5HCMA

The glic pentameric ligand-gated ion channel 2-21' cross-linked mutant complexed to bromoform
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Sites of Anesthetic Inhibitory Action on a Cationic Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hcmA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hcmA01
4QABA 5KZUA 4QACA 2WNJA 4ILBA 2PGZA 2WZYA 2YN6A 5AFMA 5TVCA 4UXUA 4Z90A 2BG9A 3SIOA 3U8NA 4TWDA 5FJVA 5HCJA 5J0ZA 5AFNA 2Y56A 2LKHA 2BYQA 4A98A 4HFIA 4ALXA 3WTNA 3UQ7A 4XHEA 2YKSA 2XQ8A 2XQ9A 3LSVA 4UM3P 3JAFA 3RQWA 4ZK4A 3JADA 2BR7A 5HCMA 4LMJA 4TWFA 3EHZA 4LMKA 3SH1A 3WTKA 2ZJUA 3T4MA 4AFGA 2BYPA 5JMEA 3TLUA 4HFCA 4ZJTA 2XQ6A 4TWHA 3C84A 4TNWA 4ILAA 4FRRA 2WNLA 5J5IA 2LM2A 5HEHA 5LG3A 2QC1B 4ILCA 4D01A 5L4EA 4QH1A 4ZK1A 2XQ3A 2Y57A 2YMDA 4QH5A 2BG9E 2PH9A 1I9BA 2XZ5A 2X00D 2XQ5A 3UU6A 2BG9C 3TLTA 3UU8A 3UU3A 3PMZA 4ZR6A 2M6IA 1OEDB 5BW2A 4IL9A 5HEJA 3U8KA 3RIFA 4ZZCA 4B5DA 4BFQA 3RI5A 4EZ1A 3TLSA 2C9TA 5AINA 5AFLA 5KE4A 4UM1A 5CO5A 3EI0A 4UY2A 3U8LA 3UU4A 2XQAA 4UM3S 4HFEA 4Z91A 2BYSA 2XNVA 2WN9A 2YOEA 3U8JA 5SYOA 3RIAA 1UV6A 5IUXA 4ZRUA 3WIPA 2Y54A 4DBMA 5HEUA 3WTLA 5J5FA 2KSRA 3ZDGA 2YMEA 4QH4A 3SQ6A 3UUBA 4HFDA 2WNCA 4LMLA 2M6BA 2Y58A 2Y7YA 3ZDHA 1UX2A 2X00A 3UU5A 2LLYA 4IREA 2BJ0A 3P50A 1OEDA 2MAWA 4A97A 3RHWA 4HFHA 5L4HA 2XNTA 1UW6A 2ZJVA 4NPPA 2LKGA 4WV9A 4X5TA 3TLWA 5LXBA 2W8FA 4UM3A 2XQ4A 2BR8A 5AFHA 3WTIA 2XYTA 2XQ7A 4HQPA 2XYSA 4ZZBA 2W8GA 3PEOA 4F8HA 4COFA 4HFBA 3SQ9A 3WTJA 5AFMB 2VL0A 5HEGA 3C79A 4ZJSA 2BG9B 2XZ6A 3GUAA 3WTMA 5BRXA 5J5GA 3RQUA 4PIRA 3U8MA 2BYRA 3TLVA 4XK9A 2BYNA 4AFTA 4AFHA 3IGQA 5AFJA 3ZKRA 3P4WA 5BP0A 3JAEA 5J5HA 2UZ6A 1OEDE 3WTHA 3WTOA 2XNUA 4BQTA 4NZBA 1OEDC 3UQ4A 4QAAA 3EAMA 5AFKA 4TNVA 5L47A 5HEOA 4IL4A 5CFBA
chains in the Genus database with same CATH superfamily
1ZP0A 5KZUA 4CI3B 4CN4A 3SIOA 1ZKEA 5LMNT 4JI2T 5EK2A 3CQGB 4N78D 4XHEA 4O2AE 2XQ9A 2GK9A 3RQWA 3Q5WA 3ANWB 2CBIA 2ZJUA 4E7ZA 3AE4A 2H3RA 1N34T 5JR9A 5LYJE 4U33A 2ZM0A 3GWHA 2LHRA 4JI7T 3KV9A 2BG9E 4EZHA 1QSDA 1XDPA 4ASKA 3AE2A 3ANWA 3RIFA 2K5BB 5KE4A 4PNIA 3FXDB 4P1NA 2ZM8A 3KFWX 4YHHT 3PE0A 4ZRUA 5JR9C 4YT0A 2XAGB 2JQ9A 1XDOA 3C4XA 3PUXF 3S4UA 3CQCB 4UF0B 5C3JA 2MAWA 3I1AA 2CRBA 4NPPA 3ABVA 4QXBB 3M65A 1HCIA 3PUQA 3VRBA 2DLRA 5F3JA 4IIJE 5HXCA 3LBXB 3T1YT 3C79A 3AEAA 4X65T 2ACXA 2VQFT 4UF0A 3W15B 2X66A 4XK9A 3B5MA 3U78A 5LHIB 2WM9A 3FXEB 2YU2A 4U7YA 3WTHA 3O1IA 1D1AA 4WYVA 3N9MA 4IL4A 2XNVA 2WDQA 2WU2A 2WNJA 3ONLC 3LBXA 4XAXB 4X62T 5AQUB 2W66A 4QXHB 4HN9A 3OVUA 1KF6A 1ZHCA 3CPZA 3ZSSA 2YK0A 1W09A 3B57A 2K24A 2CHOA 5AQPB 4JUYA 2IC9A 5HEHA 2WDVA 4OYKA 4QH1A 4P0AA 4HFVA 5JDQA 2UUCT 2PH9A 2EHOB 2VKDA 2W62A 5JDFA 4U74A 3ZJ2A 5LXTE 2VK9A 3NRXA 4AQGA 5AFLA 2V5DA 3I0OA 1HNZT 2UUBT 1VOMA 4WBOA 3HKCE 5L3DB 3RKOA 2LSJA 5DQWA 5AQVB 3RKGA 1HNWT 3NVOA 4TUYE 4JI6T 2F4VT 2Q9QA 5AFHA 1KFYA 4O4LE 3ZMSB 1IBLT 3FBLA 4DV0T 1I94T 4L0RA 5BRXA 2FUPA 2DNXA 3AA7B 3ZKRA 5J5HA 2JPFA 3SOLA 4QAAA 3AA6B 2V7IA 2LEHA 4Q25A 5AQHB 2VQET 4O4IE 3RX6A 4JEUB 3VHLA 3F31A 1WLXA 1N33T 3Q5DA 4EGWA 1MMDA 5HCJA 1S94A 3AB3B 1B7TA 4HWFA 3LSVA 2BR7A 5HXRA 2CWOA 4TN7B 3WTKA 2WP9A 4AKRB 3MZKB 3P8CD 2CXDA 5AQIB 4CI2B 1JNZA 2YEVC 3LK3B 3ZMZB 4TX5A 2LM2A 4ERRA 3LK2B 4K0KT 5AQQB 1I9BA 3TKLB 4AQFA 4ZI2D 2CEAA 2DCFA 4AKIA 3E0ZA 3ZLIA 2JQHA 4JI0T 3U8LA 4QHOA 2WN9A 4EYYR 1LVFA 3DP7A 2V8SV 2DWGA 3UUBA 1T72A 1NEKA 3ZDHA 1W9RA 2L8KA 4X1IE 5ABHA 4A97A 4AQFC 2DWKA 1HTJF 2K48A 2Z6EA 2PBIA 2XYTA 5C2TA 2W00A 4NXNT 3J7Yq 4JI4T 2LSKA 3QK6A 4GKKT 2IDOB 4H9SE 1YKEB 4LF4T 3QB5A 3QUJA 3AEEA 1MIWA 4HWDA 2W4XA 5ABEA 4QABA 1XWMA 3C98B 3AE8A 3Q5EA 5LOVE 1WR6A 4UVAB 4B3TT 2W67A 1FIOA 3UUNA 4Z8XA 3UT5E 2LJLA 5JRCA 4WBNE 4G2AA 5LG3A 2QC1B 3C4WA 2YMDA 3DJBA 3RPUA 4CXYA 5FP3A 5J1GA 2LRLA 3ZT5A 3LK42 1YKHB 1J1JA 5AQLB 4O4JE 2XM2A 4X1KE 2ZM6T 2HN2A 1QUUA 2KXPB 4DBMA 1NAFA 4X66T 2WNCA 4LMLA 2M6BA 1E1HB 2Y58A 2IMLA 2XY8B 4EEDA 2WAUA 5JQGE 1YW0A 4YLHA 1NWMX 2XJ7A 2RP4A 5LXBA 4X1YE 2RPAA 4ANJA 1L0VA 2XQ7A 2XYSA 3BQLA 3R6NA 3ETVA 5DQVA 4JI1T 3WTMA 3U8MA 4BAYB 2C0SA 3RYHE 5AQTB 2PG8A 4LFCT 1BR0A 5AFNA 4C91A 2I59A 3ZT6A 5HAXA 5J0ZA 4B6XA 3CQXC 3OPCA 3SWHA 2W2UA 2C5KT 3BK9A 2Q9QD 3KV4A 4ZJTA 5JH7E 3KDSE 2ZM2A 4LFBT 4ZK1A 4C90A 2Y6XA 1KNRA 4WNKA 5AQRB 4O8SA 4AQYT 3AXJB 1OEDB 2IW5B 3P4QA 2XUEA 3BQKA 2WB5A 5AQFB 3ZCJA 3UU4A 3L8RA 2BYSA 1HFAA 1U4QA 2YOEA 2D5UA 3LFMA 3IA3A 2MOZA 2D0TA 4KI0F 5FXZA 5HWXA 5F8PA 4QH4A 2LRKA 1HF8A 4DV7T 3AXJA 1OEDA 2BS3A 3RHWA 4KBMB 4WV9A 3TLWA 4UM3A 2AE9A 4CN1A 1N32T 1WYCA 2V7JA 1WFDA 4PJLA 4HGAA 1X9BA 3TLVA 4AFHA 2ODVA 3GN5B 4L9IA 2CCQA 3CX7B 1OEDC 1D1CA 2MBGA 5L2LA 3ZC0A 2FJDA 4QACA 5ABFB 3QC9A 5LBQB 4K0UA 3AVRA 4XBFB 2PJQA 1HR0T 4GK0E 5FJVA 2YDRA 4KHPT 4EV6A 4HFIA 3GN5A 3R84B 5HCMA 3OBVE 3NWIA 2FJBA 3SRZA 3MA9A 3NZQA 2WWUA 5ABFA 4ZI3C 4P09A 2X00D 2H7VC 2XQ5A 3TLTA 3UFGA 4UIGA 3U3IA 5L3GB 5BR8T 3TLSA 2J4GA 5LHHB 2VB6A 1BR2A 5IUXA 2KWIB 1SE7A 3L39A 4UEMA 4FI5A 3RIUA 3K3OA 3QNUA 4YTMA 3AECA 3H3AA 4L5GA 1UX2A 4U7IA 1HNXT 2D2SA 4HFHA 2X9WA 2X9YA 4CZZB 3FZKB 2ZLYA 3JC6C 2WCAA 3KINB 1J5WA 1H7CA 4DBQA 2VL0A 5A1LA 3RIUC 3HI2A 4E7SA 1LRZA 3ZN0B 3AAAB 1XMOT 3IGQA 2IHR1 5LG4A 5AFJA 4DVDA 2UXXB 1FEWA 3G06A 3HKEE 3LG7A 4GYSA 4IT4A 5EK3A 3FHNA 2L3LA 1R8IA 5IWAT 4UXUA 1HX1B 1D1BA 3UULA 1WYBA 2HH7A 1SUMB 4LMJA 5L3EB 1VCSA 3CKDA 2X51A 4G63A 2V6YB 3VR8A 2VKHA 4ILCA 1T98A 5HWYA 1MNDA 3B13A 4QX7B 2KLQA 4QH5A 2JRKA 4DMVA 3PMZA 2LE8A 3FB2A 2CWYA 2WU5A 4Z91A 2V6YA 4CN6A 3RYIE 3P7IA 2BZBA 5J5FA 3WTLA 3O4XE 2J62A 3IBPA 2BS4A 4UVBB 2YMEA 2X9XA 3SQ6A 1X79A 4O2BE 1FJGT 2Y7YA 4AISA 5HYAA 2BBHA 3K3NA 3OTOT 3RLFF 3IEEA 3PUAA 4DUZT 3KBUA 1IBMT 3PJAA 2WSSV 3AA0B 5AQGB 2UXNB 5JTGA 2XZ6A 3IF8B 3GUAA 5LGNB 3ONJA 4ISTA 2EHOA 2VVNA 4BA9A 4IDOA 3ZSTA 4CQIA 3WTOA 2XNUA 3UQ4A 3EAMA 4J2CA 2D0UA 4ZHQE 1IJ6A 3L3PA 3CIRA 2YN6A 5TVCA 4ZI7E 4ALXA 2P9BA 4DR1T 5C8YE 2EHOC 4AKLA 2HPJA 4H63H 2XSBA 2XQ6A 2UXBT 2UUAT 1HG2A 4FRRA 4H9QC 3AE1A 3MKDA 4HKAA 2PFVA 3NBXX 2CXFA 2E5LT 3RH3A 5BW2A 5HEJA 2C9TA 4UV8B 1SA0E 4UY2A 3C64A 4U72A 4IE0A 1UV6A 2XAQB 5HEUA 1MMGA 4LF8T 2RA1A 3AE3A 1Z0PA 3PUGA 3PU3A 1MIVA 4UR9A 4CXWA 4EAHA 3AEBA 5KX5E 4IE5A 2A2FX 4U2YA 3RC8A 1UUSA 3A8YC 2BR8A 4JLEA 2OA5A 4ZZBA 1UX5A 4QXCB 3AAIA 3O1HA 1US7B 5FXVA 4AKGA 4DIDB 3J9X1 4IDPA 4AKHA 3AEDA 3JC6D 3RRCA 3BQIA 2WDRA 1I6ZA 2KZ7B 4ADZA 2X68A 3PUSA 3H3MA 4JI8T 2IC6A 5FVLA 2XQYA 2K9AA 4ILBA 5L3BB 4I4TE 2FJAA 4LF5T 3OYXA 1GQEA 1ZEEA 1KNZA 3I9YA 2QGSA 3O9XA 5AQNB 2XQ8A 4NUUA 4AFGA 1O3XA 2C5IT 4TNWA 2NTYA 2I0MA 5J5IA 5ABGA 1Z8UA 2H88A 4PW8A 5LMUT 3A5XA 2JMKA 4NUVA 3C51A 2V7KA 3N9LA 3UU3A 4DV1T 4MHCA 4ZZCA 4KUMB 3N5LA 1QLBA 3UUXB 5AINA 2QYWA 2LSIA 4UM1A 2WMNA 2BKNA 2VKJA 4DV2T 4AXPA 3K3QC 4ZS3A 3T8OA 4GKJT 5LGUB 3AE9A 3P50A 4UXNB 5BMVE 1YXRA 3DTOA 3ZEFB 3IHRA 3Q2MA 4LF9T 2XM1A 2LSYA 3P4PA 1AJ3A 3SQ9A 5KDMC 2BG9B 5IHYA 1S35A 2PTFA 2BYNA 3D0TA 4AFTA 3JAEA 5AFUL 4PK6A 4DV6T 3AE5A 4PFPA 3RGLA 3AVSA 2DI4A 4QX8B 1T7SA 4GYRA 3PJAJ 2BG9A 4EEBA 5CA1E 4I43B 4ISSA 3AE6A 2NR4A 4UM3P 3CK6A 4LMKA 4DMWA 3SH1A 2LHNA 3T4MA 2BYPA 2LM9A 4JI5T 3JCFA 3CVRA 3AA1B 2R6GF 4TWHA 4ILUA 2E8IA 1UCUA 3SS1A 4ILAA 3AEFA 4YY3T 2CMRA 5ETWA 3ZMTB 2CXLA 5FMNA 4WZXA 2LSGA 2EHOD 3UU6A 2BG9C 2WWVA 5TAOA 3L09A 2WQYA 3EI0A 2YDQA 3ONXA 3AAEB 3ZMVB 5FY0A 2E5VA 4AIUA 2KSRA 1KK7A 5FL1A 3E08A 2XNTA 1CHUA 2LKGA 5JDLA 2CBJA 2W8GA 3HR0A 5LGTB 4DUYT 4PIRA 2DL1A 5ADXL 5L3FB 4YSYA 2KWHA 3H37A 3P4WA 4H9RC 2UZ6A 1SHZC 4EXTA 2VWAA 2VKOA 2B1EA 3VKGA 2BVMA 1G8XA 1HG5A 3FBZA 3SFEA 4O4HE 1YQ3A 3P4RA 2FJEA 3HA4A 4ZK4A 1BR4A 3MJXA 2B76A 2VL8A 4JV5T 4DV5T 5LCYA 3ESLA 3HKBE 4YXDA 1M7KA 2A9UA 2YU1A 3N9PA 3NRYA 4ZS2A 2MTQA 1W0BA 3WI3A 2WNLA 5L4EA 2K3WA 2JJ9A 2XQ3A 2WMOA 3ZYMA 1WRDA 4B3ST 4HWHA 2D9DA 2Y8DA 4H63V 3ZC1A 3UU8A 4PJNA 4DNDA 2JMHA 5JREA 1ZV4X 3U8KA 2BBJA 4EZ1A 5FNVE 4HFEA 1VRBA 3U8JA 2CLYB 3K8PC 4CXXA 3ETUA 3N9QA 2Y54A 5JDMA 2XSAA 3ZDGA 1N36T 2XAHB 5LJMA 3UU5A 2V6XA 1BR1A 3I9WA 5FY1A 1D0ZA 2XQ4A 5LNKA 4I55E 3PEOA 3WAKA 4F8HA 4COFA 2N2NA 2V1DB 3GA8A 4YTNA 3A7MA 3ZT7A 4YFSA 5H6QB 5AQSB 2KINB 4JBWF 2CPTA 4IGUA 4OYJA 4ZI2C 3HKDE 4BQTA 3F2EA 2CHNA 3F57A 2PGZA 2NW9A 2HHHT 2CLYC 1YQ4A 4Z90A 3N2OA 2L9QA 2J47A 4JEHB 3WTNA 4F6RC 4PK5A 1OWAA 3FZHB 2E2AA 2ES0A 4NXMT 4XZCA 2V7LA 5LJNA 4OX9T 3PDYA 2Y57A 5FKYA 1UURA 1FMWA 5IYZE 4MBQA 5JDGA 4ZR6A 2M6IA 1IJ5A 2NW7A 4BFQA 4MFRA 2G0UA 4BJMA 2IUBA 2VVSA 2XQAA 2JQKA 4PFOA 4A56A 1UK5A 5EZYE 3WIPA 1XZYA 4DV4T 4CI1B 4ZEYA 2E9XB 3CMLA 4IREA 3VRAA 1XNQT 2VURA 2XAFB 5L4HA 4YTPA 2NP9A 1CUNA 3SFDA 4KHZF 3WTIA 3RC3A 4HQPA 2WZIA 1ZOYA 4LF7T 4LF6T 4IE6A 2OLTA 1UX4A 2E9XA 2QA7A 4X20E 3ZMUB 2BS2A 4DR3T 3Q5XA 1OEDE 4NZBA 5E0OA 3NKZA 3EABA 5LB7B 3GMIA 5LBMA 5CB4E 3PV0F 4IDNA 2A72A 3VU7H 3UQ7A 2XZEA 3JAFA 5J2TE 2E9XC 5DJQC 5F5WA 5CA0E 3E22E 5KMGP 2Q9QB 3EVYA 1D0YA 5FXXA 3RYFE 4EYUA 1HS7A 4BJNA 2SPCA 2C5JA 3CX6B 2XZ5A 1MIYA 2VASA 3RI5A 1HX8A 2KNDA 3LJCA 4PJJA 3HL6A 4YSXA 4IHJE 2V5CA 4HWCA 4ZOLE 4JI3T 3NZPA 2N1GA 4GIWA 2LLYA 2HPLA 2BKPA 4GOUA 4KMCA 2H7OA 1UW6A 3N2KE 5M4YA 4LFAT 2MPKA 2XASB 1IAPA 2Q9QC 2WS3A 2NTXA 4ZI3D 5AFMB 3C50A 5HEGA 3UTKA 3RQUA 2XHEB 2XPKA 2I6HA 1OXZA 2OV9A 3O1JA 3KVAA 5AQJB 2W0GA 4HWIB 5HEOA 5LA6E 3RYCE 3PTRB 2YINA 5AFMA 3T1HT 3U8NA 3P4SA 3MXZA 2JQQA 2LKHA 2W61A 1IZNB 3N9OA 2BYQA 4DO0A 1XMQT 2QRXA 4OFZA 3PURA 4B3RT 3C4ZA 1U5PA 4YHJA 2HN1A 3EUHA 3FZLB 3RRWA 4KX6A 4TV9E 1WR0A 4I0UA 3KVBA 2X9HA 3VKHA 2ODUA 3Q9DA 3ZN1B 4OHFA 5CO5A 5JDHA 4QWNB 4WW0A 3KBTA 2IAKA 1WCRA 5L3CB 2NOXA 3AEGA 3RIAA 3FZFB 4DBRA 3PUWF 4H9OC 1IBKT 2X00A 5HXEA 5EK4A 4MLKA 5JRCB 4A5XA 2X0YA 2QVAA 2BVLA 2DHRA 2ACZA 5FVKA 2JIWA 3PUYF 4TV8E 3QOFA 1JNRA 1FMVA 4DV3T 5FYMA 4IDQA 4EZ4A 2V7MA 2H89A 3MACA 4PK4A 4GK5E 4DR6T 4FJOA 3WAJA 4HTEA 2X0HA 2A3DA 2CE7A 2WZYA 4JYAT 4QKNA 4TWDA 4TZ4C 3RF1A 3N2GE 2AXDS 2YKSA 5FXWA 3EHZA 4IDZA 5LP6E 4DR7T 3OKQA 1DU2A 5JMEA 3KV6A 3TLUA 3MK7C 4V1Av 3C84A 1V9DA 4OK0A 5FL0A 4IE4A 4D01A 2J1DG 4P0BA 2E9XD 4DR4T 2X67A 2WZHA 1UGOA 4KP3C 2IIUA 1VCTA 3PU8A 5SYOA 2CA5A 1G73A 5FY7A 4HFDA 1YD8G 4HEAA 4IE7A 1KEYA 5JVDE 3UFEA 3K1SA 2X0LB 2BJ0A 4EIWA 2ZJVA 5CJ5A 2W8FA 5GONE 4HFBA 4YSZA 3WTJA 5DABA 2LT3A 4M1PA 4PJMA 3VR9A 4UV9B 4YJ3E 3V5UA 2BYRA 3AE7A 1Y01A 4AI6A 3N9NA 4X64T 5BP0A 2UU9T 2FBWA 2KMFA 1J5ET 2V26A 5AFKA 3PUZF 4TNVA 2ZMAA 5CFBA 4HE8A 4I50E 3EDUA 4EOZB 2LOSA 3OJAA 1MMNA 4DR5T 1W0AA 2Y56A 4A98A 3CX8B 2N9DA 3X1DA 3V5SA 2UXDT 1EZ3A 3JADA 4TWFA 3KV5A 3UUMA 4YJ2E 2LOPA 2XTLA 4B3MT 4HFCA 3ZCIA 1Y64B 1M62A 5HXHA 2YDSA 4U2ZA 5HXSA 5H6RB 2Y48B 2MYSA 2NW8A 4U3CA 1KNPA 4H9PC 2CM0A 3ZJ1A 4U31A 2KT9A 2M67A 1LVKA 4IL9A 4B5DA 5LHGB 1MNEA 4UM3S 4H9NC 4EB6E 5KXJA 2WBLA 2BDEA 2WY2A 3CWZB 1E7PA 1XNRT 4MALA 1D0XA 4X5TA 4PAGA 5AQKB 3PUVF 5JDNA 2NWBA 4ZXLA 4NIQA 3ZYKA 2W63A 2XAJB 1NENA 1E2AA 4UVCB 3ZYLA 4ZJSA 4DR2T 5J5GA 3EDVA 3ZPOA 4UELA 3OYZA 2BKOA 5AQMB 3M3ZB 3QB5K 1LKXA 3FZMB 1T8BA 5J2UE 5AQOB 2UXCT 1MMAA 5CGMA 5JR9B 5L47A 3I0QA 3LDQB
chains in the Genus database with same CATH topology
4QABA 5KZUA 4QACA 2WNJA 4ILBA 2PGZA 2WZYA 2YN6A 5AFMA 5TVCA 4UXUA 4Z90A 2BG9A 3SIOA 3U8NA 4TWDA 5FJVA 5HCJA 5J0ZA 5AFNA 2Y56A 2LKHA 2BYQA 4A98A 4HFIA 4ALXA 3WTNA 3UQ7A 4XHEA 2YKSA 2XQ8A 2XQ9A 3LSVA 4UM3P 3JAFA 3RQWA 4ZK4A 3JADA 2BR7A 5HCMA 4LMJA 4TWFA 3EHZA 4LMKA 3SH1A 3WTKA 2ZJUA 3T4MA 4AFGA 2BYPA 5JMEA 3TLUA 4HFCA 4ZJTA 2XQ6A 4TWHA 3C84A 4TNWA 4ILAA 4FRRA 2WNLA 5J5IA 2LM2A 5HEHA 5LG3A 2QC1B 4ILCA 4D01A 5L4EA 4QH1A 4ZK1A 2XQ3A 2Y57A 2YMDA 4QH5A 2BG9E 2PH9A 1I9BA 2XZ5A 2X00D 2XQ5A 3UU6A 2BG9C 3TLTA 3UU8A 3UU3A 3PMZA 4ZR6A 2M6IA 1OEDB 5BW2A 4IL9A 5HEJA 3U8KA 3RIFA 4ZZCA 4B5DA 4BFQA 3RI5A 4EZ1A 3TLSA 2C9TA 5AINA 5AFLA 5KE4A 4UM1A 5CO5A 3EI0A 4UY2A 3U8LA 3UU4A 2XQAA 4UM3S 4HFEA 4Z91A 2BYSA 2XNVA 2WN9A 2YOEA 3U8JA 5SYOA 3RIAA 1UV6A 5IUXA 4ZRUA 3WIPA 2Y54A 4DBMA 5HEUA 3WTLA 5J5FA 2KSRA 3ZDGA 2YMEA 4QH4A 3SQ6A 3UUBA 4HFDA 2WNCA 4LMLA 2M6BA 2Y58A 2Y7YA 3ZDHA 1UX2A 2X00A 3UU5A 2LLYA 4IREA 2BJ0A 3P50A 1OEDA 2MAWA 4A97A 3RHWA 4HFHA 5L4HA 2XNTA 1UW6A 2ZJVA 4NPPA 2LKGA 4WV9A 4X5TA 3TLWA 5LXBA 2W8FA 4UM3A 2XQ4A 2BR8A 5AFHA 3WTIA 2XYTA 2XQ7A 4HQPA 2XYSA 4ZZBA 2W8GA 3PEOA 4F8HA 4COFA 4HFBA 3SQ9A 3WTJA 5AFMB 2VL0A 5HEGA 3C79A 4ZJSA 2BG9B 2XZ6A 3GUAA 3WTMA 5BRXA 5J5GA 3RQUA 4PIRA 3U8MA 2BYRA 3TLVA 4XK9A 2BYNA 4AFTA 4AFHA 3IGQA 5AFJA 3ZKRA 3P4WA 5BP0A 3JAEA 5J5HA 2UZ6A 1OEDE 3WTHA 3WTOA 2XNUA 4BQTA 4NZBA 1OEDC 3UQ4A 4QAAA 3EAMA 5AFKA 4TNVA 5L47A 5HEOA 4IL4A 5CFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QAB A;  5KZU A;  4QAC A;  2WNJ A;  4ILB A;  2PGZ A;  2WZY A;  2YN6 A;  5AFM A;  5TVC A;  4UXU A;  4Z90 A;  2BG9 A;  3SIO A;  3U8N A;  4TWD A;  5FJV A;  5HCJ A;  5J0Z A;  5AFN A;  2Y56 A;  2LKH A;  2BYQ A;  4A98 A;  4HFI A;  4ALX A;  3WTN A;  3UQ7 A;  4XHE A;  2YKS A;  2XQ8 A;  2XQ9 A;  3LSV A;  4UM3 P;  3JAF A;  3RQW A;  4ZK4 A;  3JAD A;  2BR7 A;  5HCM A;  4LMJ A;  4TWF A;  3EHZ A;  4LMK A;  3SH1 A;  3WTK A;  2ZJU A;  3T4M A;  4AFG A;  2BYP A;  5JME A;  3TLU A;  4HFC A;  4ZJT A;  2XQ6 A;  4TWH A;  3C84 A;  4TNW A;  4ILA A;  4FRR A;  2WNL A;  5J5I A;  2LM2 A;  5HEH A;  5LG3 A;  2QC1 B;  4ILC A;  4D01 A;  5L4E A;  4QH1 A;  4ZK1 A;  2XQ3 A;  2Y57 A;  2YMD A;  4QH5 A;  2BG9 E;  2PH9 A;  1I9B A;  2XZ5 A;  2X00 D;  2XQ5 A;  3UU6 A;  2BG9 C;  3TLT A;  3UU8 A;  3UU3 A;  3PMZ A;  4ZR6 A;  2M6I A;  1OED B;  5BW2 A;  4IL9 A;  5HEJ A;  3U8K A;  3RIF A;  4ZZC A;  4B5D A;  4BFQ A;  3RI5 A;  4EZ1 A;  3TLS A;  2C9T A;  5AIN A;  5AFL A;  5KE4 A;  4UM1 A;  5CO5 A;  3EI0 A;  4UY2 A;  3U8L A;  3UU4 A;  2XQA A;  4UM3 S;  4HFE A;  4Z91 A;  2BYS A;  2XNV A;  2WN9 A;  2YOE A;  3U8J A;  5SYO A;  3RIA A;  1UV6 A;  5IUX A;  4ZRU A;  3WIP A;  2Y54 A;  4DBM A;  5HEU A;  3WTL A;  5J5F A;  2KSR A;  3ZDG A;  2YME A;  4QH4 A;  3SQ6 A;  3UUB A;  4HFD A;  2WNC A;  4LML A;  2M6B A;  2Y58 A;  2Y7Y A;  3ZDH A;  1UX2 A;  2X00 A;  3UU5 A;  2LLY A;  4IRE A;  2BJ0 A;  3P50 A;  1OED A;  2MAW A;  4A97 A;  3RHW A;  4HFH A;  5L4H A;  2XNT A;  1UW6 A;  2ZJV A;  4NPP A;  2LKG A;  4WV9 A;  4X5T A;  3TLW A;  5LXB A;  2W8F A;  4UM3 A;  2XQ4 A;  2BR8 A;  5AFH A;  3WTI A;  2XYT A;  2XQ7 A;  4HQP A;  2XYS A;  4ZZB A;  2W8G A;  3PEO A;  4F8H A;  4COF A;  4HFB A;  3SQ9 A;  3WTJ A;  5AFM B;  2VL0 A;  5HEG A;  3C79 A;  4ZJS A;  2BG9 B;  2XZ6 A;  3GUA A;  3WTM A;  5BRX A;  5J5G A;  3RQU A;  4PIR A;  3U8M A;  2BYR A;  3TLV A;  4XK9 A;  2BYN A;  4AFT A;  4AFH A;  3IGQ A;  5AFJ A;  3ZKR A;  3P4W A;  5BP0 A;  3JAE A;  5J5H A;  2UZ6 A;  1OED E;  3WTH A;  3WTO A;  2XNU A;  4BQT A;  4NZB A;  1OED C;  3UQ4 A;  4QAA A;  3EAM A;  5AFK A;  4TNV A;  5L47 A;  5HEO A;  4IL4 A;  5CFB A; 
#chains in the Genus database with same CATH topology
 1ZP0 A;  5KZU A;  4CI3 B;  4CN4 A;  3SIO A;  1ZKE A;  5LMN T;  4JI2 T;  5EK2 A;  3CQG B;  4N78 D;  4XHE A;  4O2A E;  2XQ9 A;  2GK9 A;  3RQW A;  3Q5W A;  3ANW B;  2CBI A;  2ZJU A;  4E7Z A;  3AE4 A;  2H3R A;  1N34 T;  5JR9 A;  5LYJ E;  4U33 A;  2ZM0 A;  3GWH A;  2LHR A;  4JI7 T;  3KV9 A;  2BG9 E;  4EZH A;  1QSD A;  1XDP A;  4ASK A;  3AE2 A;  3ANW A;  3RIF A;  2K5B B;  5KE4 A;  4PNI A;  3FXD B;  4P1N A;  2ZM8 A;  3KFW X;  4YHH T;  3PE0 A;  4ZRU A;  5JR9 C;  4YT0 A;  2XAG B;  2JQ9 A;  1XDO A;  3C4X A;  3PUX F;  3S4U A;  3CQC B;  4UF0 B;  5C3J A;  2MAW A;  3I1A A;  2CRB A;  4NPP A;  3ABV A;  4QXB B;  3M65 A;  1HCI A;  3PUQ A;  3VRB A;  2DLR A;  5F3J A;  4IIJ E;  5HXC A;  3LBX B;  3T1Y T;  3C79 A;  3AEA A;  4X65 T;  2ACX A;  2VQF T;  4UF0 A;  3W15 B;  2X66 A;  4XK9 A;  3B5M A;  3U78 A;  5LHI B;  2WM9 A;  3FXE B;  2YU2 A;  4U7Y A;  3WTH A;  3O1I A;  1D1A A;  4WYV A;  3N9M A;  4IL4 A;  2XNV A;  2WDQ A;  2WU2 A;  2WNJ A;  3ONL C;  3LBX A;  4XAX B;  4X62 T;  5AQU B;  2W66 A;  4QXH B;  4HN9 A;  3OVU A;  1KF6 A;  1ZHC A;  3CPZ A;  3ZSS A;  2YK0 A;  1W09 A;  3B57 A;  2K24 A;  2CHO A;  5AQP B;  4JUY A;  2IC9 A;  5HEH A;  2WDV A;  4OYK A;  4QH1 A;  4P0A A;  4HFV A;  5JDQ A;  2UUC T;  2PH9 A;  2EHO B;  2VKD A;  2W62 A;  5JDF A;  4U74 A;  3ZJ2 A;  5LXT E;  2VK9 A;  3NRX A;  4AQG A;  5AFL A;  2V5D A;  3I0O A;  1HNZ T;  2UUB T;  1VOM A;  4WBO A;  3HKC E;  5L3D B;  3RKO A;  2LSJ A;  5DQW A;  5AQV B;  3RKG A;  1HNW T;  3NVO A;  4TUY E;  4JI6 T;  2F4V T;  2Q9Q A;  5AFH A;  1KFY A;  4O4L E;  3ZMS B;  1IBL T;  3FBL A;  4DV0 T;  1I94 T;  4L0R A;  5BRX A;  2FUP A;  2DNX A;  3AA7 B;  3ZKR A;  5J5H A;  2JPF A;  3SOL A;  4QAA A;  3AA6 B;  2V7I A;  2LEH A;  4Q25 A;  5AQH B;  2VQE T;  4O4I E;  3RX6 A;  4JEU B;  3VHL A;  3F31 A;  1WLX A;  1N33 T;  3Q5D A;  4EGW A;  1MMD A;  5HCJ A;  1S94 A;  3AB3 B;  1B7T A;  4HWF A;  3LSV A;  2BR7 A;  5HXR A;  2CWO A;  4TN7 B;  3WTK A;  2WP9 A;  4AKR B;  3MZK B;  3P8C D;  2CXD A;  5AQI B;  4CI2 B;  1JNZ A;  2YEV C;  3LK3 B;  3ZMZ B;  4TX5 A;  2LM2 A;  4ERR A;  3LK2 B;  4K0K T;  5AQQ B;  1I9B A;  3TKL B;  4AQF A;  4ZI2 D;  2CEA A;  2DCF A;  4AKI A;  3E0Z A;  3ZLI A;  2JQH A;  4JI0 T;  3U8L A;  4QHO A;  2WN9 A;  4EYY R;  1LVF A;  3DP7 A;  2V8S V;  2DWG A;  3UUB A;  1T72 A;  1NEK A;  3ZDH A;  1W9R A;  2L8K A;  4X1I E;  5ABH A;  4A97 A;  4AQF C;  2DWK A;  1HTJ F;  2K48 A;  2Z6E A;  2PBI A;  2XYT A;  5C2T A;  2W00 A;  4NXN T;  3J7Y q;  4JI4 T;  2LSK A;  3QK6 A;  4GKK T;  2IDO B;  4H9S E;  1YKE B;  4LF4 T;  3QB5 A;  3QUJ A;  3AEE A;  1MIW A;  4HWD A;  2W4X A;  5ABE A;  4QAB A;  1XWM A;  3C98 B;  3AE8 A;  3Q5E A;  5LOV E;  1WR6 A;  4UVA B;  4B3T T;  2W67 A;  1FIO A;  3UUN A;  4Z8X A;  3UT5 E;  2LJL A;  5JRC A;  4WBN E;  4G2A A;  5LG3 A;  2QC1 B;  3C4W A;  2YMD A;  3DJB A;  3RPU A;  4CXY A;  5FP3 A;  5J1G A;  2LRL A;  3ZT5 A;  3LK4 2;  1YKH B;  1J1J A;  5AQL B;  4O4J E;  2XM2 A;  4X1K E;  2ZM6 T;  2HN2 A;  1QUU A;  2KXP B;  4DBM A;  1NAF A;  4X66 T;  2WNC A;  4LML A;  2M6B A;  1E1H B;  2Y58 A;  2IML A;  2XY8 B;  4EED A;  2WAU A;  5JQG E;  1YW0 A;  4YLH A;  1NWM X;  2XJ7 A;  2RP4 A;  5LXB A;  4X1Y E;  2RPA A;  4ANJ A;  1L0V A;  2XQ7 A;  2XYS A;  3BQL A;  3R6N A;  3ETV A;  5DQV A;  4JI1 T;  3WTM A;  3U8M A;  4BAY B;  2C0S A;  3RYH E;  5AQT B;  2PG8 A;  4LFC T;  1BR0 A;  5AFN A;  4C91 A;  2I59 A;  3ZT6 A;  5HAX A;  5J0Z A;  4B6X A;  3CQX C;  3OPC A;  3SWH A;  2W2U A;  2C5K T;  3BK9 A;  2Q9Q D;  3KV4 A;  4ZJT A;  5JH7 E;  3KDS E;  2ZM2 A;  4LFB T;  4ZK1 A;  4C90 A;  2Y6X A;  1KNR A;  4WNK A;  5AQR B;  4O8S A;  4AQY T;  3AXJ B;  1OED B;  2IW5 B;  3P4Q A;  2XUE A;  3BQK A;  2WB5 A;  5AQF B;  3ZCJ A;  3UU4 A;  3L8R A;  2BYS A;  1HFA A;  1U4Q A;  2YOE A;  2D5U A;  3LFM A;  3IA3 A;  2MOZ A;  2D0T A;  4KI0 F;  5FXZ A;  5HWX A;  5F8P A;  4QH4 A;  2LRK A;  1HF8 A;  4DV7 T;  3AXJ A;  1OED A;  2BS3 A;  3RHW A;  4KBM B;  4WV9 A;  3TLW A;  4UM3 A;  2AE9 A;  4CN1 A;  1N32 T;  1WYC A;  2V7J A;  1WFD A;  4PJL A;  4HGA A;  1X9B A;  3TLV A;  4AFH A;  2ODV A;  3GN5 B;  4L9I A;  2CCQ A;  3CX7 B;  1OED C;  1D1C A;  2MBG A;  5L2L A;  3ZC0 A;  2FJD A;  4QAC A;  5ABF B;  3QC9 A;  5LBQ B;  4K0U A;  3AVR A;  4XBF B;  2PJQ A;  1HR0 T;  4GK0 E;  5FJV A;  2YDR A;  4KHP T;  4EV6 A;  4HFI A;  3GN5 A;  3R84 B;  5HCM A;  3OBV E;  3NWI A;  2FJB A;  3SRZ A;  3MA9 A;  3NZQ A;  2WWU A;  5ABF A;  4ZI3 C;  4P09 A;  2X00 D;  2H7V C;  2XQ5 A;  3TLT A;  3UFG A;  4UIG A;  3U3I A;  5L3G B;  5BR8 T;  3TLS A;  2J4G A;  5LHH B;  2VB6 A;  1BR2 A;  5IUX A;  2KWI B;  1SE7 A;  3L39 A;  4UEM A;  4FI5 A;  3RIU A;  3K3O A;  3QNU A;  4YTM A;  3AEC A;  3H3A A;  4L5G A;  1UX2 A;  4U7I A;  1HNX T;  2D2S A;  4HFH A;  2X9W A;  2X9Y A;  4CZZ B;  3FZK B;  2ZLY A;  3JC6 C;  2WCA A;  3KIN B;  1J5W A;  1H7C A;  4DBQ A;  2VL0 A;  5A1L A;  3RIU C;  3HI2 A;  4E7S A;  1LRZ A;  3ZN0 B;  3AAA B;  1XMO T;  3IGQ A;  2IHR 1;  5LG4 A;  5AFJ A;  4DVD A;  2UXX B;  1FEW A;  3G06 A;  3HKE E;  3LG7 A;  4GYS A;  4IT4 A;  5EK3 A;  3FHN A;  2L3L A;  1R8I A;  5IWA T;  4UXU A;  1HX1 B;  1D1B A;  3UUL A;  1WYB A;  2HH7 A;  1SUM B;  4LMJ A;  5L3E B;  1VCS A;  3CKD A;  2X51 A;  4G63 A;  2V6Y B;  3VR8 A;  2VKH A;  4ILC A;  1T98 A;  5HWY A;  1MND A;  3B13 A;  4QX7 B;  2KLQ A;  4QH5 A;  2JRK A;  4DMV A;  3PMZ A;  2LE8 A;  3FB2 A;  2CWY A;  2WU5 A;  4Z91 A;  2V6Y A;  4CN6 A;  3RYI E;  3P7I A;  2BZB A;  5J5F A;  3WTL A;  3O4X E;  2J62 A;  3IBP A;  2BS4 A;  4UVB B;  2YME A;  2X9X A;  3SQ6 A;  1X79 A;  4O2B E;  1FJG T;  2Y7Y A;  4AIS A;  5HYA A;  2BBH A;  3K3N A;  3OTO T;  3RLF F;  3IEE A;  3PUA A;  4DUZ T;  3KBU A;  1IBM T;  3PJA A;  2WSS V;  3AA0 B;  5AQG B;  2UXN B;  5JTG A;  2XZ6 A;  3IF8 B;  3GUA A;  5LGN B;  3ONJ A;  4IST A;  2EHO A;  2VVN A;  4BA9 A;  4IDO A;  3ZST A;  4CQI A;  3WTO A;  2XNU A;  3UQ4 A;  3EAM A;  4J2C A;  2D0U A;  4ZHQ E;  1IJ6 A;  3L3P A;  3CIR A;  2YN6 A;  5TVC A;  4ZI7 E;  4ALX A;  2P9B A;  4DR1 T;  5C8Y E;  2EHO C;  4AKL A;  2HPJ A;  4H63 H;  2XSB A;  2XQ6 A;  2UXB T;  2UUA T;  1HG2 A;  4FRR A;  4H9Q C;  3AE1 A;  3MKD A;  4HKA A;  2PFV A;  3NBX X;  2CXF A;  2E5L T;  3RH3 A;  5BW2 A;  5HEJ A;  2C9T A;  4UV8 B;  1SA0 E;  4UY2 A;  3C64 A;  4U72 A;  4IE0 A;  1UV6 A;  2XAQ B;  5HEU A;  1MMG A;  4LF8 T;  2RA1 A;  3AE3 A;  1Z0P A;  3PUG A;  3PU3 A;  1MIV A;  4UR9 A;  4CXW A;  4EAH A;  3AEB A;  5KX5 E;  4IE5 A;  2A2F X;  4U2Y A;  3RC8 A;  1UUS A;  3A8Y C;  2BR8 A;  4JLE A;  2OA5 A;  4ZZB A;  1UX5 A;  4QXC B;  3AAI A;  3O1H A;  1US7 B;  5FXV A;  4AKG A;  4DID B;  3J9X 1;  4IDP A;  4AKH A;  3AED A;  3JC6 D;  3RRC A;  3BQI A;  2WDR A;  1I6Z A;  2KZ7 B;  4ADZ A;  2X68 A;  3PUS A;  3H3M A;  4JI8 T;  2IC6 A;  5FVL A;  2XQY A;  2K9A A;  4ILB A;  5L3B B;  4I4T E;  2FJA A;  4LF5 T;  3OYX A;  1GQE A;  1ZEE A;  1KNZ A;  3I9Y A;  2QGS A;  3O9X A;  5AQN B;  2XQ8 A;  4NUU A;  4AFG A;  1O3X A;  2C5I T;  4TNW A;  2NTY A;  2I0M A;  5J5I A;  5ABG A;  1Z8U A;  2H88 A;  4PW8 A;  5LMU T;  3A5X A;  2JMK A;  4NUV A;  3C51 A;  2V7K A;  3N9L A;  3UU3 A;  4DV1 T;  4MHC A;  4ZZC A;  4KUM B;  3N5L A;  1QLB A;  3UUX B;  5AIN A;  2QYW A;  2LSI A;  4UM1 A;  2WMN A;  2BKN A;  2VKJ A;  4DV2 T;  4AXP A;  3K3Q C;  4ZS3 A;  3T8O A;  4GKJ T;  5LGU B;  3AE9 A;  3P50 A;  4UXN B;  5BMV E;  1YXR A;  3DTO A;  3ZEF B;  3IHR A;  3Q2M A;  4LF9 T;  2XM1 A;  2LSY A;  3P4P A;  1AJ3 A;  3SQ9 A;  5KDM C;  2BG9 B;  5IHY A;  1S35 A;  2PTF A;  2BYN A;  3D0T A;  4AFT A;  3JAE A;  5AFU L;  4PK6 A;  4DV6 T;  3AE5 A;  4PFP A;  3RGL A;  3AVS A;  2DI4 A;  4QX8 B;  1T7S A;  4GYR A;  3PJA J;  2BG9 A;  4EEB A;  5CA1 E;  4I43 B;  4ISS A;  3AE6 A;  2NR4 A;  4UM3 P;  3CK6 A;  4LMK A;  4DMW A;  3SH1 A;  2LHN A;  3T4M A;  2BYP A;  2LM9 A;  4JI5 T;  3JCF A;  3CVR A;  3AA1 B;  2R6G F;  4TWH A;  4ILU A;  2E8I A;  1UCU A;  3SS1 A;  4ILA A;  3AEF A;  4YY3 T;  2CMR A;  5ETW A;  3ZMT B;  2CXL A;  5FMN A;  4WZX A;  2LSG A;  2EHO D;  3UU6 A;  2BG9 C;  2WWV A;  5TAO A;  3L09 A;  2WQY A;  3EI0 A;  2YDQ A;  3ONX A;  3AAE B;  3ZMV B;  5FY0 A;  2E5V A;  4AIU A;  2KSR A;  1KK7 A;  5FL1 A;  3E08 A;  2XNT A;  1CHU A;  2LKG A;  5JDL A;  2CBJ A;  2W8G A;  3HR0 A;  5LGT B;  4DUY T;  4PIR A;  2DL1 A;  5ADX L;  5L3F B;  4YSY A;  2KWH A;  3H37 A;  3P4W A;  4H9R C;  2UZ6 A;  1SHZ C;  4EXT A;  2VWA A;  2VKO A;  2B1E A;  3VKG A;  2BVM A;  1G8X A;  1HG5 A;  3FBZ A;  3SFE A;  4O4H E;  1YQ3 A;  3P4R A;  2FJE A;  3HA4 A;  4ZK4 A;  1BR4 A;  3MJX A;  2B76 A;  2VL8 A;  4JV5 T;  4DV5 T;  5LCY A;  3ESL A;  3HKB E;  4YXD A;  1M7K A;  2A9U A;  2YU1 A;  3N9P A;  3NRY A;  4ZS2 A;  2MTQ A;  1W0B A;  3WI3 A;  2WNL A;  5L4E A;  2K3W A;  2JJ9 A;  2XQ3 A;  2WMO A;  3ZYM A;  1WRD A;  4B3S T;  4HWH A;  2D9D A;  2Y8D A;  4H63 V;  3ZC1 A;  3UU8 A;  4PJN A;  4DND A;  2JMH A;  5JRE A;  1ZV4 X;  3U8K A;  2BBJ A;  4EZ1 A;  5FNV E;  4HFE A;  1VRB A;  3U8J A;  2CLY B;  3K8P C;  4CXX A;  3ETU A;  3N9Q A;  2Y54 A;  5JDM A;  2XSA A;  3ZDG A;  1N36 T;  2XAH B;  5LJM A;  3UU5 A;  2V6X A;  1BR1 A;  3I9W A;  5FY1 A;  1D0Z A;  2XQ4 A;  5LNK A;  4I55 E;  3PEO A;  3WAK A;  4F8H A;  4COF A;  2N2N A;  2V1D B;  3GA8 A;  4YTN A;  3A7M A;  3ZT7 A;  4YFS A;  5H6Q B;  5AQS B;  2KIN B;  4JBW F;  2CPT A;  4IGU A;  4OYJ A;  4ZI2 C;  3HKD E;  4BQT A;  3F2E A;  2CHN A;  3F57 A;  2PGZ A;  2NW9 A;  2HHH T;  2CLY C;  1YQ4 A;  4Z90 A;  3N2O A;  2L9Q A;  2J47 A;  4JEH B;  3WTN A;  4F6R C;  4PK5 A;  1OWA A;  3FZH B;  2E2A A;  2ES0 A;  4NXM T;  4XZC A;  2V7L A;  5LJN A;  4OX9 T;  3PDY A;  2Y57 A;  5FKY A;  1UUR A;  1FMW A;  5IYZ E;  4MBQ A;  5JDG A;  4ZR6 A;  2M6I A;  1IJ5 A;  2NW7 A;  4BFQ A;  4MFR A;  2G0U A;  4BJM A;  2IUB A;  2VVS A;  2XQA A;  2JQK A;  4PFO A;  4A56 A;  1UK5 A;  5EZY E;  3WIP A;  1XZY A;  4DV4 T;  4CI1 B;  4ZEY A;  2E9X B;  3CML A;  4IRE A;  3VRA A;  1XNQ T;  2VUR A;  2XAF B;  5L4H A;  4YTP A;  2NP9 A;  1CUN A;  3SFD A;  4KHZ F;  3WTI A;  3RC3 A;  4HQP A;  2WZI A;  1ZOY A;  4LF7 T;  4LF6 T;  4IE6 A;  2OLT A;  1UX4 A;  2E9X A;  2QA7 A;  4X20 E;  3ZMU B;  2BS2 A;  4DR3 T;  3Q5X A;  1OED E;  4NZB A;  5E0O A;  3NKZ A;  3EAB A;  5LB7 B;  3GMI A;  5LBM A;  5CB4 E;  3PV0 F;  4IDN A;  2A72 A;  3VU7 H;  3UQ7 A;  2XZE A;  3JAF A;  5J2T E;  2E9X C;  5DJQ C;  5F5W A;  5CA0 E;  3E22 E;  5KMG P;  2Q9Q B;  3EVY A;  1D0Y A;  5FXX A;  3RYF E;  4EYU A;  1HS7 A;  4BJN A;  2SPC A;  2C5J A;  3CX6 B;  2XZ5 A;  1MIY A;  2VAS A;  3RI5 A;  1HX8 A;  2KND A;  3LJC A;  4PJJ A;  3HL6 A;  4YSX A;  4IHJ E;  2V5C A;  4HWC A;  4ZOL E;  4JI3 T;  3NZP A;  2N1G A;  4GIW A;  2LLY A;  2HPL A;  2BKP A;  4GOU A;  4KMC A;  2H7O A;  1UW6 A;  3N2K E;  5M4Y A;  4LFA T;  2MPK A;  2XAS B;  1IAP A;  2Q9Q C;  2WS3 A;  2NTX A;  4ZI3 D;  5AFM B;  3C50 A;  5HEG A;  3UTK A;  3RQU A;  2XHE B;  2XPK A;  2I6H A;  1OXZ A;  2OV9 A;  3O1J A;  3KVA A;  5AQJ B;  2W0G A;  4HWI B;  5HEO A;  5LA6 E;  3RYC E;  3PTR B;  2YIN A;  5AFM A;  3T1H T;  3U8N A;  3P4S A;  3MXZ A;  2JQQ A;  2LKH A;  2W61 A;  1IZN B;  3N9O A;  2BYQ A;  4DO0 A;  1XMQ T;  2QRX A;  4OFZ A;  3PUR A;  4B3R T;  3C4Z A;  1U5P A;  4YHJ A;  2HN1 A;  3EUH A;  3FZL B;  3RRW A;  4KX6 A;  4TV9 E;  1WR0 A;  4I0U A;  3KVB A;  2X9H A;  3VKH A;  2ODU A;  3Q9D A;  3ZN1 B;  4OHF A;  5CO5 A;  5JDH A;  4QWN B;  4WW0 A;  3KBT A;  2IAK A;  1WCR A;  5L3C B;  2NOX A;  3AEG A;  3RIA A;  3FZF B;  4DBR A;  3PUW F;  4H9O C;  1IBK T;  2X00 A;  5HXE A;  5EK4 A;  4MLK A;  5JRC B;  4A5X A;  2X0Y A;  2QVA A;  2BVL A;  2DHR A;  2ACZ A;  5FVK A;  2JIW A;  3PUY F;  4TV8 E;  3QOF A;  1JNR A;  1FMV A;  4DV3 T;  5FYM A;  4IDQ A;  4EZ4 A;  2V7M A;  2H89 A;  3MAC A;  4PK4 A;  4GK5 E;  4DR6 T;  4FJO A;  3WAJ A;  4HTE A;  2X0H A;  2A3D A;  2CE7 A;  2WZY A;  4JYA T;  4QKN A;  4TWD A;  4TZ4 C;  3RF1 A;  3N2G E;  2AXD S;  2YKS A;  5FXW A;  3EHZ A;  4IDZ A;  5LP6 E;  4DR7 T;  3OKQ A;  1DU2 A;  5JME A;  3KV6 A;  3TLU A;  3MK7 C;  4V1A v;  3C84 A;  1V9D A;  4OK0 A;  5FL0 A;  4IE4 A;  4D01 A;  2J1D G;  4P0B A;  2E9X D;  4DR4 T;  2X67 A;  2WZH A;  1UGO A;  4KP3 C;  2IIU A;  1VCT A;  3PU8 A;  5SYO A;  2CA5 A;  1G73 A;  5FY7 A;  4HFD A;  1YD8 G;  4HEA A;  4IE7 A;  1KEY A;  5JVD E;  3UFE A;  3K1S A;  2X0L B;  2BJ0 A;  4EIW A;  2ZJV A;  5CJ5 A;  2W8F A;  5GON E;  4HFB A;  4YSZ A;  3WTJ A;  5DAB A;  2LT3 A;  4M1P A;  4PJM A;  3VR9 A;  4UV9 B;  4YJ3 E;  3V5U A;  2BYR A;  3AE7 A;  1Y01 A;  4AI6 A;  3N9N A;  4X64 T;  5BP0 A;  2UU9 T;  2FBW A;  2KMF A;  1J5E T;  2V26 A;  5AFK A;  3PUZ F;  4TNV A;  2ZMA A;  5CFB A;  4HE8 A;  4I50 E;  3EDU A;  4EOZ B;  2LOS A;  3OJA A;  1MMN A;  4DR5 T;  1W0A A;  2Y56 A;  4A98 A;  3CX8 B;  2N9D A;  3X1D A;  3V5S A;  2UXD T;  1EZ3 A;  3JAD A;  4TWF A;  3KV5 A;  3UUM A;  4YJ2 E;  2LOP A;  2XTL A;  4B3M T;  4HFC A;  3ZCI A;  1Y64 B;  1M62 A;  5HXH A;  2YDS A;  4U2Z A;  5HXS A;  5H6R B;  2Y48 B;  2MYS A;  2NW8 A;  4U3C A;  1KNP A;  4H9P C;  2CM0 A;  3ZJ1 A;  4U31 A;  2KT9 A;  2M67 A;  1LVK A;  4IL9 A;  4B5D A;  5LHG B;  1MNE A;  4UM3 S;  4H9N C;  4EB6 E;  5KXJ A;  2WBL A;  2BDE A;  2WY2 A;  3CWZ B;  1E7P A;  1XNR T;  4MAL A;  1D0X A;  4X5T A;  4PAG A;  5AQK B;  3PUV F;  5JDN A;  2NWB A;  4ZXL A;  4NIQ A;  3ZYK A;  2W63 A;  2XAJ B;  1NEN A;  1E2A A;  4UVC B;  3ZYL A;  4ZJS A;  4DR2 T;  5J5G A;  3EDV A;  3ZPO A;  4UEL A;  3OYZ A;  2BKO A;  5AQM B;  3M3Z B;  3QB5 K;  1LKX A;  3FZM B;  1T8B A;  5J2U E;  5AQO B;  2UXC T;  1MMA A;  5CGM A;  5JR9 B;  5L47 A;  3I0Q A;  3LDQ B; 
#chains in the Genus database with same CATH homology
 4QAB A;  5KZU A;  4QAC A;  2WNJ A;  4ILB A;  2PGZ A;  2WZY A;  2YN6 A;  5AFM A;  5TVC A;  4UXU A;  4Z90 A;  2BG9 A;  3SIO A;  3U8N A;  4TWD A;  5FJV A;  5HCJ A;  5J0Z A;  5AFN A;  2Y56 A;  2LKH A;  2BYQ A;  4A98 A;  4HFI A;  4ALX A;  3WTN A;  3UQ7 A;  4XHE A;  2YKS A;  2XQ8 A;  2XQ9 A;  3LSV A;  4UM3 P;  3JAF A;  3RQW A;  4ZK4 A;  3JAD A;  2BR7 A;  5HCM A;  4LMJ A;  4TWF A;  3EHZ A;  4LMK A;  3SH1 A;  3WTK A;  2ZJU A;  3T4M A;  4AFG A;  2BYP A;  5JME A;  3TLU A;  4HFC A;  4ZJT A;  2XQ6 A;  4TWH A;  3C84 A;  4TNW A;  4ILA A;  4FRR A;  2WNL A;  5J5I A;  2LM2 A;  5HEH A;  5LG3 A;  2QC1 B;  4ILC A;  4D01 A;  5L4E A;  4QH1 A;  4ZK1 A;  2XQ3 A;  2Y57 A;  2YMD A;  4QH5 A;  2BG9 E;  2PH9 A;  1I9B A;  2XZ5 A;  2X00 D;  2XQ5 A;  3UU6 A;  2BG9 C;  3TLT A;  3UU8 A;  3UU3 A;  3PMZ A;  4ZR6 A;  2M6I A;  1OED B;  5BW2 A;  4IL9 A;  5HEJ A;  3U8K A;  3RIF A;  4ZZC A;  4B5D A;  4BFQ A;  3RI5 A;  4EZ1 A;  3TLS A;  2C9T A;  5AIN A;  5AFL A;  5KE4 A;  4UM1 A;  5CO5 A;  3EI0 A;  4UY2 A;  3U8L A;  3UU4 A;  2XQA A;  4UM3 S;  4HFE A;  4Z91 A;  2BYS A;  2XNV A;  2WN9 A;  2YOE A;  3U8J A;  5SYO A;  3RIA A;  1UV6 A;  5IUX A;  4ZRU A;  3WIP A;  2Y54 A;  4DBM A;  5HEU A;  3WTL A;  5J5F A;  2KSR A;  3ZDG A;  2YME A;  4QH4 A;  3SQ6 A;  3UUB A;  4HFD A;  2WNC A;  4LML A;  2M6B A;  2Y58 A;  2Y7Y A;  3ZDH A;  1UX2 A;  2X00 A;  3UU5 A;  2LLY A;  4IRE A;  2BJ0 A;  3P50 A;  1OED A;  2MAW A;  4A97 A;  3RHW A;  4HFH A;  5L4H A;  2XNT A;  1UW6 A;  2ZJV A;  4NPP A;  2LKG A;  4WV9 A;  4X5T A;  3TLW A;  5LXB A;  2W8F A;  4UM3 A;  2XQ4 A;  2BR8 A;  5AFH A;  3WTI A;  2XYT A;  2XQ7 A;  4HQP A;  2XYS A;  4ZZB A;  2W8G A;  3PEO A;  4F8H A;  4COF A;  4HFB A;  3SQ9 A;  3WTJ A;  5AFM B;  2VL0 A;  5HEG A;  3C79 A;  4ZJS A;  2BG9 B;  2XZ6 A;  3GUA A;  3WTM A;  5BRX A;  5J5G A;  3RQU A;  4PIR A;  3U8M A;  2BYR A;  3TLV A;  4XK9 A;  2BYN A;  4AFT A;  4AFH A;  3IGQ A;  5AFJ A;  3ZKR A;  3P4W A;  5BP0 A;  3JAE A;  5J5H A;  2UZ6 A;  1OED E;  3WTH A;  3WTO A;  2XNU A;  4BQT A;  4NZB A;  1OED C;  3UQ4 A;  4QAA A;  3EAM A;  5AFK A;  4TNV A;  5L47 A;  5HEO A;  4IL4 A;  5CFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...