5HCMA

The glic pentameric ligand-gated ion channel 2-21' cross-linked mutant complexed to bromoform
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sites of Anesthetic Inhibitory Action on a Cationic Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hcmA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hcmA01
3PMZA 3U8LA 3RQUA 2XYTA 5HEGA 3T4MA 4HFHA 2LKHA 3JAEA 3U8JA 4IL9A 2WZYA 2MAWA 4PIRA 4D01A 3RQWA 4BQTA 4XK9A 2XQ5A 4UY2A 2WNLA 5AFMB 5CFBA 5BP0A 4LMKA 3UU6A 5J5HA 3UU8A 2BYNA 2Y56A 4UM3P 3U8KA 3UU5A 2X00D 4TNVA 2M6IA 5L47A 3IGQA 4QH4A 4ZZCA 3TLWA 2WN9A 2BG9A 3PEOA 5FJVA 5TVCA 5KE4A 3UQ4A 2LKGA 4HFBA 4HQPA 4ILBA 4FRRA 4ILCA 2XNVA 4UM1A 3SIOA 5SYOA 5J5GA 5J5FA 3TLSA 4HFCA 4IL4A 2ZJVA 3SH1A 5LXBA 2X00A 2VL0A 2BJ0A 4ZR6A 5AFLA 2XZ5A 3TLUA 1UV6A 4BFQA 4Z91A 2XQ4A 4ZZBA 2LLYA 4X5TA 5AFJA 4AFTA 3JAFA 2KSRA 4ILAA 5LG3A 2BYRA 5HEJA 2ZJUA 2WNJA 3LSVA 5J0ZA 1OEDA 2YOEA 3UUBA 2BYPA 4ZJSA 1I9BA 5AINA 2XQ7A 3RIFA 4HFEA 2XYSA 4ZRUA 4NPPA 2LM2A 4A97A 4ALXA 3TLTA 5JMEA 4UM3A 4QH1A 2BG9E 4COFA 3UQ7A 3C79A 5KZUA 3EHZA 5AFHA 1OEDB 3RI5A 2BG9B 3UU3A 2XQ9A 4HFIA 4UM3S 5AFKA 3P4WA 5BW2A 2PGZA 3EAMA 2XNUA 3WTJA 4AFHA 3U8NA 4QH5A 5CO5A 2UZ6A 3WIPA 4NZBA 3WTOA 3SQ6A 4Z90A 2XQAA 5AFNA 2XQ3A 3EI0A 5HCMA 3RHWA 3ZKRA 2W8FA 4XHEA 4ZK4A 3WTKA 3WTIA 4B5DA 5L4EA 5HEHA 2W8GA 5BRXA 4IREA 3P50A 3WTNA 4DBMA 4TWDA 4F8HA 2BR7A 2C9TA 2QC1B 3WTHA 4QACA 3ZDHA 3ZDGA 3GUAA 4ZK1A 3WTLA 2Y57A 2BR8A 3JADA 3C84A 2BYQA 2BG9C 5IUXA 2BYSA 2Y54A 5J5IA 2XQ6A 2M6BA 4TWFA 3TLVA 1OEDE 4UXUA 1OEDC 5HCJA 2YMEA 2Y58A 4WV9A 2Y7YA 4EZ1A 3RIAA 2XNTA 3UU4A 5HEOA 4QABA 4A98A 5AFMA 2YKSA 2WNCA 4AFGA 2XZ6A 2XQ8A 4LMJA 4LMLA 2PH9A 4HFDA 4ZJTA 4QAAA 3SQ9A 1UW6A 4TNWA 2YMDA 5HEUA 1UX2A 4TWHA 3U8MA 2YN6A 5L4HA 3WTMA
chains in the Genus database with same CATH superfamily
3RYFE 3OPCA 2VKHA 5F5WA 3PJAJ 1MMAA 2NW8A 3UTKA 4BJNA 3AE9A 2IDOB 2X0HA 3GN5B 2QA7A 1ZOYA 2V6XA 3AB3B 3GWHA 1YKEB 5FNVE 1IAPA 3P4QA 1HNWT 3A5XA 4UELA 4Z91A 2EHOC 1KNRA 3AEFA 4NUUA 2JRKA 1R8IA 4EIWA 2V7MA 4DV4T 1LKXA 3TLTA 1SUMB 5KZUA 2D2SA 5EK4A 4JEUB 2CLYC 5C2TA 3CQXC 2K48A 4O4IE 1IJ5A 3IBPA 3F2EA 5CO5A 4ANJA 2CA5A 4XHEA 3RHWA 4IDPA 2YDRA 3PUGA 3MXZA 3KV9A 3ZT5A 1MIYA 4KUMB 4JV5T 2HH7A 5CGMA 2BR7A 3SWHA 1CHUA 2JIWA 3RPUA 3NKZA 5AQRB 3NRXA 4UXNB 4QKNA 1D0YA 2DWKA 4A98A 1QSDA 2J62A 2X9YA 5AQUB 1GQEA 1YQ3A 4N78D 1XDOA 5A1LA 3EABA 4IE0A 4QHOA 3SFEA 4PJNA 5HEGA 2XYTA 4X62T 4DMVA 3U8JA 3AE6A 4ISTA 3LG7A 4EAHA 4OHFA 3RQWA 2V5DA 2XQ5A 3AEBA 1FJGT 4U31A 1BR0A 4JI2T 4YJ2E 4JI6T 3PDYA 2YINA 2JQHA 3UFEA 2XNVA 4LF8T 5LXBA 1B7TA 2LSIA 4U7IA 2X68A 2XQ4A 4CN4A 5LGNB 2KWHA 4LF7T 3L3PA 2BYPA 5IHYA 4C90A 3K1SA 2L3LA 4ZI3C 3ZYMA 2VQFT 3JC6D 1XDPA 3Q5EA 5LYJE 1I6ZA 3GN5A 4TUYE 2ODUA 4UF0B 2XQ9A 2IAKA 5IWAT 2ES0A 1UK5A 2BS3A 4UVAB 3WTIA 5HWXA 3GMIA 4HEAA 2UUAT 1XWMA 4NUVA 1X79A 5FXWA 3C84A 3HKDE 2UU9T 5AQPB 4IGUA 2YMEA 2OLTA 4X65T 5LHGB 5EK3A 2V7LA 4WZXA 4DR3T 5AQTB 2ZM6T 4HWIB 1UW6A 2LEHA 4BA9A 1N33T 3LBXA 2BZBA 1VOMA 3QNUA 4UVBB 3PMZA 3RQUA 3ESLA 4U7YA 2WNLA 1QUUA 5CFBA 2XAJB 2CXDA 1U4QA 2KNDA 3WAJA 4G2AA 5L47A 1E7PA 5LXTE 3N9PA 3FB2A 2OV9A 3PUVF 2ODVA 3ZMTB 2LM9A 2UUBT 1OXZA 5AQFB 5CJ5A 2NTXA 1HFAA 3JAFA 4TV9E 2FJBA 4B6XA 5E0OA 5LG3A 1SE7A 2W2UA 4U33A 3ZN0B 3ZMVB 1HR0T 4HFEA 3RKGA 5FL0A 5LMNT 4L0RA 2VB6A 4B3TT 3N2OA 1WR0A 4DBQA 1OEDB 4I0UA 4UEMA 2LT3A 3WTJA 3WIPA 2X51A 4O4LE 4YLHA 3VKHA 3RYHE 3CQGB 3P50A 4DBMA 2XAFB 4QACA 2WMNA 5BMVE 1G8XA 2Z6EA 5GONE 4L9IA 3N9OA 2E9XD 4AXPA 2H3RA 2H7OA 4QAAA 2N1GA 2DWGA 5HEUA 3AE5A 1JNZA 5IYZE 3UUMA 2YEVC 3ZT7A 2BKPA 3FZLB 1YKHB 4DIDB 4P0AA 4FI5A 2IHR1 2Y56A 2RP4A 4O4JE 2M6IA 3PU8A 3B13A 4JI3T 5KE4A 5LA6E 1WCRA 2NTYA 3AA6B 2AXDS 1HG5A 2X00A 1MIVA 3RRWA 5AFLA 4X66T 1CUNA 2Q9QD 1YD8G 4U3CA 3L39A 5DABA 4A5XA 3UUBA 4AKGA 3IA3A 1T98A 3M65A 2X0LB 3UU3A 3AECA 1XMOT 3EAMA 5FXZA 2L8KA 5JDGA 4A56A 1US7B 3F31A 2K5BB 2WZIA 4ISSA 3KV4A 3O1JA 2LJLA 5HEHA 4ZI2D 2IC6A 2XQYA 2C9TA 2QC1B 3WTHA 4ZK1A 3GUAA 5JRCB 2ZMAA 3CMLA 3AEGA 2MPKA 4ILUA 5AQHB 4QX7B 3RC8A 1VRBA 4JEHB 5LB7B 5C3JA 2LRLA 4JI0T 5FYMA 5HXEA 5AQMB 3H3AA 3A7MA 2MAWA 3QC9A 4YY3T 4DV0T 1FMVA 4LMKA 4YXDA 1H7CA 4NXMT 3UU5A 4O4HE 4LF5T 3BK9A 4QH4A 2Y6XA 2RA1A 1I94T 2UXBT 4ZI2C 2ACZA 4DR2T 2ZJVA 3KVAA 2IIUA 3KVBA 1MMGA 3ANWB 4ZEYA 2G0UA 4TN7B 4DV2T 5AFJA 1O3XA 3RRCA 4LFCT 2E8IA 2ZJUA 2XSAA 4PK4A 4JYAT 2YOEA 5AQIB 3CX7B 1I9BA 3ZSSA 1AJ3A 3RH3A 4QH1A 2QRXA 2D0TA 3ZMZB 2P9BA 2XNUA 2EHOA 1ZV4X 5CA0E 3SQ6A 3ZKRA 4ZK4A 3RX6A 3VR8A 3DJBA 2C5JA 4IREA 4HWFA 4Z8XA 2E5LT 3T1HT 2VKOA 1X9BA 2XQ6A 2KLQA 4X1YE 4CXYA 4AKRB 3AAIA 2XASB 3UU4A 3RIUC 2WBLA 2LSGA 3IHRA 3PURA 2NP9A 5DQWA 2WZYA 4U2ZA 2NR4A 4CI2B 3UULA 5L3CB 4JBWF 4IT4A 5BP0A 5HWYA 3I9YA 3ZPOA 3C98B 5FXXA 1T8BA 4HN9A 5LMUT 5KDMC 4C91A 2WN9A 4E7SA 4GK0E 3RYIE 3ZYLA 2ZM2A 4IDQA 4EOZB 3OBVE 2V7IA 3ZLIA 2XZ5A 3MZKB 1DU2A 5J2TE 4UR9A 2BYRA 5J0ZA 5LJNA 2W62A 1BR2A 3ZMUB 5AINA 4YSYA 3ZSTA 2XUEA 3HA4A 2XTLA 3RF1A 4UM3A 4GKJT 3EHZA 4UM3S 3I9WA 5HXCA 2JQQA 1XZYA 3U8NA 2A9UA 4Z90A 2R6GF 2W8FA 1D0ZA 2KWIB 1D1BA 2W4XA 5HXHA 5FP3A 4U2YA 4NIQA 2CBJA 2EHOB 2BR8A 2XAHB 2ACXA 4CN6A 3TLVA 1OEDE 3BQLA 1WYCA 2XJ7A 2IC9A 1FIOA 3LK3B 4DNDA 4UV8B 4PFOA 4FJOA 2LOSA 5FVKA 3C4ZA 3QOFA 3ZYKA 5L4HA 5JRCA 3H37A 2YDQA 1N36T 2LHRA 4XK9A 5LP6E 1J5ET 3ZC0A 1W09A 5HAXA 3AE8A 2MTQA 4UV9B 3UT5E 2CWOA 5C8YE 3U8KA 5LBMA 3HKBE 3FBLA 1LRZA 5LNKA 4UM1A 5SYOA 2Q9QC 1T72A 3TLSA 2JQKA 4O8SA 1Y64B 4ZR6A 3AAAB 3TLUA 2E2AA 2LOPA 1HTJF 4ZZBA 2E9XC 4PK6A 4DV3T 1IBKT 4UF0A 3J7Yq 2WZHA 2ZLYA 3Q9DA 2WS3A 4NPPA 5JMEA 2BG9E 1HG2A 1IJ6A 2HHHT 5JH7E 2LSJA 4HFIA 3F57A 1HX8A 4CI3B 5ABFA 4IDOA 4EEDA 3CQCB 4XAXB 3QUJA 3W15B 4QWNB 3A8YC 3O9XA 4HFVA 2CEAA 3NZQA 4BAYB 4GK5E 5J5IA 3AE7A 2Y8DA 5FVLA 4EZ1A 3ZT6A 3Q5WA 3P4RA 5L2LA 1ZKEA 5J1GA 4HFDA 3AVSA 5LCYA 4AKIA 3WTMA 3MKDA 1UCUA 4HWCA 2J47A 5JDFA 5JDQA 2WWVA 3PE0A 4BQTA 1NWMX 2CXLA 1XNRT 4K0KT 3ZJ2A 3T8OA 4IE4A 3ZJ1A 4OK0A 4DO0A 1KK7A 2BYNA 3I1AA 4ZS3A 4ZZCA 4MFRA 1JNRA 3UQ4A 1VCSA 4HFBA 3M3ZB 2WAUA 5CA1E 5KXJA 3LDQB 4DUYT 4IDNA 1WR6A 4EXTA 5JDMA 2FJEA 2MYSA 2DL1A 4ILAA 1SA0E 4YHJA 2XQ7A 2N2NA 2VVNA 4ALXA 4H9RC 2XM2A 1MIWA 4ADZA 5JQGE 3VRAA 5BW2A 4PJLA 4IIJE 3UUXB 3KFWX 2E5VA 3EI0A 2NOXA 4JUYA 4MLKA 3K8PC 4UIGA 4PAGA 2W00A 3K3NA 1T7SA 2WMOA 3JADA 1MNDA 3ONLC 1KNZA 1KNPA 1LVFA 2CHNA 4JLEA 2K3WA 4ZJTA 3FZKB 4TWHA 4MBQA 2I6HA 3U8LA 3CKDA 4HFHA 2NW9A 4PIRA 2ZM0A 4F6RC 2JJ9A 4AQYT 5AQOB 3SOLA 2UXCT 4I50E 1UGOA 2X9HA 2Q9QB 2VURA 3FZMB 3VRBA 4HGAA 5AQSB 5AQQB 3C51A 3PEOA 2LSKA 2VK9A 2IW5B 3OTOT 2BBJA 3KBTA 2RPAA 3C4WA 3K3OA 2VL0A 4EEBA 3PUQA 5JR9C 4ZI7E 3AE1A 4JI5T 2CLYB 2XAGB 3RKOA 4DR1T 3PUYF 3RIFA 3LK42 3R6NA 3MACA 1MNEA 2QGSA 2JMKA 4KI0F 3PUXF 4EZHA 2BS4A 4AFHA 1MMDA 4EYUA 3E22E 2XM1A 3JC6C 5LHIB 3WTOA 2D5UA 2WDRA 5BRXA 3HKCE 3N5LA 3FHNA 3RIUA 4B3ST 3PV0F 1S35A 4PW8A 2BG9C 4DBRA 3P4PA 4H63H 4GOUA 4YTPA 3PUWF 4UXUA 2KT9A 3HKEE 2WNCA 2XQ8A 4LMLA 2PH9A 5ABHA 3CWZB 3SQ9A 3MJXA 4U74A 4XBFB 2YMDA 3KINB 3LK2B 4IDZA 4TX5A 2DHRA 2XY8B 3ANWA 4IL9A 4EYYR 4YTNA 3C50A 2HPJA 4WBOA 1HS7A 3K3QC 4HKAA 3AAEB 3I0QA 3U3IA 2K9AA 2NW7A 5JVDE 1UX4A 4LFAT 3S4UA 4ILCA 2HPLA 5EZYE 4HFCA 2V1DB 3ETUA 3AXJA 1Z0PA 2LLYA 1W9RA 2J4GA 2W67A 4YSXA 2VKDA 5KX5E 2WNJA 4J2CA 1U5PA 5H6QB 4CN1A 5BR8T 4QXHB 5JDNA 3RI5A 4HTEA 1WLXA 4O2BE 1ZP0A 2YU2A 2QYWA 5J2UE 5HCMA 2LSYA 2PG8A 1M62A 2CPTA 3RC3A 4ZOLE 3ZC1A 2WP9A 3WTNA 5TAOA 3ETVA 3ZDGA 3CX6B 3G06A 3FZHB 2LE8A 3PJAA 1EZ3A 4CXXA 4V1Av 3P4SA 1NEKA 2M67A 3CK6A 1WFDA 5AQNB 3E0ZA 2B1EA 3LJCA 3AA0B 3OJAA 4AFGA 4QX8B 2L9QA 2X66A 4K0UA 3EUHA 4XZCA 2H88A 4GYSA 3CVRA 3T4MA 2WU2A 1D1CA 5FY0A 2WDQA 5JDLA 2Q9QA 3FZFB 4P0BA 3UU8A 3D0TA 2V8SV 3IGQA 2LKGA 4GIWA 5ETWA 3CIRA 4ILBA 4AIUA 5J5GA 2BVMA 4IL4A 3PUAA 3SH1A 2I0MA 3AVRA 4KHPT 1UV6A 2UXXB 4KMCA 2BBHA 1N34T 3V5SA 2BVLA 1E1HB 5M4YA 2DNXA 2JQ9A 4ZJSA 2XHEB 3FBZA 5JR9A 4WBNE 3NVOA 2VL8A 2C5IT 1IZNB 3NWIA 4AQGA 2BG9B 5AFKA 4I55E 2E9XB 2VKJA 4OYJA 4L5GA 3C4XA 1NENA 1V9DA 5L4EA 2SPCA 4KX6A 2KZ7B 2LRKA 3PU3A 1YQ4A 1Y01A 1J1JA 1XNQT 2BYQA 3PTRB 3X1DA 2M6BA 2V26A 3BQIA 4ZS2A 4YJ3E 3RIAA 4AKHA 4AI6A 3EDUA 5AFMA 3AE3A 2UUCT 2X9XA 3NBXX 1BR4A 3U8MA 2PJQA 2CCQA 5AFMB 3P8CD 1ZHCA 2C0SA 3P7IA 5F8PA 3UU6A 4JI8T 4UM3P 3PUZF 2KMFA 5AQVB 1UURA 3TLWA 2W66A 2WQYA 3SS1A 2CM0A 4HQPA 5AQKB 2A3DA 2H89A 4JI1T 1HNZT 4M1PA 2ZM8A 4JI7T 4HE8A 5ADXL 4KBMB 4H9QC 4H9NC 1SHZC 2IMLA 4E7ZA 4PJJA 1YW0A 3RGLA 4WYVA 5L3GB 3N9QA 4PFPA 4O2AE 1IBLT 4A97A 3KV5A 4HWHA 2A72A 2CMRA 5JREA 4X1IE 5L3BB 4HWDA 2B76A 5DQVA 4CQIA 5AFNA 3KV6A 3AEDA 3J9X1 3B5MA 4DR4T 2W8GA 4Q25A 2WM9A 4F8HA 5L3FB 3ZDHA 2Y57A 3VR9A 3PUSA 3FXEB 4EZ4A 3N9MA 5HYAA 4WV9A 3N9LA 4AQFA 4DUZT 2DCFA 3L09A 3O1HA 5DJQC 1HX1B 4TNWA 2C5KT 3WAKA 2F4VT 4EB6E 3VKGA 3KBUA 3ONJA 4YTMA 2V5CA 2VVSA 2WU5A 2LKHA 4D01A 2K24A 4DV7T 2WB5A 3N9NA 5LBQB 3KDSE 2WSSV 4EV6A 1KF6A 2WY2A 4DR6T 1WYBA 5FMNA 2E9XA 4OFZA 5FJVA 2NWBA 5J5FA 3R84B 2OA5A 1BR1A 2BJ0A 4BFQA 4KP3C 1D1AA 3MK7C 3B57A 2KSRA 2FJAA 4ZI3D 2VQET 5HEJA 2GK9A 2LM2A 2PBIA 1FEWA 3UFGA 3UQ7A 4TV8E 4B3MT 5AFHA 3N2KE 3P4WA 3AEAA 1KEYA 4QH5A 3QB5A 1E2AA 2XQ3A 3WTKA 2CE7A 3SFDA 5L3EB 3ZEFB 4OX9T 2D9DA 3N2GE 4IHJE 2PFVA 2WWUA 3WTLA 3AA7B 3EVYA 3CPZA 3E08A 1HNXT 2BYSA 2BKNA 2V7JA 1OEDC 5FY7A 1S94A 3EDVA 5JR9B 2Y7YA 4JI4T 2XNTA 2IUBA 2XZEA 2V6YA 2DLRA 5H6RB 3DTOA 4I43B 2JPFA 3JAEA 3ZN1B 4UY2A 3VHLA 3ONXA 3QB5K 2HN2A 3RLFF 2CWYA 2LHNA 2W61A 1D0XA 4NXNT 5AFUL 3FXDB 2JMHA 3OKQA 4AFTA 2CHOA 4X5TA 2X9WA 5LHHB 4X1KE 1OEDA 1W0BA 3QK6A 2BKOA 5LG4A 4ZRUA 2XYSA 4U72A 2XSBA 4AISA 1IBMT 4P09A 3OVUA 2UXNB 4OYKA 5KMGP 5LGUB 1VCTA 1LVKA 5HXSA 2FJDA 1UUSA 4AQFC 4TWDA 4LF4T 4LF6T 3T1YT 4MHCA 4GKKT 5EK2A 5IUXA 4TWFA 3AA1B 2DI4A 4DR5T 3U78A 1QLBA 5HEOA 2XZ6A 5F3JA 2PTFA 2J1DG 3I0OA 1UX2A 5FXVA 2HN1A 3ABVA 4KHZF 3O1IA 4CXWA 4I4TE 1FMWA 3ZCIA 1UX5A 4H9PC 5AQGB 2X00D 4X20E 1Z8UA 3Q5XA 2V6YB 5ABEA 3ZCJA 3MA9A 2QVAA 4B3RT 4MALA 5JDHA 2AE9A 5LGTB 2X0YA 2CRBA 3NZPA 3LSVA 4WNKA 2WDVA 5HXRA 3Q2MA 2W0GA 4QXBB 3DP7A 4TZ4C 4PK5A 4COFA 3CX8B 3C79A 1OWAA 3AE2A 4YHHT 2BS2A 2PGZA 2XAQB 3NRYA 4DV1T 3OYXA 2UZ6A 4NZBA 2YDSA 1L0VA 3AXJB 4LF9T 2VASA 1HF8A 4UVCB 4QXCB 2H7VC 2CBIA 2FUPA 4IE5A 4YT0A 4H63V 3H3MA 2D0UA 4DMWA 3JCFA 5LOVE 5AQLB 4PJMA 5FY1A 4GYRA 3SRZA 2V7KA 1KFYA 5CB4E 2Y54A 2MOZA 5HCJA 3HI2A 1HCIA 2Y58A 2I59A 4ASKA 4QABA 3HR0A 3L8RA 2YN6A 1G73A 1W0AA 4PNIA 2W63A 2WCAA 2YK0A 5LJMA 5J5HA 2A2FX 3ZMSB 5JTGA 4TNVA 5TVCA 1YXRA 4X64T 2BG9A 4H9OC 2CXFA 4G63A 4FRRA 4DV5T 1N32T 3V5UA 3SIOA 3IF8B 1MMNA 3UUNA 3GA8A 4WW0A 4P1NA 1M7KA 4H9SE 3VU7H 4EGWA 4ZXLA 2KXPB 3OYZA 4LFBT 2UXDT 5L3DB 2FBWA 4AKLA 5ABFB 4ERRA 4ZHQE 2N9DA 2VWAA 3TKLB 4IE6A 1WRDA 2EHOD 5AQJB 1J5WA 3C64A 4YSZA 4BJMA 5FL1A 4CI1B 2MBGA 3BQKA 2BDEA 5ABGA 2XQAA 4B5DA 2YU1A 4YFSA 3WI3A 4DR7T 3Q5DA 3AEEA 3AE4A 2KINB 3HL6A 3RYCE 3LBXB 2XPKA 2Y48B 4DVDA 1NAFA 5FKYA 1XMQT 3IEEA 4DV6T 3O4XE 2YKSA 3LFMA 4LMJA 2X67A 4CZZB 4IE7A 1ZEEA
chains in the Genus database with same CATH topology
3PMZA 3U8LA 3RQUA 2XYTA 5HEGA 3T4MA 4HFHA 2LKHA 3JAEA 3U8JA 4IL9A 2WZYA 2MAWA 4PIRA 4D01A 3RQWA 4BQTA 4XK9A 2XQ5A 4UY2A 2WNLA 5AFMB 5CFBA 5BP0A 4LMKA 3UU6A 5J5HA 3UU8A 2BYNA 2Y56A 4UM3P 3U8KA 3UU5A 2X00D 4TNVA 2M6IA 5L47A 3IGQA 4QH4A 4ZZCA 3TLWA 2WN9A 2BG9A 3PEOA 5FJVA 5TVCA 5KE4A 3UQ4A 2LKGA 4HFBA 4HQPA 4ILBA 4FRRA 4ILCA 2XNVA 4UM1A 3SIOA 5SYOA 5J5GA 5J5FA 3TLSA 4HFCA 4IL4A 2ZJVA 3SH1A 5LXBA 2X00A 2VL0A 2BJ0A 4ZR6A 5AFLA 2XZ5A 3TLUA 1UV6A 4BFQA 4Z91A 2XQ4A 4ZZBA 2LLYA 4X5TA 5AFJA 4AFTA 3JAFA 2KSRA 4ILAA 5LG3A 2BYRA 5HEJA 2ZJUA 2WNJA 3LSVA 5J0ZA 1OEDA 2YOEA 3UUBA 2BYPA 4ZJSA 1I9BA 5AINA 2XQ7A 3RIFA 4HFEA 2XYSA 4ZRUA 4NPPA 2LM2A 4A97A 4ALXA 3TLTA 5JMEA 4UM3A 4QH1A 2BG9E 4COFA 3UQ7A 3C79A 5KZUA 3EHZA 5AFHA 1OEDB 3RI5A 2BG9B 3UU3A 2XQ9A 4HFIA 4UM3S 5AFKA 3P4WA 5BW2A 2PGZA 3EAMA 2XNUA 3WTJA 4AFHA 3U8NA 4QH5A 5CO5A 2UZ6A 3WIPA 4NZBA 3WTOA 3SQ6A 4Z90A 2XQAA 5AFNA 2XQ3A 3EI0A 5HCMA 3RHWA 3ZKRA 2W8FA 4XHEA 4ZK4A 3WTKA 3WTIA 4B5DA 5L4EA 5HEHA 2W8GA 5BRXA 4IREA 3P50A 3WTNA 4DBMA 4TWDA 4F8HA 2BR7A 2C9TA 2QC1B 3WTHA 4QACA 3ZDHA 3ZDGA 3GUAA 4ZK1A 3WTLA 2Y57A 2BR8A 3JADA 3C84A 2BYQA 2BG9C 5IUXA 2BYSA 2Y54A 5J5IA 2XQ6A 2M6BA 4TWFA 3TLVA 1OEDE 4UXUA 1OEDC 5HCJA 2YMEA 2Y58A 4WV9A 2Y7YA 4EZ1A 3RIAA 2XNTA 3UU4A 5HEOA 4QABA 4A98A 5AFMA 2YKSA 2WNCA 4AFGA 2XZ6A 2XQ8A 4LMJA 4LMLA 2PH9A 4HFDA 4ZJTA 4QAAA 3SQ9A 1UW6A 4TNWA 2YMDA 5HEUA 1UX2A 4TWHA 3U8MA 2YN6A 5L4HA 3WTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMZ A;  3U8L A;  3RQU A;  2XYT A;  5HEG A;  3T4M A;  4HFH A;  2LKH A;  3JAE A;  3U8J A;  4IL9 A;  2WZY A;  2MAW A;  4PIR A;  4D01 A;  3RQW A;  4BQT A;  4XK9 A;  2XQ5 A;  4UY2 A;  2WNL A;  5AFM B;  5CFB A;  5BP0 A;  4LMK A;  3UU6 A;  5J5H A;  3UU8 A;  2BYN A;  2Y56 A;  4UM3 P;  3U8K A;  3UU5 A;  2X00 D;  4TNV A;  2M6I A;  5L47 A;  3IGQ A;  4QH4 A;  4ZZC A;  3TLW A;  2WN9 A;  2BG9 A;  3PEO A;  5FJV A;  5TVC A;  5KE4 A;  3UQ4 A;  2LKG A;  4HFB A;  4HQP A;  4ILB A;  4FRR A;  4ILC A;  2XNV A;  4UM1 A;  3SIO A;  5SYO A;  5J5G A;  5J5F A;  3TLS A;  4HFC A;  4IL4 A;  2ZJV A;  3SH1 A;  5LXB A;  2X00 A;  2VL0 A;  2BJ0 A;  4ZR6 A;  5AFL A;  2XZ5 A;  3TLU A;  1UV6 A;  4BFQ A;  4Z91 A;  2XQ4 A;  4ZZB A;  2LLY A;  4X5T A;  5AFJ A;  4AFT A;  3JAF A;  2KSR A;  4ILA A;  5LG3 A;  2BYR A;  5HEJ A;  2ZJU A;  2WNJ A;  3LSV A;  5J0Z A;  1OED A;  2YOE A;  3UUB A;  2BYP A;  4ZJS A;  1I9B A;  5AIN A;  2XQ7 A;  3RIF A;  4HFE A;  2XYS A;  4ZRU A;  4NPP A;  2LM2 A;  4A97 A;  4ALX A;  3TLT A;  5JME A;  4UM3 A;  4QH1 A;  2BG9 E;  4COF A;  3UQ7 A;  3C79 A;  5KZU A;  3EHZ A;  5AFH A;  1OED B;  3RI5 A;  2BG9 B;  3UU3 A;  2XQ9 A;  4HFI A;  4UM3 S;  5AFK A;  3P4W A;  5BW2 A;  2PGZ A;  3EAM A;  2XNU A;  3WTJ A;  4AFH A;  3U8N A;  4QH5 A;  5CO5 A;  2UZ6 A;  3WIP A;  4NZB A;  3WTO A;  3SQ6 A;  4Z90 A;  2XQA A;  5AFN A;  2XQ3 A;  3EI0 A;  5HCM A;  3RHW A;  3ZKR A;  2W8F A;  4XHE A;  4ZK4 A;  3WTK A;  3WTI A;  4B5D A;  5L4E A;  5HEH A;  2W8G A;  5BRX A;  4IRE A;  3P50 A;  3WTN A;  4DBM A;  4TWD A;  4F8H A;  2BR7 A;  2C9T A;  2QC1 B;  3WTH A;  4QAC A;  3ZDH A;  3ZDG A;  3GUA A;  4ZK1 A;  3WTL A;  2Y57 A;  2BR8 A;  3JAD A;  3C84 A;  2BYQ A;  2BG9 C;  5IUX A;  2BYS A;  2Y54 A;  5J5I A;  2XQ6 A;  2M6B A;  4TWF A;  3TLV A;  1OED E;  4UXU A;  1OED C;  5HCJ A;  2YME A;  2Y58 A;  4WV9 A;  2Y7Y A;  4EZ1 A;  3RIA A;  2XNT A;  3UU4 A;  5HEO A;  4QAB A;  4A98 A;  5AFM A;  2YKS A;  2WNC A;  4AFG A;  2XZ6 A;  2XQ8 A;  4LMJ A;  4LML A;  2PH9 A;  4HFD A;  4ZJT A;  4QAA A;  3SQ9 A;  1UW6 A;  4TNW A;  2YMD A;  5HEU A;  1UX2 A;  4TWH A;  3U8M A;  2YN6 A;  5L4H A;  3WTM A; 
#chains in the Genus database with same CATH topology
 3RYF E;  3OPC A;  2VKH A;  5F5W A;  3PJA J;  1MMA A;  2NW8 A;  3UTK A;  4BJN A;  3AE9 A;  2IDO B;  2X0H A;  3GN5 B;  2QA7 A;  1ZOY A;  2V6X A;  3AB3 B;  3GWH A;  1YKE B;  5FNV E;  1IAP A;  3P4Q A;  1HNW T;  3A5X A;  4UEL A;  4Z91 A;  2EHO C;  1KNR A;  3AEF A;  4NUU A;  2JRK A;  1R8I A;  4EIW A;  2V7M A;  4DV4 T;  1LKX A;  3TLT A;  1SUM B;  5KZU A;  2D2S A;  5EK4 A;  4JEU B;  2CLY C;  5C2T A;  3CQX C;  2K48 A;  4O4I E;  1IJ5 A;  3IBP A;  3F2E A;  5CO5 A;  4ANJ A;  2CA5 A;  4XHE A;  3RHW A;  4IDP A;  2YDR A;  3PUG A;  3MXZ A;  3KV9 A;  3ZT5 A;  1MIY A;  4KUM B;  4JV5 T;  2HH7 A;  5CGM A;  2BR7 A;  3SWH A;  1CHU A;  2JIW A;  3RPU A;  3NKZ A;  5AQR B;  3NRX A;  4UXN B;  4QKN A;  1D0Y A;  2DWK A;  4A98 A;  1QSD A;  2J62 A;  2X9Y A;  5AQU B;  1GQE A;  1YQ3 A;  4N78 D;  1XDO A;  5A1L A;  3EAB A;  4IE0 A;  4QHO A;  3SFE A;  4PJN A;  5HEG A;  2XYT A;  4X62 T;  4DMV A;  3U8J A;  3AE6 A;  4IST A;  3LG7 A;  4EAH A;  4OHF A;  3RQW A;  2V5D A;  2XQ5 A;  3AEB A;  1FJG T;  4U31 A;  1BR0 A;  4JI2 T;  4YJ2 E;  4JI6 T;  3PDY A;  2YIN A;  2JQH A;  3UFE A;  2XNV A;  4LF8 T;  5LXB A;  1B7T A;  2LSI A;  4U7I A;  2X68 A;  2XQ4 A;  4CN4 A;  5LGN B;  2KWH A;  4LF7 T;  3L3P A;  2BYP A;  5IHY A;  4C90 A;  3K1S A;  2L3L A;  4ZI3 C;  3ZYM A;  2VQF T;  3JC6 D;  1XDP A;  3Q5E A;  5LYJ E;  1I6Z A;  3GN5 A;  4TUY E;  2ODU A;  4UF0 B;  2XQ9 A;  2IAK A;  5IWA T;  2ES0 A;  1UK5 A;  2BS3 A;  4UVA B;  3WTI A;  5HWX A;  3GMI A;  4HEA A;  2UUA T;  1XWM A;  4NUV A;  1X79 A;  5FXW A;  3C84 A;  3HKD E;  2UU9 T;  5AQP B;  4IGU A;  2YME A;  2OLT A;  4X65 T;  5LHG B;  5EK3 A;  2V7L A;  4WZX A;  4DR3 T;  5AQT B;  2ZM6 T;  4HWI B;  1UW6 A;  2LEH A;  4BA9 A;  1N33 T;  3LBX A;  2BZB A;  1VOM A;  3QNU A;  4UVB B;  3PMZ A;  3RQU A;  3ESL A;  4U7Y A;  2WNL A;  1QUU A;  5CFB A;  2XAJ B;  2CXD A;  1U4Q A;  2KND A;  3WAJ A;  4G2A A;  5L47 A;  1E7P A;  5LXT E;  3N9P A;  3FB2 A;  2OV9 A;  3PUV F;  2ODV A;  3ZMT B;  2LM9 A;  2UUB T;  1OXZ A;  5AQF B;  5CJ5 A;  2NTX A;  1HFA A;  3JAF A;  4TV9 E;  2FJB A;  4B6X A;  5E0O A;  5LG3 A;  1SE7 A;  2W2U A;  4U33 A;  3ZN0 B;  3ZMV B;  1HR0 T;  4HFE A;  3RKG A;  5FL0 A;  5LMN T;  4L0R A;  2VB6 A;  4B3T T;  3N2O A;  1WR0 A;  4DBQ A;  1OED B;  4I0U A;  4UEM A;  2LT3 A;  3WTJ A;  3WIP A;  2X51 A;  4O4L E;  4YLH A;  3VKH A;  3RYH E;  3CQG B;  3P50 A;  4DBM A;  2XAF B;  4QAC A;  2WMN A;  5BMV E;  1G8X A;  2Z6E A;  5GON E;  4L9I A;  3N9O A;  2E9X D;  4AXP A;  2H3R A;  2H7O A;  4QAA A;  2N1G A;  2DWG A;  5HEU A;  3AE5 A;  1JNZ A;  5IYZ E;  3UUM A;  2YEV C;  3ZT7 A;  2BKP A;  3FZL B;  1YKH B;  4DID B;  4P0A A;  4FI5 A;  2IHR 1;  2Y56 A;  2RP4 A;  4O4J E;  2M6I A;  3PU8 A;  3B13 A;  4JI3 T;  5KE4 A;  5LA6 E;  1WCR A;  2NTY A;  3AA6 B;  2AXD S;  1HG5 A;  2X00 A;  1MIV A;  3RRW A;  5AFL A;  4X66 T;  1CUN A;  2Q9Q D;  1YD8 G;  4U3C A;  3L39 A;  5DAB A;  4A5X A;  3UUB A;  4AKG A;  3IA3 A;  1T98 A;  3M65 A;  2X0L B;  3UU3 A;  3AEC A;  1XMO T;  3EAM A;  5FXZ A;  2L8K A;  5JDG A;  4A56 A;  1US7 B;  3F31 A;  2K5B B;  2WZI A;  4ISS A;  3KV4 A;  3O1J A;  2LJL A;  5HEH A;  4ZI2 D;  2IC6 A;  2XQY A;  2C9T A;  2QC1 B;  3WTH A;  4ZK1 A;  3GUA A;  5JRC B;  2ZMA A;  3CML A;  3AEG A;  2MPK A;  4ILU A;  5AQH B;  4QX7 B;  3RC8 A;  1VRB A;  4JEH B;  5LB7 B;  5C3J A;  2LRL A;  4JI0 T;  5FYM A;  5HXE A;  5AQM B;  3H3A A;  3A7M A;  2MAW A;  3QC9 A;  4YY3 T;  4DV0 T;  1FMV A;  4LMK A;  4YXD A;  1H7C A;  4NXM T;  3UU5 A;  4O4H E;  4LF5 T;  3BK9 A;  4QH4 A;  2Y6X A;  2RA1 A;  1I94 T;  2UXB T;  4ZI2 C;  2ACZ A;  4DR2 T;  2ZJV A;  3KVA A;  2IIU A;  3KVB A;  1MMG A;  3ANW B;  4ZEY A;  2G0U A;  4TN7 B;  4DV2 T;  5AFJ A;  1O3X A;  3RRC A;  4LFC T;  2E8I A;  2ZJU A;  2XSA A;  4PK4 A;  4JYA T;  2YOE A;  5AQI B;  3CX7 B;  1I9B A;  3ZSS A;  1AJ3 A;  3RH3 A;  4QH1 A;  2QRX A;  2D0T A;  3ZMZ B;  2P9B A;  2XNU A;  2EHO A;  1ZV4 X;  5CA0 E;  3SQ6 A;  3ZKR A;  4ZK4 A;  3RX6 A;  3VR8 A;  3DJB A;  2C5J A;  4IRE A;  4HWF A;  4Z8X A;  2E5L T;  3T1H T;  2VKO A;  1X9B A;  2XQ6 A;  2KLQ A;  4X1Y E;  4CXY A;  4AKR B;  3AAI A;  2XAS B;  3UU4 A;  3RIU C;  2WBL A;  2LSG A;  3IHR A;  3PUR A;  2NP9 A;  5DQW A;  2WZY A;  4U2Z A;  2NR4 A;  4CI2 B;  3UUL A;  5L3C B;  4JBW F;  4IT4 A;  5BP0 A;  5HWY A;  3I9Y A;  3ZPO A;  3C98 B;  5FXX A;  1T8B A;  4HN9 A;  5LMU T;  5KDM C;  4C91 A;  2WN9 A;  4E7S A;  4GK0 E;  3RYI E;  3ZYL A;  2ZM2 A;  4IDQ A;  4EOZ B;  3OBV E;  2V7I A;  3ZLI A;  2XZ5 A;  3MZK B;  1DU2 A;  5J2T E;  4UR9 A;  2BYR A;  5J0Z A;  5LJN A;  2W62 A;  1BR2 A;  3ZMU B;  5AIN A;  4YSY A;  3ZST A;  2XUE A;  3HA4 A;  2XTL A;  3RF1 A;  4UM3 A;  4GKJ T;  3EHZ A;  4UM3 S;  3I9W A;  5HXC A;  2JQQ A;  1XZY A;  3U8N A;  2A9U A;  4Z90 A;  2R6G F;  2W8F A;  1D0Z A;  2KWI B;  1D1B A;  2W4X A;  5HXH A;  5FP3 A;  4U2Y A;  4NIQ A;  2CBJ A;  2EHO B;  2BR8 A;  2XAH B;  2ACX A;  4CN6 A;  3TLV A;  1OED E;  3BQL A;  1WYC A;  2XJ7 A;  2IC9 A;  1FIO A;  3LK3 B;  4DND A;  4UV8 B;  4PFO A;  4FJO A;  2LOS A;  5FVK A;  3C4Z A;  3QOF A;  3ZYK A;  5L4H A;  5JRC A;  3H37 A;  2YDQ A;  1N36 T;  2LHR A;  4XK9 A;  5LP6 E;  1J5E T;  3ZC0 A;  1W09 A;  5HAX A;  3AE8 A;  2MTQ A;  4UV9 B;  3UT5 E;  2CWO A;  5C8Y E;  3U8K A;  5LBM A;  3HKB E;  3FBL A;  1LRZ A;  5LNK A;  4UM1 A;  5SYO A;  2Q9Q C;  1T72 A;  3TLS A;  2JQK A;  4O8S A;  1Y64 B;  4ZR6 A;  3AAA B;  3TLU A;  2E2A A;  2LOP A;  1HTJ F;  4ZZB A;  2E9X C;  4PK6 A;  4DV3 T;  1IBK T;  4UF0 A;  3J7Y q;  2WZH A;  2ZLY A;  3Q9D A;  2WS3 A;  4NPP A;  5JME A;  2BG9 E;  1HG2 A;  1IJ6 A;  2HHH T;  5JH7 E;  2LSJ A;  4HFI A;  3F57 A;  1HX8 A;  4CI3 B;  5ABF A;  4IDO A;  4EED A;  3CQC B;  4XAX B;  3QUJ A;  3W15 B;  4QWN B;  3A8Y C;  3O9X A;  4HFV A;  2CEA A;  3NZQ A;  4BAY B;  4GK5 E;  5J5I A;  3AE7 A;  2Y8D A;  5FVL A;  4EZ1 A;  3ZT6 A;  3Q5W A;  3P4R A;  5L2L A;  1ZKE A;  5J1G A;  4HFD A;  3AVS A;  5LCY A;  4AKI A;  3WTM A;  3MKD A;  1UCU A;  4HWC A;  2J47 A;  5JDF A;  5JDQ A;  2WWV A;  3PE0 A;  4BQT A;  1NWM X;  2CXL A;  1XNR T;  4K0K T;  3ZJ2 A;  3T8O A;  4IE4 A;  3ZJ1 A;  4OK0 A;  4DO0 A;  1KK7 A;  2BYN A;  3I1A A;  4ZS3 A;  4ZZC A;  4MFR A;  1JNR A;  3UQ4 A;  1VCS A;  4HFB A;  3M3Z B;  2WAU A;  5CA1 E;  5KXJ A;  3LDQ B;  4DUY T;  4IDN A;  1WR6 A;  4EXT A;  5JDM A;  2FJE A;  2MYS A;  2DL1 A;  4ILA A;  1SA0 E;  4YHJ A;  2XQ7 A;  2N2N A;  2VVN A;  4ALX A;  4H9R C;  2XM2 A;  1MIW A;  4ADZ A;  5JQG E;  3VRA A;  5BW2 A;  4PJL A;  4IIJ E;  3UUX B;  3KFW X;  2E5V A;  3EI0 A;  2NOX A;  4JUY A;  4MLK A;  3K8P C;  4UIG A;  4PAG A;  2W00 A;  3K3N A;  1T7S A;  2WMO A;  3JAD A;  1MND A;  3ONL C;  1KNZ A;  1KNP A;  1LVF A;  2CHN A;  4JLE A;  2K3W A;  4ZJT A;  3FZK B;  4TWH A;  4MBQ A;  2I6H A;  3U8L A;  3CKD A;  4HFH A;  2NW9 A;  4PIR A;  2ZM0 A;  4F6R C;  2JJ9 A;  4AQY T;  5AQO B;  3SOL A;  2UXC T;  4I50 E;  1UGO A;  2X9H A;  2Q9Q B;  2VUR A;  3FZM B;  3VRB A;  4HGA A;  5AQS B;  5AQQ B;  3C51 A;  3PEO A;  2LSK A;  2VK9 A;  2IW5 B;  3OTO T;  2BBJ A;  3KBT A;  2RPA A;  3C4W A;  3K3O A;  2VL0 A;  4EEB A;  3PUQ A;  5JR9 C;  4ZI7 E;  3AE1 A;  4JI5 T;  2CLY B;  2XAG B;  3RKO A;  4DR1 T;  3PUY F;  3RIF A;  3LK4 2;  3R6N A;  3MAC A;  1MNE A;  2QGS A;  2JMK A;  4KI0 F;  3PUX F;  4EZH A;  2BS4 A;  4AFH A;  1MMD A;  4EYU A;  3E22 E;  2XM1 A;  3JC6 C;  5LHI B;  3WTO A;  2D5U A;  2WDR A;  5BRX A;  3HKC E;  3N5L A;  3FHN A;  3RIU A;  4B3S T;  3PV0 F;  1S35 A;  4PW8 A;  2BG9 C;  4DBR A;  3P4P A;  4H63 H;  4GOU A;  4YTP A;  3PUW F;  4UXU A;  2KT9 A;  3HKE E;  2WNC A;  2XQ8 A;  4LML A;  2PH9 A;  5ABH A;  3CWZ B;  3SQ9 A;  3MJX A;  4U74 A;  4XBF B;  2YMD A;  3KIN B;  3LK2 B;  4IDZ A;  4TX5 A;  2DHR A;  2XY8 B;  3ANW A;  4IL9 A;  4EYY R;  4YTN A;  3C50 A;  2HPJ A;  4WBO A;  1HS7 A;  3K3Q C;  4HKA A;  3AAE B;  3I0Q A;  3U3I A;  2K9A A;  2NW7 A;  5JVD E;  1UX4 A;  4LFA T;  3S4U A;  4ILC A;  2HPL A;  5EZY E;  4HFC A;  2V1D B;  3ETU A;  3AXJ A;  1Z0P A;  2LLY A;  1W9R A;  2J4G A;  2W67 A;  4YSX A;  2VKD A;  5KX5 E;  2WNJ A;  4J2C A;  1U5P A;  5H6Q B;  4CN1 A;  5BR8 T;  4QXH B;  5JDN A;  3RI5 A;  4HTE A;  1WLX A;  4O2B E;  1ZP0 A;  2YU2 A;  2QYW A;  5J2U E;  5HCM A;  2LSY A;  2PG8 A;  1M62 A;  2CPT A;  3RC3 A;  4ZOL E;  3ZC1 A;  2WP9 A;  3WTN A;  5TAO A;  3ETV A;  3ZDG A;  3CX6 B;  3G06 A;  3FZH B;  2LE8 A;  3PJA A;  1EZ3 A;  4CXX A;  4V1A v;  3P4S A;  1NEK A;  2M67 A;  3CK6 A;  1WFD A;  5AQN B;  3E0Z A;  2B1E A;  3LJC A;  3AA0 B;  3OJA A;  4AFG A;  4QX8 B;  2L9Q A;  2X66 A;  4K0U A;  3EUH A;  4XZC A;  2H88 A;  4GYS A;  3CVR A;  3T4M A;  2WU2 A;  1D1C A;  5FY0 A;  2WDQ A;  5JDL A;  2Q9Q A;  3FZF B;  4P0B A;  3UU8 A;  3D0T A;  2V8S V;  3IGQ A;  2LKG A;  4GIW A;  5ETW A;  3CIR A;  4ILB A;  4AIU A;  5J5G A;  2BVM A;  4IL4 A;  3PUA A;  3SH1 A;  2I0M A;  3AVR A;  4KHP T;  1UV6 A;  2UXX B;  4KMC A;  2BBH A;  1N34 T;  3V5S A;  2BVL A;  1E1H B;  5M4Y A;  2DNX A;  2JQ9 A;  4ZJS A;  2XHE B;  3FBZ A;  5JR9 A;  4WBN E;  3NVO A;  2VL8 A;  2C5I T;  1IZN B;  3NWI A;  4AQG A;  2BG9 B;  5AFK A;  4I55 E;  2E9X B;  2VKJ A;  4OYJ A;  4L5G A;  3C4X A;  1NEN A;  1V9D A;  5L4E A;  2SPC A;  4KX6 A;  2KZ7 B;  2LRK A;  3PU3 A;  1YQ4 A;  1Y01 A;  1J1J A;  1XNQ T;  2BYQ A;  3PTR B;  3X1D A;  2M6B A;  2V26 A;  3BQI A;  4ZS2 A;  4YJ3 E;  3RIA A;  4AKH A;  4AI6 A;  3EDU A;  5AFM A;  3AE3 A;  2UUC T;  2X9X A;  3NBX X;  1BR4 A;  3U8M A;  2PJQ A;  2CCQ A;  5AFM B;  3P8C D;  1ZHC A;  2C0S A;  3P7I A;  5F8P A;  3UU6 A;  4JI8 T;  4UM3 P;  3PUZ F;  2KMF A;  5AQV B;  1UUR A;  3TLW A;  2W66 A;  2WQY A;  3SS1 A;  2CM0 A;  4HQP A;  5AQK B;  2A3D A;  2H89 A;  4JI1 T;  1HNZ T;  4M1P A;  2ZM8 A;  4JI7 T;  4HE8 A;  5ADX L;  4KBM B;  4H9Q C;  4H9N C;  1SHZ C;  2IML A;  4E7Z A;  4PJJ A;  1YW0 A;  3RGL A;  4WYV A;  5L3G B;  3N9Q A;  4PFP A;  4O2A E;  1IBL T;  4A97 A;  3KV5 A;  4HWH A;  2A72 A;  2CMR A;  5JRE A;  4X1I E;  5L3B B;  4HWD A;  2B76 A;  5DQV A;  4CQI A;  5AFN A;  3KV6 A;  3AED A;  3J9X 1;  3B5M A;  4DR4 T;  2W8G A;  4Q25 A;  2WM9 A;  4F8H A;  5L3F B;  3ZDH A;  2Y57 A;  3VR9 A;  3PUS A;  3FXE B;  4EZ4 A;  3N9M A;  5HYA A;  4WV9 A;  3N9L A;  4AQF A;  4DUZ T;  2DCF A;  3L09 A;  3O1H A;  5DJQ C;  1HX1 B;  4TNW A;  2C5K T;  3WAK A;  2F4V T;  4EB6 E;  3VKG A;  3KBU A;  3ONJ A;  4YTM A;  2V5C A;  2VVS A;  2WU5 A;  2LKH A;  4D01 A;  2K24 A;  4DV7 T;  2WB5 A;  3N9N A;  5LBQ B;  3KDS E;  2WSS V;  4EV6 A;  1KF6 A;  2WY2 A;  4DR6 T;  1WYB A;  5FMN A;  2E9X A;  4OFZ A;  5FJV A;  2NWB A;  5J5F A;  3R84 B;  2OA5 A;  1BR1 A;  2BJ0 A;  4BFQ A;  4KP3 C;  1D1A A;  3MK7 C;  3B57 A;  2KSR A;  2FJA A;  4ZI3 D;  2VQE T;  5HEJ A;  2GK9 A;  2LM2 A;  2PBI A;  1FEW A;  3UFG A;  3UQ7 A;  4TV8 E;  4B3M T;  5AFH A;  3N2K E;  3P4W A;  3AEA A;  1KEY A;  4QH5 A;  3QB5 A;  1E2A A;  2XQ3 A;  3WTK A;  2CE7 A;  3SFD A;  5L3E B;  3ZEF B;  4OX9 T;  2D9D A;  3N2G E;  4IHJ E;  2PFV A;  2WWU A;  3WTL A;  3AA7 B;  3EVY A;  3CPZ A;  3E08 A;  1HNX T;  2BYS A;  2BKN A;  2V7J A;  1OED C;  5FY7 A;  1S94 A;  3EDV A;  5JR9 B;  2Y7Y A;  4JI4 T;  2XNT A;  2IUB A;  2XZE A;  2V6Y A;  2DLR A;  5H6R B;  3DTO A;  4I43 B;  2JPF A;  3JAE A;  3ZN1 B;  4UY2 A;  3VHL A;  3ONX A;  3QB5 K;  2HN2 A;  3RLF F;  2CWY A;  2LHN A;  2W61 A;  1D0X A;  4NXN T;  5AFU L;  3FXD B;  2JMH A;  3OKQ A;  4AFT A;  2CHO A;  4X5T A;  2X9W A;  5LHH B;  4X1K E;  1OED A;  1W0B A;  3QK6 A;  2BKO A;  5LG4 A;  4ZRU A;  2XYS A;  4U72 A;  2XSB A;  4AIS A;  1IBM T;  4P09 A;  3OVU A;  2UXN B;  4OYK A;  5KMG P;  5LGU B;  1VCT A;  1LVK A;  5HXS A;  2FJD A;  1UUS A;  4AQF C;  4TWD A;  4LF4 T;  4LF6 T;  3T1Y T;  4MHC A;  4GKK T;  5EK2 A;  5IUX A;  4TWF A;  3AA1 B;  2DI4 A;  4DR5 T;  3U78 A;  1QLB A;  5HEO A;  2XZ6 A;  5F3J A;  2PTF A;  2J1D G;  3I0O A;  1UX2 A;  5FXV A;  2HN1 A;  3ABV A;  4KHZ F;  3O1I A;  4CXW A;  4I4T E;  1FMW A;  3ZCI A;  1UX5 A;  4H9P C;  5AQG B;  2X00 D;  4X20 E;  1Z8U A;  3Q5X A;  2V6Y B;  5ABE A;  3ZCJ A;  3MA9 A;  2QVA A;  4B3R T;  4MAL A;  5JDH A;  2AE9 A;  5LGT B;  2X0Y A;  2CRB A;  3NZP A;  3LSV A;  4WNK A;  2WDV A;  5HXR A;  3Q2M A;  2W0G A;  4QXB B;  3DP7 A;  4TZ4 C;  4PK5 A;  4COF A;  3CX8 B;  3C79 A;  1OWA A;  3AE2 A;  4YHH T;  2BS2 A;  2PGZ A;  2XAQ B;  3NRY A;  4DV1 T;  3OYX A;  2UZ6 A;  4NZB A;  2YDS A;  1L0V A;  3AXJ B;  4LF9 T;  2VAS A;  1HF8 A;  4UVC B;  4QXC B;  2H7V C;  2CBI A;  2FUP A;  4IE5 A;  4YT0 A;  4H63 V;  3H3M A;  2D0U A;  4DMW A;  3JCF A;  5LOV E;  5AQL B;  4PJM A;  5FY1 A;  4GYR A;  3SRZ A;  2V7K A;  1KFY A;  5CB4 E;  2Y54 A;  2MOZ A;  5HCJ A;  3HI2 A;  1HCI A;  2Y58 A;  2I59 A;  4ASK A;  4QAB A;  3HR0 A;  3L8R A;  2YN6 A;  1G73 A;  1W0A A;  4PNI A;  2W63 A;  2WCA A;  2YK0 A;  5LJM A;  5J5H A;  2A2F X;  3ZMS B;  5JTG A;  4TNV A;  5TVC A;  1YXR A;  4X64 T;  2BG9 A;  4H9O C;  2CXF A;  4G63 A;  4FRR A;  4DV5 T;  1N32 T;  3V5U A;  3SIO A;  3IF8 B;  1MMN A;  3UUN A;  3GA8 A;  4WW0 A;  4P1N A;  1M7K A;  4H9S E;  3VU7 H;  4EGW A;  4ZXL A;  2KXP B;  3OYZ A;  4LFB T;  2UXD T;  5L3D B;  2FBW A;  4AKL A;  5ABF B;  4ERR A;  4ZHQ E;  2N9D A;  2VWA A;  3TKL B;  4IE6 A;  1WRD A;  2EHO D;  5AQJ B;  1J5W A;  3C64 A;  4YSZ A;  4BJM A;  5FL1 A;  4CI1 B;  2MBG A;  3BQK A;  2BDE A;  5ABG A;  2XQA A;  4B5D A;  2YU1 A;  4YFS A;  3WI3 A;  4DR7 T;  3Q5D A;  3AEE A;  3AE4 A;  2KIN B;  3HL6 A;  3RYC E;  3LBX B;  2XPK A;  2Y48 B;  4DVD A;  1NAF A;  5FKY A;  1XMQ T;  3IEE A;  4DV6 T;  3O4X E;  2YKS A;  3LFM A;  4LMJ A;  2X67 A;  4CZZ B;  4IE7 A;  1ZEE A; 
#chains in the Genus database with same CATH homology
 3PMZ A;  3U8L A;  3RQU A;  2XYT A;  5HEG A;  3T4M A;  4HFH A;  2LKH A;  3JAE A;  3U8J A;  4IL9 A;  2WZY A;  2MAW A;  4PIR A;  4D01 A;  3RQW A;  4BQT A;  4XK9 A;  2XQ5 A;  4UY2 A;  2WNL A;  5AFM B;  5CFB A;  5BP0 A;  4LMK A;  3UU6 A;  5J5H A;  3UU8 A;  2BYN A;  2Y56 A;  4UM3 P;  3U8K A;  3UU5 A;  2X00 D;  4TNV A;  2M6I A;  5L47 A;  3IGQ A;  4QH4 A;  4ZZC A;  3TLW A;  2WN9 A;  2BG9 A;  3PEO A;  5FJV A;  5TVC A;  5KE4 A;  3UQ4 A;  2LKG A;  4HFB A;  4HQP A;  4ILB A;  4FRR A;  4ILC A;  2XNV A;  4UM1 A;  3SIO A;  5SYO A;  5J5G A;  5J5F A;  3TLS A;  4HFC A;  4IL4 A;  2ZJV A;  3SH1 A;  5LXB A;  2X00 A;  2VL0 A;  2BJ0 A;  4ZR6 A;  5AFL A;  2XZ5 A;  3TLU A;  1UV6 A;  4BFQ A;  4Z91 A;  2XQ4 A;  4ZZB A;  2LLY A;  4X5T A;  5AFJ A;  4AFT A;  3JAF A;  2KSR A;  4ILA A;  5LG3 A;  2BYR A;  5HEJ A;  2ZJU A;  2WNJ A;  3LSV A;  5J0Z A;  1OED A;  2YOE A;  3UUB A;  2BYP A;  4ZJS A;  1I9B A;  5AIN A;  2XQ7 A;  3RIF A;  4HFE A;  2XYS A;  4ZRU A;  4NPP A;  2LM2 A;  4A97 A;  4ALX A;  3TLT A;  5JME A;  4UM3 A;  4QH1 A;  2BG9 E;  4COF A;  3UQ7 A;  3C79 A;  5KZU A;  3EHZ A;  5AFH A;  1OED B;  3RI5 A;  2BG9 B;  3UU3 A;  2XQ9 A;  4HFI A;  4UM3 S;  5AFK A;  3P4W A;  5BW2 A;  2PGZ A;  3EAM A;  2XNU A;  3WTJ A;  4AFH A;  3U8N A;  4QH5 A;  5CO5 A;  2UZ6 A;  3WIP A;  4NZB A;  3WTO A;  3SQ6 A;  4Z90 A;  2XQA A;  5AFN A;  2XQ3 A;  3EI0 A;  5HCM A;  3RHW A;  3ZKR A;  2W8F A;  4XHE A;  4ZK4 A;  3WTK A;  3WTI A;  4B5D A;  5L4E A;  5HEH A;  2W8G A;  5BRX A;  4IRE A;  3P50 A;  3WTN A;  4DBM A;  4TWD A;  4F8H A;  2BR7 A;  2C9T A;  2QC1 B;  3WTH A;  4QAC A;  3ZDH A;  3ZDG A;  3GUA A;  4ZK1 A;  3WTL A;  2Y57 A;  2BR8 A;  3JAD A;  3C84 A;  2BYQ A;  2BG9 C;  5IUX A;  2BYS A;  2Y54 A;  5J5I A;  2XQ6 A;  2M6B A;  4TWF A;  3TLV A;  1OED E;  4UXU A;  1OED C;  5HCJ A;  2YME A;  2Y58 A;  4WV9 A;  2Y7Y A;  4EZ1 A;  3RIA A;  2XNT A;  3UU4 A;  5HEO A;  4QAB A;  4A98 A;  5AFM A;  2YKS A;  2WNC A;  4AFG A;  2XZ6 A;  2XQ8 A;  4LMJ A;  4LML A;  2PH9 A;  4HFD A;  4ZJT A;  4QAA A;  3SQ9 A;  1UW6 A;  4TNW A;  2YMD A;  5HEU A;  1UX2 A;  4TWH A;  3U8M A;  2YN6 A;  5L4H A;  3WTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...