HFIA 4HFBA 2XYSA 4WV9A 2BJ0A 5HCJA 1OEDE 5LXBA 5J5HA 3RI5A 3UU6A 3SH1A 2YMDA 4QACA 3RQUA 2BYNA 3UU5A 2Y54A 2M6BA 5HEGA 5J5IA 5AFMB 4ILBA 2YN6A 4QH4A 2LM2A 3RQWA 4UM1A 4QABA 5L47A 2XQ5A 2PH9A 3U8NA 2XQ7A 4QH5A 2LKGA 4ILAA 2QC1B 3WTMA 3WTJA 4ZRUA 5J5FA 5J0ZA 4XHEA 3WTLA 2XYTA 2W8GA 4LMKA 5CFBA 4AFHA 4AFTA 5AINA 2XZ5A 2PGZA 2UZ6A 2X00A 2VL0A 4ZJSA 2XQ6A 5HCMA 2BYPA 3TLSA 4UY2A 3U8LA 2MAWA 2BYRA 3UU3A 5JMEA 2BYSA 4UXUA 4TWDA 2XQ9A 3TLUA 2WNCA 3EHZA 2XNUA 2XZ6A 3PEOA 3WTKA 4X5TA 4UM3A 5BRXA 3SQ9A 2XQ3A 3P4WA 1UX2A 5AFKA 2LKHA 5HEOA 4HFCA 3WTHA 3JAEA 4B5DA 3WIPA 2BG9C 4ZK4A 2BR7A 3RHWA 4D01A 5TVCA 4IL4A 2XQAA 2XNTA 1OEDC 3C79A 4Z91A 3RIAA 2M6IA 4ZK1A 5AFJA 5L4EA 5AFNA 5HEUA 2BG9A 4IL9A 5LG3A 2WN9A 5KE4A 5HEHA 4BQTA 5CO5A 4ZJTA 1UV6A 2Y57A 5FJVA 4ZZBA 3T4MA 2YOEA 3UU4A 5SYOA 3SQ6A 4HQPA 3P50A 3TLWA 3JADA 4FRRA 2W8FA 4Z90A 2BR8A 3SIOA 3TLTA 2BG9B 2YKSA 5L4HA 2C9TA 4QAAA 4ZR6A 4ILCA 5J5GA 4UM3S 4DBMA 4UM3P 4TWFA 2Y7YA 2XQ8A 1OEDB 2XNVA 4QH1A 3UQ4A 2Y58A 2WNLA 4HFDA 3ZDHA 2LLYA
chains in the Genus database with same CATH superfamily
4U72A 4XAXB 3PUXF 3FBZA 4YY3T 3O1HA 4CN6A 1XNRT 4UIGA 1SA0E 2N2NA 2CWOA 3UUBA 5HAXA 4QKNA 2E9XD 4H9SE 2VWAA 2IMLA 2NP9A 4AKGA 2Q9QC 3RX6A 4XK9A 3PTRB 3AAAB 3UQ7A 5AQMB 4KP3C 4AFGA 4HFIA 3ZN0B 1XNQT 4E7ZA 4TZ4C 3I1AA 1XDOA 4O4HE 4NUVA 5ABHA 5HEGA 2B76A 5AFMB 4QH4A 1HCIA 2LM2A 4JI3T 5L47A 4JEUB 3WTJA 2W8GA 2CBJA 5AQKB 3AE6A 4FJOA 2VL0A 2BYRA 2I0MA 5DABA 4KI0F 2HPJA 3EHZA 2BVMA 3N9MA 2LRKA 4ZS3A 2ODVA 5A1LA 3AEBA 4HTEA 2OA5A 4TN7B 1UCUA 5KE4A 2L8KA 1LVKA 4J2CA 3OYXA 4TX5A 5J5GA 2H7OA 1YQ4A 2Y58A 3UQ4A 2E5VA 1OWAA 4I43B 4LFAT 3LSVA 1FMWA 3AE9A 4I0UA 5LB7B 3N2GE 2KXPB 4U2YA 1QLBA 5L3BB 4UXNB 4KBMB 2KWIB 3CIRA 4EYYR 5E0OA 1UURA 5AQNB 2QYWA 2UU9T 3RH3A 4H9NC 4A97A 3J7Yq 4X65T 1M7KA 5LHGB 4QWNB 2H88A 2YDRA 4HFHA 1NWMX 4HFBA 5LXBA 3ZN1B 1ZP0A 5AQUB 4DNDA 2VKHA 3T1YT 4AKHA 4CI1B 4PFPA 2NTYA 2Q9QB 2CEAA 2Z6EA 2DCFA 3B5MA 5FVKA 3IBPA 3WAJA 2BBJA 3BQKA 2C0SA 4H9QC 2VK9A 2Q9QA 2JQHA 4UXUA 2J1DG 2CBIA 2Y48B 1Y64B 2LJLA 5JVDE 3C98B 3PUQA 2I59A 4DO0A 1WLXA 2IUBA 2XNTA 5AQTB 5FKYA 3RIAA 2XZEA 4IL9A 4IE7A 2WN9A 5CB4E 3RYFE 3PJAA 1IBMT 5GONE 4ILUA 1BR0A 1CHUA 3UUMA 5JH7E 1YQ3A 4QHOA 2YKSA 4QAAA 2XQ8A 2BKOA 2XNVA 1NEKA 4JEHB 4U7IA 3ZDGA 3KVBA 5ABEA 3L39A 2D5UA 2D9DA 4DV2T 2X9XA 4QX8B 5J2UE 1IBLT 2BS4A 2N1GA 4AKIA 3ZSSA 4TWHA 2KSRA 4CI2B 4ADZA 2FJDA 2W2UA 2FBWA 3CVRA 2WBLA 2ZJVA 1T98A 4A5XA 2CM0A 3ZJ2A 5AQRB 2QRXA 1HFAA 1XMQT 4YSYA 2A3DA 4GOUA 1BR1A 2OV9A 4KHPT 3RLFF 3P4RA 3FHNA 1D0YA 3SH1A 1JNRA 5J5IA 4X66T 3RC3A 2MYSA 3U8NA 1BR2A 4LFBT 2X51A 4ZJSA 2X00A 5C3JA 4YTMA 3LFMA 5HXHA 1WFDA 3TLUA 3HKCE 4UM3A 4ZS2A 4QXCB 1E2AA 1UX2A 4IDQA 3WIPA 3ONLC 4ZK4A 5DJQC 5EK3A 1KNRA 2I6HA 1MMDA 4DIDB 4G2AA 3HR0A 3TLTA 5CA0E 5KX5E 4UF0B 4DBQA 3ZDHA 2X9YA 5JREA 3AEGA 3VHLA 4UF0A 4HWCA 2JRKA 2WSSV 3JAFA 2VB6A 4NZBA 3CX6B 3JC6C 5CGMA 2WU2A 3ZCJA 4UVAB 3IF8B 5IUXA 4I4TE 4JUYA 4O8SA 4H9OC 5EK4A 3AEFA 4JI5T 3X1DA 3RPUA 4AXPA 1LKXA 1OEDE 3UU6A 1H7CA 5FXVA 3ZMSB 2WQYA 3CKDA 2MOZA 4CXXA 3FZHB 4DV5T 4QABA 4UM1A 1D0XA 4HKAA 2DHRA 2JIWA 2UUCT 1UX5A 3UU3A 2XQ9A 1WCRA 3LK42 5LMUT 3MACA 5JR9C 5LG4A 4U2ZA 3GWHA 3N2OA 3I9YA 1YD8G 4DV0T 4O4IE 1D1BA 2HH7A 1FEWA 2VKDA 1ZOYA 4ZK1A 2BG9A 5LG3A 3PE0A 4X1IE 4X1KE 2DL1A 4H63H 3JADA 5IWAT 1UX4A 3L8RA 4UM3P 3VRAA 1U5PA 3O9XA 2X9WA 4H63V 3EDVA 5HXRA 1NENA 4A98A 2KT9A 4X1YE 4IREA 1N32T 2IAKA 5HXSA 3RYIE 2BYQA 1SHZC 2KWHA 3UULA 5L3DB 4DR6T 2E8IA 2PJQA 3U8KA 2XQYA 3Q5DA 1X9BA 3CK6A 3MZKB 2W62A 5FXXA 4TNWA 2LSIA 4DV4T 2E9XC 4UVCB 1XWMA 1QUUA 3G06A 3PUSA 4KX6A 2IW5B 5J2TE 4L9IA 3RIUA 4BA9A 1AJ3A 5J5FA 2QGSA 4JI1T 2QA7A 3V5SA 2E2AA 3TKLB 1DU2A 3B13A 2LHRA 2BS2A 1I94T 3E22E 2MAWA 5JMEA 2WAUA 3F31A 3PEOA 4IE6A 4X5TA 5DQVA 5L3FB 2DWKA 4ZI3C 3WTHA 2UXBT 4PAGA 2X68A 3R6NA 2KNDA 3C4ZA 5LMNT 4YFSA 3PUYF 4OX9T 4A56A 5JR9B 3SS1A 1W9RA 3ZC1A 5AFUL 4ILCA 2W63A 3I0OA 2R6GF 3K3OA 2W67A 3E0ZA 2WZHA 5LGUB 5JR9A 4HWIB 3VR9A 4HWHA 2BVLA 4DMVA 5FVLA 4QX7B 4CN4A 3P4QA 3KV5A 3K3NA 4Z8XA 4ANJA 5FY1A 2IC9A 1S94A 3CQXC 2WNJA 3N5LA 1MMGA 4YLHA 2V6XA 4HFEA 4NUUA 3ABVA 4DV3T 5J5HA 2XASB 1VCSA 3EVYA 4ZOLE 5LCYA 3I0QA 2WM9A 5L3CB 5AQVB 2XAQB 4P0BA 5LHHB 4ZHQE 5BR8T 4LMKA 1HF8A 2PGZA 2ACZA 2E9XB 2CE7A 2FJAA 2UXNB 4P1NA 2ZM0A 3HKBE 2WCAA 3KVAA 4U7YA 2K3WA 3FZLB 5KDMC 4JYAT 4HFCA 5AQOB 2JQKA 2CXDA 2E9XA 3AA1B 3DP7A 3BQLA 3AA7B 2MPKA 2LSJA 5CO5A 4ZJTA 4LF9T 5HWYA 3AE1A 3TLWA 4DVDA 2BR8A 3RKOA 3KBUA 2GK9A 1D0ZA 3IEEA 2X0YA 1O3XA 2LHNA 2H3RA 4JI6T 4QXHB 3ZYKA 2OLTA 2VL8A 2FJBA 3LG7A 4H9PC 1XZYA 5AQFB 3ZKRA 3PUAA 2ZM8A 2LSYA 2V7JA 3CX7B 5FL1A 2CPTA 1YXRA 2WMNA 5KZUA 3AVSA 4O2AE 1MNEA 2WDRA 1G73A 1IBKT 4UELA 3CMLA 2WZYA 4P0AA 3KBTA 2EHOD 4AISA 4WV9A 4XBFB 5JDLA 2YMDA 4QACA 3RQUA 2M6BA 5AQJB 2DI4A 2PTFA 3RQWA 4GIWA 4JV5T 3VRBA 5J0ZA 3LJCA 3SRZA 3WTLA 3DTOA 2UZ6A 5JDMA 5F8PA 1FJGT 2LOPA 4O2BE 5FXZA 4PK5A 3F2EA 2V26A 4AKRB 1VCTA 4B6XA 4JI8T 4OYKA 2XQAA 1T8BA 4Z91A 4HFVA 4U3CA 3CQGB 4AQFC 4PJMA 4LF6T 1HS7A 1M62A 5CJ5A 3Q5WA 2J62A 4PJNA 4N78D 4QH1A 2IC6A 2A2FX 4U74A 5LA6E 1HG5A 1Z0PA 3AVRA 3KINB 3WTIA 4JI4T 1MIWA 4YSZA 2BS3A 3UFGA 4DV7T 2CWYA 3C50A 3P4PA 2K5BB 3U8JA 3SFEA 3ZMUB 4Q25A 3OTOT 4DBRA 3Q5EA 1N33T 5BW2A 5J1GA 3UU8A 4OYJA 1WR6A 1MIYA 2X67A 1W0AA 5TAOA 3EDUA 2K9AA 5BMVE 4HN9A 4EOZB 2YN6A 4AIUA 3LDQB 2C5KT 2NW9A 4ZRUA 2V7MA 4EV6A 2BKPA 3AE7A 2UUBT 4CI3B 1E7PA 3L3PA 2BYPA 2BYSA 1LVFA 5F5WA 4TUYE 4B3MT 2PG8A 3AEEA 3JAEA 4DR1T 2BG9C 3K8PC 3K3QC 3SOLA 3KFWX 5AFJA 2UUAT 2NWBA 4MLKA 5L2LA 4KHZF 3C64A 2PFVA 5FJVA 4ZZBA 3IHRA 3UU4A 4EEBA 2Y8DA 2K48A 5AQGB 2JQ9A 2Y7YA 4EYUA 4TNVA 3E08A 2J4GA 3QUJA 5AFHA 4AQFA 3ETUA 4YHHT 4DR3T 4IDOA 3GN5A 2VKOA 3UTKA 2X9HA 1HNWT 5IHYA 3NRYA 1WRDA 4PK4A 3L09A 4IGUA 2JJ9A 5H6QB 2NR4A 5HCJA 3ZJ1A 2XTLA 1Z8UA 3N9OA 3LBXB 5AQLB 5LGNB 2XSBA 3U3IA 3H3MA 4PW8A 3RIUC 2ZMAA 1W09A 4AKLA 2WS3A 4HWFA 3PUZF 3MJXA 3HKEE 2XQ5A 4YXDA 2PH9A 4QH5A 2JMHA 1HG2A 3LBXA 4XHEA 4ASKA 5AINA 5CA1E 2WWUA 3U8LA 2JQQA 3A5XA 2WNCA 3PDYA 3T1HT 3WTKA 4DR7T 4OFZA 3MKDA 2V6YA 2BR7A 5FXWA 2XAJB 4YTNA 2NW8A 4IIJE 3N9NA 5DQWA 1UV6A 5LP6E 4HQPA 3P50A 4DV6T 4FRRA 3PV0F 4CXWA 2BG9B 2ZM2A 2LE8A 2W66A 5C2TA 2BBHA 4BJMA 3EAMA 4COFA 3PUGA 3WTNA 2YDQA 2LRLA 4EZHA 1D1CA 4NPPA 3O1JA 1IAPA 5EK2A 3OYZA 2XQ4A 2ODUA 3ANWB 1D1AA 3F57A 4HEAA 3NRXA 2X0HA 2BJ0A 1ZKEA 3QK6A 1J5WA 4GYRA 4P09A 3ANWA 1HNZT 2KMFA 2KLQA 4ZXLA 2LKGA 2BDEA 3BK9A 3O1IA 4I55E 2W0GA 2P9BA 3FZFB 4LF7T 3R84B 4ZI2D 3O4XE 4MHCA 5HEOA 4B5DA 1ZEEA 5JDQA 1KF6A 2JMKA 5JRCB 4EIWA 4OK0A 4BQTA 2MBGA 1ZV4X 2ACXA 2YOEA 4IDNA 4MFRA 5JRCA 3N2KE 3C51A 1NAFA 4IE4A 3VR8A 5FL0A 1X79A 4KMCA 4D01A 3IA3A 2IIUA 2CHOA 3U8MA 1S35A 5HEJA 2CLYB 3UUNA 2YMEA 4HGAA 3OPCA 4E7SA 2N9DA 2DNXA 4LMJA 3CX8B 2KZ7B 2LM9A 4DUYT 4EXTA 1KFYA 2A9UA 3C84A 3ZYLA 2LT3A 1LRZA 4BFQA 4ISTA 3ONJA 2XYSA 1IZNB 2A72A 2K24A 3AECA 4ERRA 3ESLA 4TV8E 2VQET 3C4WA 3NBXX 3I9WA 3DJBA 5JDHA 4HWDA 1VOMA 2QC1B 4O4LE 4B3TT 3KV9A 4U33A 1BR4A 5LJMA 2M67A 5LYJE 2BKNA 4WBOA 3GMIA 4WZXA 5LGTB 2D0UA 2XQ3A 3P4WA 5JDNA 2YU2A 5AFKA 4CZZB 2V1DB 2MTQA 2VQFT 5FP3A 2LEHA 3C79A 2DLRA 3HI2A 3AE3A 1YW0A 2CMRA 2XSAA 3NWIA 3AA0B 3RRWA 4IT4A 4WNKA 3ZPOA 4JI0T 4Z90A 1N34T 3N9LA 2YEVC 4UM3S 3N9QA 4IDPA 3LK3B 2ZM6T 2VKJA 5HYAA 2C5IT 4HFDA 2LLYA 2D2SA 4NXNT 3EI0A 5IYZE 5C8YE 2XJ7A 5AFLA 4PFOA 3ZYMA 4NXMT 1KNPA 3PUWF 3TLVA 4GKJT 4WYVA 3PMZA 3AB3B 1UK5A 4F6RC 4PJJA 3FZMB 3PU3A 2V5DA 4ZI3D 3AE4A 4UVBB 4TV9E 2CXFA 5EZYE 2AXDS 2WZIA 3J9X1 5AFMA 4XZCA 3Q2MA 3W15B 2RA1A 3CWZB 5FY7A 3ZT6A 3KV4A 4ZI7E 4YJ2E 4ILBA 1ZHCA 3MA9A 3Q9DA 2V7LA 4LF5T 2J47A 2E5LT 2XYTA 1KNZA 4AFHA 4AFTA 2XZ5A 2C5JA 2JPFA 3PJAJ 2CRBA 4B3ST 3VU7H 3A8YC 4TWDA 2VVNA 3ETVA 4LF8T 3OJAA 1KK7A 1IJ5A 3KV6A 4FI5A 3RC8A 2CA5A 4YHJA 2XAFB 2ZLYA 5FYMA 2EHOB 1HNXT 1HX8A 3MK7C 4EB6E 3T8OA 3ZMVB 3QNUA 3QB5K 3RKGA 3FB2A 1YKEB 2CCQA 1QSDA 4EGWA 5SYOA 3UFEA 2W4XA 2EHOA 2Y6XA 1KEYA 5AQIB 3D0TA 1WYBA 1WYCA 4IE0A 2YDSA 4LFCT 5ABFB 4GKKT 3WI3A 2LOSA 2Q9QD 1CUNA 3FZKB 2BZBA 5JDFA 3GUAA 3N9PA 2X66A 5ABFA 5JTGA 4HE8A 3AXJB 3UT5E 4KUMB 2XPKA 4UEMA 3IGQA 4C90A 2WY2A 1I9BA 5L3GB 2XM1A 3QOFA 2CHNA 3AXJA 3WAKA 4GK0E 3CPZA 3JCFA 4WBNE 2UXXB 2XQ7A 4NIQA 3PU8A 2WU5A 4V1Av 3AA6B 4JI2T 3TLSA 3H3AA 3QB5A 2QVAA 2XAGB 3EABA 1HX1B 2LSKA 3RHWA 1L0VA 1XDPA 2WMOA 5KMGP 2V8SV 4MBQA 2IDOB 4ZEYA 4PJLA 4DR4T 4JI7T 2Y57A 2G0UA 3SQ6A 4ISSA 2W8FA 2VASA 3AE2A 2C9TA 4ZR6A 3RYCE 5M4YA 2IHR1 4IDZA 3BQIA 3ZC0A 4X20E 1SUMB 4PIRA 2D0TA 2WDQA 5LXTE 2ES0A 4UR9A 5L3EB 2X00D 4DMWA 5BP0A 2XM2A 5H6RB 4B3RT 4C91A 2VURA 4F8HA 1YKHB 3AEAA 1MMNA 1MIVA 2H89A 2SPCA 3HL6A 3GN5B 3P7IA 4OHFA 2UXDT 2CXLA 3A7MA 2BG9E 3M3ZB 2HN1A 3PUVF 3RI5A 5ABGA 2WP9A 3SWHA 3GA8A 1G8XA 3HKDE 2V5CA 4YSXA 2V7KA 5JDGA 2NW7A 4U31A 4ILAA 1E1HB 3ZT7A 3Q5XA 2UXCT 4H9RC 5FY0A 4G63A 4UY2A 1FMVA 4WW0A 5AQQB 3SQ9A 4AQGA 3P4SA 1UUSA 1OXZA 5TVCA 1OEDC 5L4EA 5HEUA 5AQSB 1JNZA 4GYSA 4ZI2C 3H37A 2V6YB 2FUPA 3OBVE 1N36T 4CQIA 4CN1A 4IHJE 4QXBB 3NKZA 5FMNA 5L4HA 2PBIA 4TWFA 1UGOA 2WNLA 4AI6A 2XAHB 3ZEFB 4DR2T 1I6ZA 1HTJF 2CLYC 1FIOA 3P8CD 4PNIA 4ALXA 5LHIB 3VKHA 3ZMZB 4JLEA 4K0KT 2WB5A 2Y56A 4O4JE 3VKGA 1XMOT 5LOVE 3KDSE 2DWGA 2NOXA 4EAHA 4YJ3E 4EZ1A 3NZPA 1R8IA 3NVOA 3AAIA 1MNDA 2BYNA 3S4UA 1EZ3A 1US7B 2LSGA 3AE8A 4L5GA 3FXDB 4L0RA 4YTPA 5CFBA 2XQ6A 5HCMA 3EUHA 3M65A 3OKQA 1VRBA 2XNUA 2XZ6A 2XHEB 5LNKA 5HWXA 2VVSA 3LK2B 2LKHA 2H7VC 3CQCB 2YU1A 2M6IA 3PURA 5AFNA 3FBLA 2HN2A 4UV8B 4X62T 3T4MA 3SFDA 2NTXA 4MALA 4EEDA 3ONXA 2L9QA 3K1SA 4JBWF 2XY8B 4DBMA 4DV1T 1OEDB 3UU5A 1GQEA 3JC6D 4X64T 2XUEA 4LMLA 1U4QA 3C4XA 2F4VT 4ZZCA 1UW6A 3OVUA 5JQGE 4AQYT 3RIFA 2HHHT 1OEDA 4EZ4A 5HXCA 1HR0T 1T72A 3WTOA 1Y01A 5FNVE 4UV9B 2HPLA 3RRCA 5AQHB 1SE7A 2AE9A 3FXEB 3RGLA 1J5ET 5ETWA 2FJEA 2ZJUA 3ZMTB 2L3LA 4YT0A 2RP4A 1IJ6A 3QC9A 2YK0A 1WR0A 3U78A 3UUXB 4I50E 1V9DA 2Y54A 2RPAA 3ZSTA 3RF1A 2WDVA 4CXYA 4BJNA 4IE5A 3MXZA 3WTMA 3RYHE 2B1EA 3ZCIA 4M1PA 4BAYB 3ZLIA 3B57A 5AQPB 5LJNA 4DR5T 3AE5A 5F3JA 3NZQA 4GK5E 2WWVA 4K0UA 3ZT5A 2W61A 3V5UA 5BRXA 2KINB 4DUZT 3AAEB 4IL4A 2V7IA 2X0LB 2W00A 5LBQB 1B7TA 5ADXL 1J1JA 5LBMA 5HXEA 2EHOC 3HA4A 5HEHA 1T7SA 4PK6A 1W0BA 3SIOA 3AEDA 1MMAA 4LF4T 5KXJA 2YINA
chains in the Genus database with same CATH topology
3U8MA 3EI0A 5HEJA 4LMLA 3EAMA 3LSVA 4TNVA 4A98A 4PIRA 4ZZCA 1UW6A 3ZDGA 4COFA 2YMEA 3RIFA 2X00D 5AFLA 4IREA 5AFHA 1OEDA 5BP0A 3WTNA 4LMJA 2BYQA 3WTIA 3JAFA 4ALXA 3WTOA 3TLVA 3PMZA 3GUAA 3ZKRA 4NZBA 4NPPA 4F8HA 3UUBA 4TWHA 2KSRA 2WNJA 2Y56A 3U8KA 3U8JA 5IUXA 3IGQA 2XQ4A 2ZJUA 5KZUA 4HFEA 1I9BA 2ZJVA 5BW2A 4XK9A 4A97A 3UU8A 5AFMA 3C84A 4EZ1A 4TNWA 2BG9E 4HFHA 3UQ7A 2WZYA 4BFQA 4AFGA 4HFIA 4HFBA 2XYSA 4WV9A 2BJ0A 5HCJA 1OEDE 5LXBA 5J5HA 3RI5A 3UU6A 3SH1A 2YMDA 4QACA 3RQUA 2BYNA 3UU5A 2Y54A 2M6BA 5HEGA 5J5IA 5AFMB 4ILBA 2YN6A 4QH4A 2LM2A 3RQWA 4UM1A 4QABA 5L47A 2XQ5A 2PH9A 3U8NA 2XQ7A 4QH5A 2LKGA 4ILAA 2QC1B 3WTMA 3WTJA 4ZRUA 5J5FA 5J0ZA 4XHEA 3WTLA 2XYTA 2W8GA 4LMKA 5CFBA 4AFHA 4AFTA 5AINA 2XZ5A 2PGZA 2UZ6A 2X00A 2VL0A 4ZJSA 2XQ6A 5HCMA 2BYPA 3TLSA 4UY2A 3U8LA 2MAWA 2BYRA 3UU3A 5JMEA 2BYSA 4UXUA 4TWDA 2XQ9A 3TLUA 2WNCA 3EHZA 2XNUA 2XZ6A 3PEOA 3WTKA 4X5TA 4UM3A 5BRXA 3SQ9A 2XQ3A 3P4WA 1UX2A 5AFKA 2LKHA 5HEOA 4HFCA 3WTHA 3JAEA 4B5DA 3WIPA 2BG9C 4ZK4A 2BR7A 3RHWA 4D01A 5TVCA 4IL4A 2XQAA 2XNTA 1OEDC 3C79A 4Z91A 3RIAA 2M6IA 4ZK1A 5AFJA 5L4EA 5AFNA 5HEUA 2BG9A 4IL9A 5LG3A 2WN9A 5KE4A 5HEHA 4BQTA 5CO5A 4ZJTA 1UV6A 2Y57A 5FJVA 4ZZBA 3T4MA 2YOEA 3UU4A 5SYOA 3SQ6A 4HQPA 3P50A 3TLWA 3JADA 4FRRA 2W8FA 4Z90A 2BR8A 3SIOA 3TLTA 2BG9B 2YKSA 5L4HA 2C9TA 4QAAA 4ZR6A 4ILCA 5J5GA 4UM3S 4DBMA 4UM3P 4TWFA 2Y7YA 2XQ8A 1OEDB 2XNVA 4QH1A 3UQ4A 2Y58A 2WNLA 4HFDA 3ZDHA 2LLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8M A;  3EI0 A;  5HEJ A;  4LML A;  3EAM A;  3LSV A;  4TNV A;  4A98 A;  4PIR A;  4ZZC A;  1UW6 A;  3ZDG A;  4COF A;  2YME A;  3RIF A;  2X00 D;  5AFL A;  4IRE A;  5AFH A;  1OED A;  5BP0 A;  3WTN A;  4LMJ A;  2BYQ A;  3WTI A;  3JAF A;  4ALX A;  3WTO A;  3TLV A;  3PMZ A;  3GUA A;  3ZKR A;  4NZB A;  4NPP A;  4F8H A;  3UUB A;  4TWH A;  2KSR A;  2WNJ A;  2Y56 A;  3U8K A;  3U8J A;  5IUX A;  3IGQ A;  2XQ4 A;  2ZJU A;  5KZU A;  4HFE A;  1I9B A;  2ZJV A;  5BW2 A;  4XK9 A;  4A97 A;  3UU8 A;  5AFM A;  3C84 A;  4EZ1 A;  4TNW A;  2BG9 E;  4HFH A;  3UQ7 A;  2WZY A;  4BFQ A;  4AFG A;  4HFI A;  4HFB A;  2XYS A;  4WV9 A;  2BJ0 A;  5HCJ A;  1OED E;  5LXB A;  5J5H A;  3RI5 A;  3UU6 A;  3SH1 A;  2YMD A;  4QAC A;  3RQU A;  2BYN A;  3UU5 A;  2Y54 A;  2M6B A;  5HEG A;  5J5I A;  5AFM B;  4ILB A;  2YN6 A;  4QH4 A;  2LM2 A;  3RQW A;  4UM1 A;  4QAB A;  5L47 A;  2XQ5 A;  2PH9 A;  3U8N A;  2XQ7 A;  4QH5 A;  2LKG A;  4ILA A;  2QC1 B;  3WTM A;  3WTJ A;  4ZRU A;  5J5F A;  5J0Z A;  4XHE A;  3WTL A;  2XYT A;  2W8G A;  4LMK A;  5CFB A;  4AFH A;  4AFT A;  5AIN A;  2XZ5 A;  2PGZ A;  2UZ6 A;  2X00 A;  2VL0 A;  4ZJS A;  2XQ6 A;  5HCM A;  2BYP A;  3TLS A;  4UY2 A;  3U8L A;  2MAW A;  2BYR A;  3UU3 A;  5JME A;  2BYS A;  4UXU A;  4TWD A;  2XQ9 A;  3TLU A;  2WNC A;  3EHZ A;  2XNU A;  2XZ6 A;  3PEO A;  3WTK A;  4X5T A;  4UM3 A;  5BRX A;  3SQ9 A;  2XQ3 A;  3P4W A;  1UX2 A;  5AFK A;  2LKH A;  5HEO A;  4HFC A;  3WTH A;  3JAE A;  4B5D A;  3WIP A;  2BG9 C;  4ZK4 A;  2BR7 A;  3RHW A;  4D01 A;  5TVC A;  4IL4 A;  2XQA A;  2XNT A;  1OED C;  3C79 A;  4Z91 A;  3RIA A;  2M6I A;  4ZK1 A;  5AFJ A;  5L4E A;  5AFN A;  5HEU A;  2BG9 A;  4IL9 A;  5LG3 A;  2WN9 A;  5KE4 A;  5HEH A;  4BQT A;  5CO5 A;  4ZJT A;  1UV6 A;  2Y57 A;  5FJV A;  4ZZB A;  3T4M A;  2YOE A;  3UU4 A;  5SYO A;  3SQ6 A;  4HQP A;  3P50 A;  3TLW A;  3JAD A;  4FRR A;  2W8F A;  4Z90 A;  2BR8 A;  3SIO A;  3TLT A;  2BG9 B;  2YKS A;  5L4H A;  2C9T A;  4QAA A;  4ZR6 A;  4ILC A;  5J5G A;  4UM3 S;  4DBM A;  4UM3 P;  4TWF A;  2Y7Y A;  2XQ8 A;  1OED B;  2XNV A;  4QH1 A;  3UQ4 A;  2Y58 A;  2WNL A;  4HFD A;  3ZDH A;  2LLY A; 
#chains in the Genus database with same CATH topology
 4U72 A;  4XAX B;  3PUX F;  3FBZ A;  4YY3 T;  3O1H A;  4CN6 A;  1XNR T;  4UIG A;  1SA0 E;  2N2N A;  2CWO A;  3UUB A;  5HAX A;  4QKN A;  2E9X D;  4H9S E;  2VWA A;  2IML A;  2NP9 A;  4AKG A;  2Q9Q C;  3RX6 A;  4XK9 A;  3PTR B;  3AAA B;  3UQ7 A;  5AQM B;  4KP3 C;  4AFG A;  4HFI A;  3ZN0 B;  1XNQ T;  4E7Z A;  4TZ4 C;  3I1A A;  1XDO A;  4O4H E;  4NUV A;  5ABH A;  5HEG A;  2B76 A;  5AFM B;  4QH4 A;  1HCI A;  2LM2 A;  4JI3 T;  5L47 A;  4JEU B;  3WTJ A;  2W8G A;  2CBJ A;  5AQK B;  3AE6 A;  4FJO A;  2VL0 A;  2BYR A;  2I0M A;  5DAB A;  4KI0 F;  2HPJ A;  3EHZ A;  2BVM A;  3N9M A;  2LRK A;  4ZS3 A;  2ODV A;  5A1L A;  3AEB A;  4HTE A;  2OA5 A;  4TN7 B;  1UCU A;  5KE4 A;  2L8K A;  1LVK A;  4J2C A;  3OYX A;  4TX5 A;  5J5G A;  2H7O A;  1YQ4 A;  2Y58 A;  3UQ4 A;  2E5V A;  1OWA A;  4I43 B;  4LFA T;  3LSV A;  1FMW A;  3AE9 A;  4I0U A;  5LB7 B;  3N2G E;  2KXP B;  4U2Y A;  1QLB A;  5L3B B;  4UXN B;  4KBM B;  2KWI B;  3CIR A;  4EYY R;  5E0O A;  1UUR A;  5AQN B;  2QYW A;  2UU9 T;  3RH3 A;  4H9N C;  4A97 A;  3J7Y q;  4X65 T;  1M7K A;  5LHG B;  4QWN B;  2H88 A;  2YDR A;  4HFH A;  1NWM X;  4HFB A;  5LXB A;  3ZN1 B;  1ZP0 A;  5AQU B;  4DND A;  2VKH A;  3T1Y T;  4AKH A;  4CI1 B;  4PFP A;  2NTY A;  2Q9Q B;  2CEA A;  2Z6E A;  2DCF A;  3B5M A;  5FVK A;  3IBP A;  3WAJ A;  2BBJ A;  3BQK A;  2C0S A;  4H9Q C;  2VK9 A;  2Q9Q A;  2JQH A;  4UXU A;  2J1D G;  2CBI A;  2Y48 B;  1Y64 B;  2LJL A;  5JVD E;  3C98 B;  3PUQ A;  2I59 A;  4DO0 A;  1WLX A;  2IUB A;  2XNT A;  5AQT B;  5FKY A;  3RIA A;  2XZE A;  4IL9 A;  4IE7 A;  2WN9 A;  5CB4 E;  3RYF E;  3PJA A;  1IBM T;  5GON E;  4ILU A;  1BR0 A;  1CHU A;  3UUM A;  5JH7 E;  1YQ3 A;  4QHO A;  2YKS A;  4QAA A;  2XQ8 A;  2BKO A;  2XNV A;  1NEK A;  4JEH B;  4U7I A;  3ZDG A;  3KVB A;  5ABE A;  3L39 A;  2D5U A;  2D9D A;  4DV2 T;  2X9X A;  4QX8 B;  5J2U E;  1IBL T;  2BS4 A;  2N1G A;  4AKI A;  3ZSS A;  4TWH A;  2KSR A;  4CI2 B;  4ADZ A;  2FJD A;  2W2U A;  2FBW A;  3CVR A;  2WBL A;  2ZJV A;  1T98 A;  4A5X A;  2CM0 A;  3ZJ2 A;  5AQR B;  2QRX A;  1HFA A;  1XMQ T;  4YSY A;  2A3D A;  4GOU A;  1BR1 A;  2OV9 A;  4KHP T;  3RLF F;  3P4R A;  3FHN A;  1D0Y A;  3SH1 A;  1JNR A;  5J5I A;  4X66 T;  3RC3 A;  2MYS A;  3U8N A;  1BR2 A;  4LFB T;  2X51 A;  4ZJS A;  2X00 A;  5C3J A;  4YTM A;  3LFM A;  5HXH A;  1WFD A;  3TLU A;  3HKC E;  4UM3 A;  4ZS2 A;  4QXC B;  1E2A A;  1UX2 A;  4IDQ A;  3WIP A;  3ONL C;  4ZK4 A;  5DJQ C;  5EK3 A;  1KNR A;  2I6H A;  1MMD A;  4DID B;  4G2A A;  3HR0 A;  3TLT A;  5CA0 E;  5KX5 E;  4UF0 B;  4DBQ A;  3ZDH A;  2X9Y A;  5JRE A;  3AEG A;  3VHL A;  4UF0 A;  4HWC A;  2JRK A;  2WSS V;  3JAF A;  2VB6 A;  4NZB A;  3CX6 B;  3JC6 C;  5CGM A;  2WU2 A;  3ZCJ A;  4UVA B;  3IF8 B;  5IUX A;  4I4T E;  4JUY A;  4O8S A;  4H9O C;  5EK4 A;  3AEF A;  4JI5 T;  3X1D A;  3RPU A;  4AXP A;  1LKX A;  1OED E;  3UU6 A;  1H7C A;  5FXV A;  3ZMS B;  2WQY A;  3CKD A;  2MOZ A;  4CXX A;  3FZH B;  4DV5 T;  4QAB A;  4UM1 A;  1D0X A;  4HKA A;  2DHR A;  2JIW A;  2UUC T;  1UX5 A;  3UU3 A;  2XQ9 A;  1WCR A;  3LK4 2;  5LMU T;  3MAC A;  5JR9 C;  5LG4 A;  4U2Z A;  3GWH A;  3N2O A;  3I9Y A;  1YD8 G;  4DV0 T;  4O4I E;  1D1B A;  2HH7 A;  1FEW A;  2VKD A;  1ZOY A;  4ZK1 A;  2BG9 A;  5LG3 A;  3PE0 A;  4X1I E;  4X1K E;  2DL1 A;  4H63 H;  3JAD A;  5IWA T;  1UX4 A;  3L8R A;  4UM3 P;  3VRA A;  1U5P A;  3O9X A;  2X9W A;  4H63 V;  3EDV A;  5HXR A;  1NEN A;  4A98 A;  2KT9 A;  4X1Y E;  4IRE A;  1N32 T;  2IAK A;  5HXS A;  3RYI E;  2BYQ A;  1SHZ C;  2KWH A;  3UUL A;  5L3D B;  4DR6 T;  2E8I A;  2PJQ A;  3U8K A;  2XQY A;  3Q5D A;  1X9B A;  3CK6 A;  3MZK B;  2W62 A;  5FXX A;  4TNW A;  2LSI A;  4DV4 T;  2E9X C;  4UVC B;  1XWM A;  1QUU A;  3G06 A;  3PUS A;  4KX6 A;  2IW5 B;  5J2T E;  4L9I A;  3RIU A;  4BA9 A;  1AJ3 A;  5J5F A;  2QGS A;  4JI1 T;  2QA7 A;  3V5S A;  2E2A A;  3TKL B;  1DU2 A;  3B13 A;  2LHR A;  2BS2 A;  1I94 T;  3E22 E;  2MAW A;  5JME A;  2WAU A;  3F31 A;  3PEO A;  4IE6 A;  4X5T A;  5DQV A;  5L3F B;  2DWK A;  4ZI3 C;  3WTH A;  2UXB T;  4PAG A;  2X68 A;  3R6N A;  2KND A;  3C4Z A;  5LMN T;  4YFS A;  3PUY F;  4OX9 T;  4A56 A;  5JR9 B;  3SS1 A;  1W9R A;  3ZC1 A;  5AFU L;  4ILC A;  2W63 A;  3I0O A;  2R6G F;  3K3O A;  2W67 A;  3E0Z A;  2WZH A;  5LGU B;  5JR9 A;  4HWI B;  3VR9 A;  4HWH A;  2BVL A;  4DMV A;  5FVL A;  4QX7 B;  4CN4 A;  3P4Q A;  3KV5 A;  3K3N A;  4Z8X A;  4ANJ A;  5FY1 A;  2IC9 A;  1S94 A;  3CQX C;  2WNJ A;  3N5L A;  1MMG A;  4YLH A;  2V6X A;  4HFE A;  4NUU A;  3ABV A;  4DV3 T;  5J5H A;  2XAS B;  1VCS A;  3EVY A;  4ZOL E;  5LCY A;  3I0Q A;  2WM9 A;  5L3C B;  5AQV B;  2XAQ B;  4P0B A;  5LHH B;  4ZHQ E;  5BR8 T;  4LMK A;  1HF8 A;  2PGZ A;  2ACZ A;  2E9X B;  2CE7 A;  2FJA A;  2UXN B;  4P1N A;  2ZM0 A;  3HKB E;  2WCA A;  3KVA A;  4U7Y A;  2K3W A;  3FZL B;  5KDM C;  4JYA T;  4HFC A;  5AQO B;  2JQK A;  2CXD A;  2E9X A;  3AA1 B;  3DP7 A;  3BQL A;  3AA7 B;  2MPK A;  2LSJ A;  5CO5 A;  4ZJT A;  4LF9 T;  5HWY A;  3AE1 A;  3TLW A;  4DVD A;  2BR8 A;  3RKO A;  3KBU A;  2GK9 A;  1D0Z A;  3IEE A;  2X0Y A;  1O3X A;  2LHN A;  2H3R A;  4JI6 T;  4QXH B;  3ZYK A;  2OLT A;  2VL8 A;  2FJB A;  3LG7 A;  4H9P C;  1XZY A;  5AQF B;  3ZKR A;  3PUA A;  2ZM8 A;  2LSY A;  2V7J A;  3CX7 B;  5FL1 A;  2CPT A;  1YXR A;  2WMN A;  5KZU A;  3AVS A;  4O2A E;  1MNE A;  2WDR A;  1G73 A;  1IBK T;  4UEL A;  3CML A;  2WZY A;  4P0A A;  3KBT A;  2EHO D;  4AIS A;  4WV9 A;  4XBF B;  5JDL A;  2YMD A;  4QAC A;  3RQU A;  2M6B A;  5AQJ B;  2DI4 A;  2PTF A;  3RQW A;  4GIW A;  4JV5 T;  3VRB A;  5J0Z A;  3LJC A;  3SRZ A;  3WTL A;  3DTO A;  2UZ6 A;  5JDM A;  5F8P A;  1FJG T;  2LOP A;  4O2B E;  5FXZ A;  4PK5 A;  3F2E A;  2V26 A;  4AKR B;  1VCT A;  4B6X A;  4JI8 T;  4OYK A;  2XQA A;  1T8B A;  4Z91 A;  4HFV A;  4U3C A;  3CQG B;  4AQF C;  4PJM A;  4LF6 T;  1HS7 A;  1M62 A;  5CJ5 A;  3Q5W A;  2J62 A;  4PJN A;  4N78 D;  4QH1 A;  2IC6 A;  2A2F X;  4U74 A;  5LA6 E;  1HG5 A;  1Z0P A;  3AVR A;  3KIN B;  3WTI A;  4JI4 T;  1MIW A;  4YSZ A;  2BS3 A;  3UFG A;  4DV7 T;  2CWY A;  3C50 A;  3P4P A;  2K5B B;  3U8J A;  3SFE A;  3ZMU B;  4Q25 A;  3OTO T;  4DBR A;  3Q5E A;  1N33 T;  5BW2 A;  5J1G A;  3UU8 A;  4OYJ A;  1WR6 A;  1MIY A;  2X67 A;  1W0A A;  5TAO A;  3EDU A;  2K9A A;  5BMV E;  4HN9 A;  4EOZ B;  2YN6 A;  4AIU A;  3LDQ B;  2C5K T;  2NW9 A;  4ZRU A;  2V7M A;  4EV6 A;  2BKP A;  3AE7 A;  2UUB T;  4CI3 B;  1E7P A;  3L3P A;  2BYP A;  2BYS A;  1LVF A;  5F5W A;  4TUY E;  4B3M T;  2PG8 A;  3AEE A;  3JAE A;  4DR1 T;  2BG9 C;  3K8P C;  3K3Q C;  3SOL A;  3KFW X;  5AFJ A;  2UUA T;  2NWB A;  4MLK A;  5L2L A;  4KHZ F;  3C64 A;  2PFV A;  5FJV A;  4ZZB A;  3IHR A;  3UU4 A;  4EEB A;  2Y8D A;  2K48 A;  5AQG B;  2JQ9 A;  2Y7Y A;  4EYU A;  4TNV A;  3E08 A;  2J4G A;  3QUJ A;  5AFH A;  4AQF A;  3ETU A;  4YHH T;  4DR3 T;  4IDO A;  3GN5 A;  2VKO A;  3UTK A;  2X9H A;  1HNW T;  5IHY A;  3NRY A;  1WRD A;  4PK4 A;  3L09 A;  4IGU A;  2JJ9 A;  5H6Q B;  2NR4 A;  5HCJ A;  3ZJ1 A;  2XTL A;  1Z8U A;  3N9O A;  3LBX B;  5AQL B;  5LGN B;  2XSB A;  3U3I A;  3H3M A;  4PW8 A;  3RIU C;  2ZMA A;  1W09 A;  4AKL A;  2WS3 A;  4HWF A;  3PUZ F;  3MJX A;  3HKE E;  2XQ5 A;  4YXD A;  2PH9 A;  4QH5 A;  2JMH A;  1HG2 A;  3LBX A;  4XHE A;  4ASK A;  5AIN A;  5CA1 E;  2WWU A;  3U8L A;  2JQQ A;  3A5X A;  2WNC A;  3PDY A;  3T1H T;  3WTK A;  4DR7 T;  4OFZ A;  3MKD A;  2V6Y A;  2BR7 A;  5FXW A;  2XAJ B;  4YTN A;  2NW8 A;  4IIJ E;  3N9N A;  5DQW A;  1UV6 A;  5LP6 E;  4HQP A;  3P50 A;  4DV6 T;  4FRR A;  3PV0 F;  4CXW A;  2BG9 B;  2ZM2 A;  2LE8 A;  2W66 A;  5C2T A;  2BBH A;  4BJM A;  3EAM A;  4COF A;  3PUG A;  3WTN A;  2YDQ A;  2LRL A;  4EZH A;  1D1C A;  4NPP A;  3O1J A;  1IAP A;  5EK2 A;  3OYZ A;  2XQ4 A;  2ODU A;  3ANW B;  1D1A A;  3F57 A;  4HEA A;  3NRX A;  2X0H A;  2BJ0 A;  1ZKE A;  3QK6 A;  1J5W A;  4GYR A;  4P09 A;  3ANW A;  1HNZ T;  2KMF A;  2KLQ A;  4ZXL A;  2LKG A;  2BDE A;  3BK9 A;  3O1I A;  4I55 E;  2W0G A;  2P9B A;  3FZF B;  4LF7 T;  3R84 B;  4ZI2 D;  3O4X E;  4MHC A;  5HEO A;  4B5D A;  1ZEE A;  5JDQ A;  1KF6 A;  2JMK A;  5JRC B;  4EIW A;  4OK0 A;  4BQT A;  2MBG A;  1ZV4 X;  2ACX A;  2YOE A;  4IDN A;  4MFR A;  5JRC A;  3N2K E;  3C51 A;  1NAF A;  4IE4 A;  3VR8 A;  5FL0 A;  1X79 A;  4KMC A;  4D01 A;  3IA3 A;  2IIU A;  2CHO A;  3U8M A;  1S35 A;  5HEJ A;  2CLY B;  3UUN A;  2YME A;  4HGA A;  3OPC A;  4E7S A;  2N9D A;  2DNX A;  4LMJ A;  3CX8 B;  2KZ7 B;  2LM9 A;  4DUY T;  4EXT A;  1KFY A;  2A9U A;  3C84 A;  3ZYL A;  2LT3 A;  1LRZ A;  4BFQ A;  4IST A;  3ONJ A;  2XYS A;  1IZN B;  2A72 A;  2K24 A;  3AEC A;  4ERR A;  3ESL A;  4TV8 E;  2VQE T;  3C4W A;  3NBX X;  3I9W A;  3DJB A;  5JDH A;  4HWD A;  1VOM A;  2QC1 B;  4O4L E;  4B3T T;  3KV9 A;  4U33 A;  1BR4 A;  5LJM A;  2M67 A;  5LYJ E;  2BKN A;  4WBO A;  3GMI A;  4WZX A;  5LGT B;  2D0U A;  2XQ3 A;  3P4W A;  5JDN A;  2YU2 A;  5AFK A;  4CZZ B;  2V1D B;  2MTQ A;  2VQF T;  5FP3 A;  2LEH A;  3C79 A;  2DLR A;  3HI2 A;  3AE3 A;  1YW0 A;  2CMR A;  2XSA A;  3NWI A;  3AA0 B;  3RRW A;  4IT4 A;  4WNK A;  3ZPO A;  4JI0 T;  4Z90 A;  1N34 T;  3N9L A;  2YEV C;  4UM3 S;  3N9Q A;  4IDP A;  3LK3 B;  2ZM6 T;  2VKJ A;  5HYA A;  2C5I T;  4HFD A;  2LLY A;  2D2S A;  4NXN T;  3EI0 A;  5IYZ E;  5C8Y E;  2XJ7 A;  5AFL A;  4PFO A;  3ZYM A;  4NXM T;  1KNP A;  3PUW F;  3TLV A;  4GKJ T;  4WYV A;  3PMZ A;  3AB3 B;  1UK5 A;  4F6R C;  4PJJ A;  3FZM B;  3PU3 A;  2V5D A;  4ZI3 D;  3AE4 A;  4UVB B;  4TV9 E;  2CXF A;  5EZY E;  2AXD S;  2WZI A;  3J9X 1;  5AFM A;  4XZC A;  3Q2M A;  3W15 B;  2RA1 A;  3CWZ B;  5FY7 A;  3ZT6 A;  3KV4 A;  4ZI7 E;  4YJ2 E;  4ILB A;  1ZHC A;  3MA9 A;  3Q9D A;  2V7L A;  4LF5 T;  2J47 A;  2E5L T;  2XYT A;  1KNZ A;  4AFH A;  4AFT A;  2XZ5 A;  2C5J A;  2JPF A;  3PJA J;  2CRB A;  4B3S T;  3VU7 H;  3A8Y C;  4TWD A;  2VVN A;  3ETV A;  4LF8 T;  3OJA A;  1KK7 A;  1IJ5 A;  3KV6 A;  4FI5 A;  3RC8 A;  2CA5 A;  4YHJ A;  2XAF B;  2ZLY A;  5FYM A;  2EHO B;  1HNX T;  1HX8 A;  3MK7 C;  4EB6 E;  3T8O A;  3ZMV B;  3QNU A;  3QB5 K;  3RKG A;  3FB2 A;  1YKE B;  2CCQ A;  1QSD A;  4EGW A;  5SYO A;  3UFE A;  2W4X A;  2EHO A;  2Y6X A;  1KEY A;  5AQI B;  3D0T A;  1WYB A;  1WYC A;  4IE0 A;  2YDS A;  4LFC T;  5ABF B;  4GKK T;  3WI3 A;  2LOS A;  2Q9Q D;  1CUN A;  3FZK B;  2BZB A;  5JDF A;  3GUA A;  3N9P A;  2X66 A;  5ABF A;  5JTG A;  4HE8 A;  3AXJ B;  3UT5 E;  4KUM B;  2XPK A;  4UEM A;  3IGQ A;  4C90 A;  2WY2 A;  1I9B A;  5L3G B;  2XM1 A;  3QOF A;  2CHN A;  3AXJ A;  3WAK A;  4GK0 E;  3CPZ A;  3JCF A;  4WBN E;  2UXX B;  2XQ7 A;  4NIQ A;  3PU8 A;  2WU5 A;  4V1A v;  3AA6 B;  4JI2 T;  3TLS A;  3H3A A;  3QB5 A;  2QVA A;  2XAG B;  3EAB A;  1HX1 B;  2LSK A;  3RHW A;  1L0V A;  1XDP A;  2WMO A;  5KMG P;  2V8S V;  4MBQ A;  2IDO B;  4ZEY A;  4PJL A;  4DR4 T;  4JI7 T;  2Y57 A;  2G0U A;  3SQ6 A;  4ISS A;  2W8F A;  2VAS A;  3AE2 A;  2C9T A;  4ZR6 A;  3RYC E;  5M4Y A;  2IHR 1;  4IDZ A;  3BQI A;  3ZC0 A;  4X20 E;  1SUM B;  4PIR A;  2D0T A;  2WDQ A;  5LXT E;  2ES0 A;  4UR9 A;  5L3E B;  2X00 D;  4DMW A;  5BP0 A;  2XM2 A;  5H6R B;  4B3R T;  4C91 A;  2VUR A;  4F8H A;  1YKH B;  3AEA A;  1MMN A;  1MIV A;  2H89 A;  2SPC A;  3HL6 A;  3GN5 B;  3P7I A;  4OHF A;  2UXD T;  2CXL A;  3A7M A;  2BG9 E;  3M3Z B;  2HN1 A;  3PUV F;  3RI5 A;  5ABG A;  2WP9 A;  3SWH A;  3GA8 A;  1G8X A;  3HKD E;  2V5C A;  4YSX A;  2V7K A;  5JDG A;  2NW7 A;  4U31 A;  4ILA A;  1E1H B;  3ZT7 A;  3Q5X A;  2UXC T;  4H9R C;  5FY0 A;  4G63 A;  4UY2 A;  1FMV A;  4WW0 A;  5AQQ B;  3SQ9 A;  4AQG A;  3P4S A;  1UUS A;  1OXZ A;  5TVC A;  1OED C;  5L4E A;  5HEU A;  5AQS B;  1JNZ A;  4GYS A;  4ZI2 C;  3H37 A;  2V6Y B;  2FUP A;  3OBV E;  1N36 T;  4CQI A;  4CN1 A;  4IHJ E;  4QXB B;  3NKZ A;  5FMN A;  5L4H A;  2PBI A;  4TWF A;  1UGO A;  2WNL A;  4AI6 A;  2XAH B;  3ZEF B;  4DR2 T;  1I6Z A;  1HTJ F;  2CLY C;  1FIO A;  3P8C D;  4PNI A;  4ALX A;  5LHI B;  3VKH A;  3ZMZ B;  4JLE A;  4K0K T;  2WB5 A;  2Y56 A;  4O4J E;  3VKG A;  1XMO T;  5LOV E;  3KDS E;  2DWG A;  2NOX A;  4EAH A;  4YJ3 E;  4EZ1 A;  3NZP A;  1R8I A;  3NVO A;  3AAI A;  1MND A;  2BYN A;  3S4U A;  1EZ3 A;  1US7 B;  2LSG A;  3AE8 A;  4L5G A;  3FXD B;  4L0R A;  4YTP A;  5CFB A;  2XQ6 A;  5HCM A;  3EUH A;  3M65 A;  3OKQ A;  1VRB A;  2XNU A;  2XZ6 A;  2XHE B;  5LNK A;  5HWX A;  2VVS A;  3LK2 B;  2LKH A;  2H7V C;  3CQC B;  2YU1 A;  2M6I A;  3PUR A;  5AFN A;  3FBL A;  2HN2 A;  4UV8 B;  4X62 T;  3T4M A;  3SFD A;  2NTX A;  4MAL A;  4EED A;  3ONX A;  2L9Q A;  3K1S A;  4JBW F;  2XY8 B;  4DBM A;  4DV1 T;  1OED B;  3UU5 A;  1GQE A;  3JC6 D;  4X64 T;  2XUE A;  4LML A;  1U4Q A;  3C4X A;  2F4V T;  4ZZC A;  1UW6 A;  3OVU A;  5JQG E;  4AQY T;  3RIF A;  2HHH T;  1OED A;  4EZ4 A;  5HXC A;  1HR0 T;  1T72 A;  3WTO A;  1Y01 A;  5FNV E;  4UV9 B;  2HPL A;  3RRC A;  5AQH B;  1SE7 A;  2AE9 A;  3FXE B;  3RGL A;  1J5E T;  5ETW A;  2FJE A;  2ZJU A;  3ZMT B;  2L3L A;  4YT0 A;  2RP4 A;  1IJ6 A;  3QC9 A;  2YK0 A;  1WR0 A;  3U78 A;  3UUX B;  4I50 E;  1V9D A;  2Y54 A;  2RPA A;  3ZST A;  3RF1 A;  2WDV A;  4CXY A;  4BJN A;  4IE5 A;  3MXZ A;  3WTM A;  3RYH E;  2B1E A;  3ZCI A;  4M1P A;  4BAY B;  3ZLI A;  3B57 A;  5AQP B;  5LJN A;  4DR5 T;  3AE5 A;  5F3J A;  3NZQ A;  4GK5 E;  2WWV A;  4K0U A;  3ZT5 A;  2W61 A;  3V5U A;  5BRX A;  2KIN B;  4DUZ T;  3AAE B;  4IL4 A;  2V7I A;  2X0L B;  2W00 A;  5LBQ B;  1B7T A;  5ADX L;  1J1J A;  5LBM A;  5HXE A;  2EHO C;  3HA4 A;  5HEH A;  1T7S A;  4PK6 A;  1W0B A;  3SIO A;  3AED A;  1MMA A;  4LF4 T;  5KXJ A;  2YIN A; 
#chains in the Genus database with same CATH homology
 3U8M A;  3EI0 A;  5HEJ A;  4LML A;  3EAM A;  3LSV A;  4TNV A;  4A98 A;  4PIR A;  4ZZC A;  1UW6 A;  3ZDG A;  4COF A;  2YME A;  3RIF A;  2X00 D;  5AFL A;  4IRE A;  5AFH A;  1OED A;  5BP0 A;  3WTN A;  4LMJ A;  2BYQ A;  3WTI A;  3JAF A;  4ALX A;  3WTO A;  3TLV A;  3PMZ A;  3GUA A;  3ZKR A;  4NZB A;  4NPP A;  4F8H A;  3UUB A;  4TWH A;  2KSR A;  2WNJ A;  2Y56 A;  3U8K A;  3U8J A;  5IUX A;  3IGQ A;  2XQ4 A;  2ZJU A;  5KZU A;  4HFE A;  1I9B A;  2ZJV A;  5BW2 A;  4XK9 A;  4A97 A;  3UU8 A;  5AFM A;  3C84 A;  4EZ1 A;  4TNW A;  2BG9 E;  4HFH A;  3UQ7 A;  2WZY A;  4BFQ A;  4AFG A;  4HFI A;  4HFB A;  2XYS A;  4WV9 A;  2BJ0 A;  5HCJ A;  1OED E;  5LXB A;  5J5H A;  3RI5 A;  3UU6 A;  3SH1 A;  2YMD A;  4QAC A;  3RQU A;  2BYN A;  3UU5 A;  2Y54 A;  2M6B A;  5HEG A;  5J5I A;  5AFM B;  4ILB A;  2YN6 A;  4QH4 A;  2LM2 A;  3RQW A;  4UM1 A;  4QAB A;  5L47 A;  2XQ5 A;  2PH9 A;  3U8N A;  2XQ7 A;  4QH5 A;  2LKG A;  4ILA A;  2QC1 B;  3WTM A;  3WTJ A;  4ZRU A;  5J5F A;  5J0Z A;  4XHE A;  3WTL A;  2XYT A;  2W8G A;  4LMK A;  5CFB A;  4AFH A;  4AFT A;  5AIN A;  2XZ5 A;  2PGZ A;  2UZ6 A;  2X00 A;  2VL0 A;  4ZJS A;  2XQ6 A;  5HCM A;  2BYP A;  3TLS A;  4UY2 A;  3U8L A;  2MAW A;  2BYR A;  3UU3 A;  5JME A;  2BYS A;  4UXU A;  4TWD A;  2XQ9 A;  3TLU A;  2WNC A;  3EHZ A;  2XNU A;  2XZ6 A;  3PEO A;  3WTK A;  4X5T A;  4UM3 A;  5BRX A;  3SQ9 A;  2XQ3 A;  3P4W A;  1UX2 A;  5AFK A;  2LKH A;  5HEO A;  4HFC A;  3WTH A;  3JAE A;  4B5D A;  3WIP A;  2BG9 C;  4ZK4 A;  2BR7 A;  3RHW A;  4D01 A;  5TVC A;  4IL4 A;  2XQA A;  2XNT A;  1OED C;  3C79 A;  4Z91 A;  3RIA A;  2M6I A;  4ZK1 A;  5AFJ A;  5L4E A;  5AFN A;  5HEU A;  2BG9 A;  4IL9 A;  5LG3 A;  2WN9 A;  5KE4 A;  5HEH A;  4BQT A;  5CO5 A;  4ZJT A;  1UV6 A;  2Y57 A;  5FJV A;  4ZZB A;  3T4M A;  2YOE A;  3UU4 A;  5SYO A;  3SQ6 A;  4HQP A;  3P50 A;  3TLW A;  3JAD A;  4FRR A;  2W8F A;  4Z90 A;  2BR8 A;  3SIO A;  3TLT A;  2BG9 B;  2YKS A;  5L4H A;  2C9T A;  4QAA A;  4ZR6 A;  4ILC A;  5J5G A;  4UM3 S;  4DBM A;  4UM3 P;  4TWF A;  2Y7Y A;  2XQ8 A;  1OED B;  2XNV A;  4QH1 A;  3UQ4 A;  2Y58 A;  2WNL A;  4HFD A;  3ZDH A;  2LLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...