5HCMA

The glic pentameric ligand-gated ion channel 2-21' cross-linked mutant complexed to bromoform
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Proton-gated ion channel
publication title Sites of Anesthetic Inhibitory Action on a Cationic Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hcmA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hcmA01
2M6IA 4QABA 4WV9A 4ZR6A 3RI5A 3U8KA 3UQ7A 3WIPA 2ZJUA 2BR8A 4UY2A 5AFHA 4NZBA 5L4EA 3JAFA 2BYRA 4XK9A 2XQ4A 2YN6A 3UU6A 2WZYA 2VL0A 2BG9C 4HFCA 4TNVA 5HEJA 2BYQA 2ZJVA 4UM3P 5CO5A 4ZK4A 3WTJA 4BFQA 2Y7YA 3UU3A 1UX2A 4IL4A 3C79A 3PMZA 4AFHA 5AFMB 2YOEA 2XQAA 4QACA 4ZJTA 3TLWA 2XQ6A 4UM3A 2X00D 3RIFA 3T4MA 2BG9B 4EZ1A 1UV6A 2YMDA 2XQ7A 5AINA 4ZRUA 3WTKA 3WTNA 5LG3A 3UU4A 1UW6A 4ILCA 2LLYA 4F8HA 2W8FA 4UM1A 3U8JA 4TWDA 4HFEA 2XQ8A 3UU8A 5J5FA 5KE4A 3U8NA 5J5GA 4HFDA 2W8GA 5LXBA 2BJ0A 5HEOA 5HEHA 3ZDGA 4Z91A 4LMLA 2LKGA 4ZK1A 5JMEA 4X5TA 5HEUA 4HFHA 3WTMA 4QH4A 4B5DA 4HFBA 3C84A 4IL9A 4A98A 4AFTA 5AFNA 2BG9E 3WTLA 2WN9A 3UQ4A 5AFLA 3UU5A 5J5IA 3RHWA 3WTOA 4HFIA 4DBMA 2LM2A 2BYNA 2WNJA 3SH1A 2WNCA 3RQWA 3UUBA 5HEGA 2PH9A 2XZ5A 1OEDA 4D01A 3TLSA 5J0ZA 4UXUA 4ILBA 4NPPA 3TLUA 2M6BA 4COFA 4XHEA 4ALXA 4LMKA 3EAMA 3P4WA 4A97A 4QH1A 2XQ3A 2XNTA 3GUAA 3PEOA 2YKSA 3RIAA 4PIRA 4TWHA 5BW2A 4UM3S 4IREA 2XNUA 5HCMA 2XYTA 3ZDHA 3SQ6A 4HQPA 2UZ6A 3JADA 1OEDC 5KZUA 2LKHA 2XYSA 5BRXA 5AFJA 3TLTA 2QC1B 5CFBA 3WTIA 3SQ9A 3SIOA 4AFGA 5HCJA 2Y58A 2XQ5A 3JAEA 4BQTA 5J5HA 4Z90A 4QH5A 3ZKRA 1I9BA 3EHZA 2BR7A 1OEDB 2PGZA 5BP0A 2XQ9A 4QAAA 3EI0A 2C9TA 4ZJSA 3IGQA 5TVCA 2YMEA 4ZZCA 5L4HA 4ZZBA 2WNLA 2XZ6A 3RQUA 5SYOA 2MAWA 3U8LA 2BYSA 2BYPA 4TWFA 5L47A 2Y57A 5AFMA 5FJVA 5IUXA 4FRRA 3U8MA 2X00A 2BG9A 3P50A 4LMJA 2KSRA 3LSVA 2XNVA 4TNWA 2Y56A 1OEDE 4ILAA 3WTHA 3TLVA 2Y54A 5AFKA
chains in the Genus database with same CATH superfamily
3IA3A 1QLBA 3ANWB 5JDHA 2W62A 4MBQA 2MOZA 4HFCA 5HEJA 3J9X1 2VKOA 5LGNB 2Y7YA 3RIFA 3UFGA 4F8HA 1WRDA 1XMQT 2EHOC 1FJGT 1G73A 2VWAA 4O4IE 3QUJA 2MTQA 4PAGA 3BQLA 5HAXA 5HEUA 4YTPA 2VKDA 4UEMA 5AFNA 5FVKA 2WDQA 3RHWA 3FBZA 5CGMA 2G0UA 2JMKA 4ZI3C 1O3XA 1T8BA 4KI0F 2V7JA 4D01A 5LNKA 2D9DA 2D0TA 4ILBA 3P4SA 4OHFA 2MBGA 4COFA 3PTRB 4CI2B 1M62A 1MMDA 2XSBA 2CCQA 4F6RC 4ANJA 2X9HA 2XNUA 1YD8G 2AE9A 3B57A 4IE7A 2BKNA 4JI5T 3CQGB 3LJCA 4AFGA 3UTKA 5LXTE 4JI0T 1T72A 2ZM2A 2XQ9A 5LOVE 3RGLA 4ZXLA 2WNLA 3ZN0B 4I50E 4OYKA 4WBNE 4MALA 3ZMVB 1SUMB 2X00A 1QSDA 2K48A 4QWNB 2ZJUA 2NTXA 2XJ7A 2JRKA 3UU6A 2VL0A 2BG9C 2WAUA 2J1DG 5M4YA 1I6ZA 3C79A 4AISA 1HNZT 4ZJTA 3TLWA 3ZPOA 3UU4A 2UUBT 3U8JA 3JCFA 2QGSA 4E7SA 2ACZA 5EK4A 2WMOA 1D0XA 3U78A 3A8YC 4ZK1A 4DV5T 5HYAA 2N1GA 3T1HT 2BZBA 2UXBT 3AE1A 2OLTA 4IE0A 3UQ4A 1BR2A 1WFDA 2ZM6T 4QHOA 4H9RC 2PH9A 3ABVA 4XHEA 4HFVA 4CN1A 3FZHB 2XNTA 3GUAA 3AEFA 1FMVA 4CN6A 4OYJA 1SE7A 4HQPA 3IEEA 4I4TE 2LE8A 2LSJA 4DMVA 2LSGA 4AQFA 1IJ6A 2WMNA 4QKNA 4M1PA 1OEDB 2PGZA 5BP0A 2WZIA 2E8IA 4QAAA 2H88A 2HHHT 5JDGA 3MKDA 2PFVA 5LG4A 5AQMB 3F57A 2DCFA 1S35A 2E9XD 2YINA 2B76A 4CXWA 3K3NA 2K5BB 2V7IA 2ZLYA 3U3IA 2XY8B 2V6YA 2NW8A 3NVOA 1IAPA 4WYVA 5LYJE 2Y6XA 2CLYB 4I43B 2XPKA 4NUUA 4LF8T 3FZMB 3AEAA 2VVNA 4H9QC 4HWHA 2E5LT 3AVRA 4PW8A 1B7TA 4O2BE 4EYYR 4DV4T 4TWDA 3TKLB 3GN5A 4GYSA 5EZYE 4HFHA 3ZC0A 4X1YE 2CPTA 4IDOA 5FXVA 5L3FB 1ZEEA 1KEYA 1MIVA 4EYUA 5LJNA 4UXNB 4JI4T 3TLSA 4Z8XA 3PUZF 4ZI7E 4UXUA 3TLUA 3EAMA 4ASKA 5JR9C 1IBMT 4H63V 2DNXA 4HWDA 2CHOA 3ZCJA 5AQQB 2LOSA 1YKHB 3M3ZB 4CI3B 3KV9A 1HX8A 3AA0B 4UVCB 5IHYA 3EHZA 3DP7A 2XAHB 4DBRA 4ZJSA 5TVCA 5ADXL 2BYSA 4G2AA 2FUPA 3ZEFB 4EZHA 4KMCA 3EUHA 2F4VT 4A5XA 3A7MA 4UF0A 3AXJB 3I9WA 3AAEB 2X0YA 2BR8A 4K0UA 3AECA 4U33A 2SPCA 4AKRB 4OFZA 4X1IE 3EABA 4IE5A 2X67A 3Q5XA 4ZRUA 1IZNB 4HFEA 5KE4A 2V26A 3C50A 1HG2A 1WYCA 2VQET 3SFDA 4C90A 2K24A 2N9DA 4JI1T 5LB7B 2CBIA 1HNXT 2H7VC 1MNEA 1W09A 1HCIA 2WNJA 3T1YT 4DV2T 1CUNA 3PUGA 2KT9A 3LDQB 4I0UA 3N9MA 3P4WA 4UM3S 2WU2A 3UUXB 2UZ6A 1OEDC 4LFAT 4YSZA 2VKJA 4BQTA 4JYAT 4GK0E 4H9SE 4CI1B 2VASA 2BKPA 4YSXA 4O8SA 5FKYA 5L47A 3P4QA 2D5UA 5FP3A 2A2FX 3C98B 3FZFB 2LSYA 2CLYC 1IJ5A 3RYCE 2ZJVA 4TNVA 3N9NA 2IMLA 4AFHA 4ZS2A 4QACA 4YHJA 5FYMA 2KWIB 4UM3A 5KXJA 3ZN1B 2W4XA 2UXDT 2DI4A 1X9BA 2KINB 2X66A 4HFDA 2X0LB 5DQWA 2BJ0A 1J5ET 3AE5A 2LJLA 3HKBE 3B13A 3WI3A 2WZHA 4IDNA 3O9XA 2Y8DA 4GIWA 3C4WA 3ZT7A 5FL0A 4HFIA 1HR0T 3MACA 1N32T 2Y48B 4HE8A 4U7YA 1VCSA 1XMOT 3AVSA 2GK9A 3KINB 2XQ3A 4U72A 5FY0A 2WCAA 4TZ4C 2J4GA 1D1AA 2E9XA 5L2LA 4XAXB 2JQHA 2LKHA 2CHNA 3OVUA 4YFSA 5CFBA 4IDPA 4L5GA 4H9OC 3LK42 3ZKRA 5FVLA 2BR7A 3UT5E 2P9BA 5LGTB 2H3RA 4O4LE 2BYPA 4ERRA 5AFMA 3IHRA 5JDQA 3RIUC 4LMJA 4H63H 2CMRA 4ILAA 5A1LA 5E0OA 4U74A 1I94T 1WYBA 2UXXB 1Y64B 4UY2A 2CBJA 3JAFA 2WZYA 4JLEA 4IL4A 1ZP0A 4AQYT 2XQ6A 3PUYF 2WDVA 3PJAA 4X1KE 2YMDA 5CJ5A 3AAAB 5J5FA 5ABFA 1N34T 3C4XA 4Z91A 3CMLA 4IDQA 2V6YB 4J2CA 3CWZB 2BG9E 1UX5A 2WN9A 2ZM0A 4B3ST 2YK0A 4UIGA 3JC6C 2BYNA 1YKEB 2XHEB 3CK6A 4DVDA 3GN5B 2M6BA 5LCYA 1BR0A 1V9DA 3ZMSB 4TUYE 4AKLA 3F31A 2XYTA 1KK7A 4NUVA 2YU1A 1KF6A 5LGUB 5LMNT 2YDQA 3PURA 2XAQB 1WCRA 1HX1B 2W0GA 1ZHCA 2XQ5A 1UX4A 3B5MA 1IBLT 1HFAA 5AQPB 4JI2T 3ZSSA 2LSKA 3U8LA 3KV6A 4JBWF 1VCTA 2WY2A 2V1DB 1MMAA 2X51A 2HPLA 1NENA 5BMVE 5JR9B 3PU3A 4BFQA 1KNPA 5ABEA 4QABA 3U8KA 5AQTB 3C51A 3WIPA 3FHNA 2WWUA 4G63A 2Q9QD 2BYQA 4EZ4A 3HKEE 4QXCB 2YOEA 1LVFA 3MJXA 1SHZC 4EZ1A 2UUAT 4UF0B 2W8FA 4UM1A 1IBKT 2XQ8A 5J5GA 3V5UA 2W8GA 4IGUA 2DWGA 2CXDA 5J1GA 2XM2A 1KNRA 5AQUB 3WTMA 1H7CA 3HR0A 4GOUA 4HEAA 3UU5A 4DNDA 3E08A 4QX8B 4YXDA 4DV3T 5HEGA 1D1CA 1UURA 5JH7E 5LHHB 4P0AA 4TV8E 2E5VA 4JI3T 2IC6A 2L9QA 5AQLB 2W63A 3ZDHA 4PJLA 4H9NC 2LSIA 4JUYA 3WTIA 2FJDA 1WLXA 3SQ9A 3QB5K 3O1HA 5ABHA 1YW0A 4AXPA 4QH5A 4DV7T 2H89A 4IIJE 4HTEA 2JMHA 5LMUT 1T98A 2N2NA 1R8IA 4YJ3E 4AQFC 2I59A 4I55E 1WR0A 1UCUA 2Y56A 3RRWA 4QXHB 4U7IA 1Z0PA 2BDEA 2A3DA 3UQ7A 2M67A 4PFOA 1YQ4A 2RPAA 3RYHE 3PE0A 4ZK4A 3LK3B 4E7ZA 1BR4A 4NXMT 1S94A 3PUXF 5JDNA 1D0ZA 1W0BA 3WTNA 2FJBA 4TV9E 2JJ9A 4LF4T 3ZDGA 4LMLA 5HXRA 1FEWA 4EAHA 3X1DA 1XZYA 1MMGA 4GKJT 4AKIA 3WTOA 2DL1A 2VVSA 4DBMA 1LKXA 5H6RB 4WNKA 2UXNB 3QB5A 2X9WA 2WNCA 3RQWA 5JRCA 4Q25A 3E22E 3RX6A 5J0ZA 4N78D 4DV6T 2FJAA 2W66A 3ZMUB 2WM9A 4HWIB 3I0OA 4JEUB 2BVLA 4YHHT 4WBOA 5JDMA 5KZUA 3RYIE 4LF6T 4HKAA 4OX9T 2FJEA 5HCJA 3RC3A 1Z8UA 2L3LA 4GYRA 5F8PA 3EDUA 4DMWA 4KUMB 5L4HA 4ZZBA 2XQYA 3SOLA 4KHZF 3MA9A 3SWHA 5FJVA 2E9XB 3AEBA 3OYZA 3CPZA 3AEEA 4TNWA 3Q5WA 1OEDE 3MK7C 2Y54A 5AFKA 3O4XE 2M6IA 3CX8B 5L3GB 3WAKA 1LRZA 2IIUA 2WQYA 3NZQA 4NZBA 3PJAJ 4PNIA 4JI8T 3FBLA 4KBMB 5AFMB 4X65T 3WTKA 5LG3A 3ZJ1A 4ILCA 4O2AE 4DBQA 3ZYMA 2IHR1 5LP6E 3PUWF 4PK5A 1MIYA 2WP9A 4U2ZA 1VOMA 3FZLB 2EHOD 4BJNA 4B5DA 3C84A 2VQFT 5BR8T 3A5XA 5EK3A 1MNDA 2PTFA 5ABFB 2XZ5A 4ZI3D 3ZJ2A 4ALXA 4X66T 3AA7B 3GWHA 3DJBA 3AE9A 5HCMA 3EVYA 2XSAA 4B3MT 3VKHA 3PUAA 4LF9T 3P7IA 1BR1A 2LRLA 2K9AA 4UELA 5HWXA 3JAEA 4CN4A 2W61A 3ZCIA 3NZPA 2Q9QA 4ZZCA 5KMGP 2MAWA 4KX6A 2LM9A 4HN9A 2LRKA 3M65A 4ISSA 1HTJF 1FIOA 1AJ3A 3QOFA 1UGOA 3OPCA 4AKGA 1MMNA 3RF1A 2KNDA 4BAYB 5F5WA 4XK9A 3VR9A 2LHRA 4H9PC 5C2TA 2NOXA 4XBFB 2XQAA 4BJMA 3T4MA 3N5LA 1UV6A 3QC9A 2D0UA 3FZKB 2HN1A 2LHNA 4JV5T 2QVAA 2CXFA 5AQRB 1GQEA 2HPJA 2D2SA 3AE4A 3MZKB 3QNUA 1DU2A 3ZSTA 4KHPT 4UVBB 4PK6A 3AEDA 2VB6A 3L09A 2B1EA 3L39A 3N9LA 4DUZT 3J7Yq 3H3AA 3OBVE 4EEDA 2YU2A 3RIAA 4K0KT 4TWHA 2DLRA 3AA1B 4YLHA 2XAJB 5AQFB 3G06A 4BA9A 2HN2A 4UV8B 1ZKEA 4YSYA 2V6XA 3HKDE 3N2OA 3F2EA 4JI7T 3N2KE 1KFYA 3IGQA 2E9XC 4ZS3A 3I1AA 3C64A 2CA5A 5AQVB 2NWBA 2V7KA 5LHGB 2IAKA 5L3CB 2VL8A 4UV9B 4EXTA 3K8PC 5L4EA 2XQ4A 5IYZE 4IT4A 4OK0A 4MHCA 3PUSA 1UK5A 5JDFA 1E7PA 4GKKT 5JVDE 1HG5A 4DV0T 3D0TA 2H7OA 1E1HB 3U8NA 4O4HE 1D0YA 2LKGA 5JMEA 4TX5A 4X5TA 5EK2A 4XZCA 2IC9A 4AKHA 2XAGB 3RKGA 4IL9A 4DIDB 2XUEA 3PUVF 2AXDS 2UU9T 4EOZB 4L9IA 4B6XA 3VRBA 5J5IA 3IBPA 5AQJB 2VKHA 5IWAT 2IW5B 2CXLA 5LBQB 2VURA 2WBLA 4NPPA 3BQKA 3PV0F 3UULA 4YTMA 3OTOT 2CWYA 3OYXA 3R84B 2RA1A 3SFEA 3T8OA 1XNRT 4JI6T 2QC1B 4U3CA 5LA6E 3KVBA 4IE6A 3N9QA 3SRZA 5JRCB 3R6NA 4X62T 2A9UA 3OKQA 5JDLA 3RQUA 5GONE 4LF5T 4TWFA 3K1SA 3W15B 1N33T 4FRRA 4NIQA 3MXZA 2WB5A 3P50A 3C4ZA 3ZMTB 2V5DA 3QK6A 2CM0A 2NR4A 5ABGA 4CQIA 3Q5EA 4ZR6A 5DABA 2W2UA 2E2AA 2V5CA 3N9PA 2EHOA 3Q5DA 2WDRA 2BS3A 4NXNT 4ZI2D 5AQNB 5CA1E 2ODUA 3P4PA 2I6HA 4L0RA 4DR2T 4U31A 5HXHA 3UUNA 1J5WA 2R6GF 2CWOA 5HEHA 3CQCB 2KWHA 3ETUA 2LOPA 4X64T 3KFWX 3WTLA 5CA0E 3GA8A 2LT3A 2C5KT 2PJQA 3V5SA 4ADZA 3SH1A 3LG7A 4EB6E 4B3RT 1UUSA 2MYSA 4AI6A 2WS3A 3K3QC 3L8RA 1U4QA 2UUCT 3FB2A 4A97A 4QH1A 4CZZB 2J62A 3LBXA 4ZOLE 4PFPA 5CB4E 2JQKA 4PJJA 2JIWA 4WZXA 2JQQA 4HWFA 3EDVA 5FMNA 5H6QB 3HI2A 2QA7A 2ES0A 3AA6B 3I0QA 4FI5A 4DR7T 1JNZA 5ETWA 3RLFF 3UUMA 3NKZA 2KZ7B 2XTLA 1YQ3A 2BG9A 3KBUA 3LSVA 1XDPA 1ZOYA 3S4UA 2X9YA 1XNQT 3PU8A 4YY3T 2Q9QB 2BYRA 5AQKB 2YN6A 4DO0A 4ZHQE 4O4JE 3VU7H 2HH7A 3UU3A 4LF7T 3BK9A 3PMZA 2J47A 4WW0A 2MPKA 5TAOA 2BBJA 4IHJE 4ZEYA 3ZMZB 2V7LA 3CVRA 5LXBA 2NP9A 3NRYA 4HGAA 2FBWA 3P4RA 3RH3A 3RKOA 2QYWA 4A98A 4DR6T 1NWMX 5LHIB 2XZEA 5KDMC 2V7MA 3O1JA 1W9RA 2X0HA 3KVAA 5AFUL 2YEVC 2NW7A 3ONLC 3CQXC 4KP3C 3SQ6A 2X68A 2A72A 3LFMA 1M7KA 3KV5A 3RPUA 2BVMA 4EV6A 2WWVA 4HWCA 2DHRA 3H37A 3EI0A 3ANWA 1HF8A 2YMEA 5KX5E 1J1JA 1QUUA 2WSSV 1N36T 3HKCE 1VRBA 3WTHA 2X9XA 4WV9A 5HXSA 3KV4A 4EIWA 5AQSB 3I9YA 5CO5A 3AE3A 5JTGA 1CHUA 3H3MA 2KXPB 4P09A 1UW6A 3AAIA 2LLYA 2OA5A 4CXXA 3UU8A 2K3WA 3CIRA 2OV9A 3CKDA 2YDSA 3Q2MA 3AE8A 3N9OA 2XAFB 3O1IA 2JPFA 5HWYA 1HNWT 4DV1T 5JR9A 5AQHB 1EZ3A 1YXRA 2CEAA 2KLQA 3JC6D 3ZYKA 1X79A 4PIRA 2YKSA 2QRXA 4TN7B 2XM1A 2PG8A 2ACXA 2BS2A 5J2TE 2BBHA 5AFJA 3TLTA 3KBTA 2V8SV 3SIOA 4P1NA 1XWMA 2C5IT 4DR5T 4AQGA 3ETVA 5L3DB 2I0MA 4Z90A 4ZI2C 2ZM8A 1L0VA 2C5JA 3BQIA 3ZLIA 1KNZA 3AE7A 5JREA 1XDOA 2XZ6A 3CX7B 4ISTA 2Y57A 5IUXA 3ZT6A 2PBIA 1ZV4X 3VHLA 2KSRA 3ZT5A 2Q9QC 3IF8B 3ZYLA 3RI5A 4U2YA 4JEHB 3NRXA 2NW9A 5AFHA 4B3TT 3FXEB 4YJ2E 3WTJA 5AQIB 1NEKA 1E2AA 4AIUA 1SA0E 3RRCA 2X00D 2L8KA 4X20E 5LBMA 3AE2A 2C0SA 2XQ7A 5AINA 3GMIA 2KMFA 5DQVA 3E0ZA 5FL1A 2CRBA 2EHOB 4QH4A 4HFBA 5HXEA 5AFLA 3WAJA 3ZC1A 2ZMAA 2RP4A 4UR9A 3SS1A 4IDZA 3UUBA 3N2GE 1OEDA 2JQ9A 5C8YE 2VK9A 3RC8A 3VRAA 5FXXA 2Z6EA 4LMKA 2LEHA 3PEOA 3OJAA 5BW2A 4ILUA 3FXDB 3ONJA 3RYFE 3P8CD 4QXBB 5L3BB 5HXCA 2IDOB 3PUQA 4EGWA 1LVKA 3JADA 2XYSA 1HS7A 2Y58A 5J5HA 1I9BA 1W0AA 1Y01A 4P0BA 5SYOA 3VKGA 1US7B 3ESLA 3LBXB 5J2UE 1JNRA 2W67A 2CE7A 4DR1T 2XNVA 5F3JA 2IUBA 3TLVA 5FXWA 1T7SA 3CX6B 5DJQC 5FY7A 2WU5A 4UVAB 4UM3P 3KDSE 5AQGB 1UX2A 2NTYA 3Q9DA 2W00A 3DTOA 1WR6A 2BS4A 5AQOB 2BG9B 5FNVE 3NWIA 4IE4A 4A56A 5HEOA 1OWAA 4CXYA 4PJMA 4MFRA 3HA4A 1OXZA 3VR8A 1G8XA 4MLKA 4AFTA 2UXCT 1FMWA 5L3EB 3LK2B 4EEBA 2LM2A 3AEGA 4FJOA 4PK4A 1D1BA 4YTNA 3PDYA 5FXZA 4LFCT 2DWKA 1MIWA 2XASB 5C3JA 5LJMA 4IREA 4GK5E 2YDRA 3HL6A 3AE6A 4DR3T 5BRXA 4V1Av 4DR4T 4LFBT 2BKOA 3NBXX 3ONXA 3AXJA 3AB3B 3RIUA 4PJNA 1NAFA 4YT0A 2C9TA 4QX7B 4DUYT 3U8MA 1U5PA 3UFEA 3K3OA 3L3PA 2ODVA 4C91A 5FY1A 5JQGE
chains in the Genus database with same CATH topology
2M6IA 4QABA 4WV9A 4ZR6A 3RI5A 3U8KA 3UQ7A 3WIPA 2ZJUA 2BR8A 4UY2A 5AFHA 4NZBA 5L4EA 3JAFA 2BYRA 4XK9A 2XQ4A 2YN6A 3UU6A 2WZYA 2VL0A 2BG9C 4HFCA 4TNVA 5HEJA 2BYQA 2ZJVA 4UM3P 5CO5A 4ZK4A 3WTJA 4BFQA 2Y7YA 3UU3A 1UX2A 4IL4A 3C79A 3PMZA 4AFHA 5AFMB 2YOEA 2XQAA 4QACA 4ZJTA 3TLWA 2XQ6A 4UM3A 2X00D 3RIFA 3T4MA 2BG9B 4EZ1A 1UV6A 2YMDA 2XQ7A 5AINA 4ZRUA 3WTKA 3WTNA 5LG3A 3UU4A 1UW6A 4ILCA 2LLYA 4F8HA 2W8FA 4UM1A 3U8JA 4TWDA 4HFEA 2XQ8A 3UU8A 5J5FA 5KE4A 3U8NA 5J5GA 4HFDA 2W8GA 5LXBA 2BJ0A 5HEOA 5HEHA 3ZDGA 4Z91A 4LMLA 2LKGA 4ZK1A 5JMEA 4X5TA 5HEUA 4HFHA 3WTMA 4QH4A 4B5DA 4HFBA 3C84A 4IL9A 4A98A 4AFTA 5AFNA 2BG9E 3WTLA 2WN9A 3UQ4A 5AFLA 3UU5A 5J5IA 3RHWA 3WTOA 4HFIA 4DBMA 2LM2A 2BYNA 2WNJA 3SH1A 2WNCA 3RQWA 3UUBA 5HEGA 2PH9A 2XZ5A 1OEDA 4D01A 3TLSA 5J0ZA 4UXUA 4ILBA 4NPPA 3TLUA 2M6BA 4COFA 4XHEA 4ALXA 4LMKA 3EAMA 3P4WA 4A97A 4QH1A 2XQ3A 2XNTA 3GUAA 3PEOA 2YKSA 3RIAA 4PIRA 4TWHA 5BW2A 4UM3S 4IREA 2XNUA 5HCMA 2XYTA 3ZDHA 3SQ6A 4HQPA 2UZ6A 3JADA 1OEDC 5KZUA 2LKHA 2XYSA 5BRXA 5AFJA 3TLTA 2QC1B 5CFBA 3WTIA 3SQ9A 3SIOA 4AFGA 5HCJA 2Y58A 2XQ5A 3JAEA 4BQTA 5J5HA 4Z90A 4QH5A 3ZKRA 1I9BA 3EHZA 2BR7A 1OEDB 2PGZA 5BP0A 2XQ9A 4QAAA 3EI0A 2C9TA 4ZJSA 3IGQA 5TVCA 2YMEA 4ZZCA 5L4HA 4ZZBA 2WNLA 2XZ6A 3RQUA 5SYOA 2MAWA 3U8LA 2BYSA 2BYPA 4TWFA 5L47A 2Y57A 5AFMA 5FJVA 5IUXA 4FRRA 3U8MA 2X00A 2BG9A 3P50A 4LMJA 2KSRA 3LSVA 2XNVA 4TNWA 2Y56A 1OEDE 4ILAA 3WTHA 3TLVA 2Y54A 5AFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6I A;  4QAB A;  4WV9 A;  4ZR6 A;  3RI5 A;  3U8K A;  3UQ7 A;  3WIP A;  2ZJU A;  2BR8 A;  4UY2 A;  5AFH A;  4NZB A;  5L4E A;  3JAF A;  2BYR A;  4XK9 A;  2XQ4 A;  2YN6 A;  3UU6 A;  2WZY A;  2VL0 A;  2BG9 C;  4HFC A;  4TNV A;  5HEJ A;  2BYQ A;  2ZJV A;  4UM3 P;  5CO5 A;  4ZK4 A;  3WTJ A;  4BFQ A;  2Y7Y A;  3UU3 A;  1UX2 A;  4IL4 A;  3C79 A;  3PMZ A;  4AFH A;  5AFM B;  2YOE A;  2XQA A;  4QAC A;  4ZJT A;  3TLW A;  2XQ6 A;  4UM3 A;  2X00 D;  3RIF A;  3T4M A;  2BG9 B;  4EZ1 A;  1UV6 A;  2YMD A;  2XQ7 A;  5AIN A;  4ZRU A;  3WTK A;  3WTN A;  5LG3 A;  3UU4 A;  1UW6 A;  4ILC A;  2LLY A;  4F8H A;  2W8F A;  4UM1 A;  3U8J A;  4TWD A;  4HFE A;  2XQ8 A;  3UU8 A;  5J5F A;  5KE4 A;  3U8N A;  5J5G A;  4HFD A;  2W8G A;  5LXB A;  2BJ0 A;  5HEO A;  5HEH A;  3ZDG A;  4Z91 A;  4LML A;  2LKG A;  4ZK1 A;  5JME A;  4X5T A;  5HEU A;  4HFH A;  3WTM A;  4QH4 A;  4B5D A;  4HFB A;  3C84 A;  4IL9 A;  4A98 A;  4AFT A;  5AFN A;  2BG9 E;  3WTL A;  2WN9 A;  3UQ4 A;  5AFL A;  3UU5 A;  5J5I A;  3RHW A;  3WTO A;  4HFI A;  4DBM A;  2LM2 A;  2BYN A;  2WNJ A;  3SH1 A;  2WNC A;  3RQW A;  3UUB A;  5HEG A;  2PH9 A;  2XZ5 A;  1OED A;  4D01 A;  3TLS A;  5J0Z A;  4UXU A;  4ILB A;  4NPP A;  3TLU A;  2M6B A;  4COF A;  4XHE A;  4ALX A;  4LMK A;  3EAM A;  3P4W A;  4A97 A;  4QH1 A;  2XQ3 A;  2XNT A;  3GUA A;  3PEO A;  2YKS A;  3RIA A;  4PIR A;  4TWH A;  5BW2 A;  4UM3 S;  4IRE A;  2XNU A;  5HCM A;  2XYT A;  3ZDH A;  3SQ6 A;  4HQP A;  2UZ6 A;  3JAD A;  1OED C;  5KZU A;  2LKH A;  2XYS A;  5BRX A;  5AFJ A;  3TLT A;  2QC1 B;  5CFB A;  3WTI A;  3SQ9 A;  3SIO A;  4AFG A;  5HCJ A;  2Y58 A;  2XQ5 A;  3JAE A;  4BQT A;  5J5H A;  4Z90 A;  4QH5 A;  3ZKR A;  1I9B A;  3EHZ A;  2BR7 A;  1OED B;  2PGZ A;  5BP0 A;  2XQ9 A;  4QAA A;  3EI0 A;  2C9T A;  4ZJS A;  3IGQ A;  5TVC A;  2YME A;  4ZZC A;  5L4H A;  4ZZB A;  2WNL A;  2XZ6 A;  3RQU A;  5SYO A;  2MAW A;  3U8L A;  2BYS A;  2BYP A;  4TWF A;  5L47 A;  2Y57 A;  5AFM A;  5FJV A;  5IUX A;  4FRR A;  3U8M A;  2X00 A;  2BG9 A;  3P50 A;  4LMJ A;  2KSR A;  3LSV A;  2XNV A;  4TNW A;  2Y56 A;  1OED E;  4ILA A;  3WTH A;  3TLV A;  2Y54 A;  5AFK A; 
#chains in the Genus database with same CATH topology
 3IA3 A;  1QLB A;  3ANW B;  5JDH A;  2W62 A;  4MBQ A;  2MOZ A;  4HFC A;  5HEJ A;  3J9X 1;  2VKO A;  5LGN B;  2Y7Y A;  3RIF A;  3UFG A;  4F8H A;  1WRD A;  1XMQ T;  2EHO C;  1FJG T;  1G73 A;  2VWA A;  4O4I E;  3QUJ A;  2MTQ A;  4PAG A;  3BQL A;  5HAX A;  5HEU A;  4YTP A;  2VKD A;  4UEM A;  5AFN A;  5FVK A;  2WDQ A;  3RHW A;  3FBZ A;  5CGM A;  2G0U A;  2JMK A;  4ZI3 C;  1O3X A;  1T8B A;  4KI0 F;  2V7J A;  4D01 A;  5LNK A;  2D9D A;  2D0T A;  4ILB A;  3P4S A;  4OHF A;  2MBG A;  4COF A;  3PTR B;  4CI2 B;  1M62 A;  1MMD A;  2XSB A;  2CCQ A;  4F6R C;  4ANJ A;  2X9H A;  2XNU A;  1YD8 G;  2AE9 A;  3B57 A;  4IE7 A;  2BKN A;  4JI5 T;  3CQG B;  3LJC A;  4AFG A;  3UTK A;  5LXT E;  4JI0 T;  1T72 A;  2ZM2 A;  2XQ9 A;  5LOV E;  3RGL A;  4ZXL A;  2WNL A;  3ZN0 B;  4I50 E;  4OYK A;  4WBN E;  4MAL A;  3ZMV B;  1SUM B;  2X00 A;  1QSD A;  2K48 A;  4QWN B;  2ZJU A;  2NTX A;  2XJ7 A;  2JRK A;  3UU6 A;  2VL0 A;  2BG9 C;  2WAU A;  2J1D G;  5M4Y A;  1I6Z A;  3C79 A;  4AIS A;  1HNZ T;  4ZJT A;  3TLW A;  3ZPO A;  3UU4 A;  2UUB T;  3U8J A;  3JCF A;  2QGS A;  4E7S A;  2ACZ A;  5EK4 A;  2WMO A;  1D0X A;  3U78 A;  3A8Y C;  4ZK1 A;  4DV5 T;  5HYA A;  2N1G A;  3T1H T;  2BZB A;  2UXB T;  3AE1 A;  2OLT A;  4IE0 A;  3UQ4 A;  1BR2 A;  1WFD A;  2ZM6 T;  4QHO A;  4H9R C;  2PH9 A;  3ABV A;  4XHE A;  4HFV A;  4CN1 A;  3FZH B;  2XNT A;  3GUA A;  3AEF A;  1FMV A;  4CN6 A;  4OYJ A;  1SE7 A;  4HQP A;  3IEE A;  4I4T E;  2LE8 A;  2LSJ A;  4DMV A;  2LSG A;  4AQF A;  1IJ6 A;  2WMN A;  4QKN A;  4M1P A;  1OED B;  2PGZ A;  5BP0 A;  2WZI A;  2E8I A;  4QAA A;  2H88 A;  2HHH T;  5JDG A;  3MKD A;  2PFV A;  5LG4 A;  5AQM B;  3F57 A;  2DCF A;  1S35 A;  2E9X D;  2YIN A;  2B76 A;  4CXW A;  3K3N A;  2K5B B;  2V7I A;  2ZLY A;  3U3I A;  2XY8 B;  2V6Y A;  2NW8 A;  3NVO A;  1IAP A;  4WYV A;  5LYJ E;  2Y6X A;  2CLY B;  4I43 B;  2XPK A;  4NUU A;  4LF8 T;  3FZM B;  3AEA A;  2VVN A;  4H9Q C;  4HWH A;  2E5L T;  3AVR A;  4PW8 A;  1B7T A;  4O2B E;  4EYY R;  4DV4 T;  4TWD A;  3TKL B;  3GN5 A;  4GYS A;  5EZY E;  4HFH A;  3ZC0 A;  4X1Y E;  2CPT A;  4IDO A;  5FXV A;  5L3F B;  1ZEE A;  1KEY A;  1MIV A;  4EYU A;  5LJN A;  4UXN B;  4JI4 T;  3TLS A;  4Z8X A;  3PUZ F;  4ZI7 E;  4UXU A;  3TLU A;  3EAM A;  4ASK A;  5JR9 C;  1IBM T;  4H63 V;  2DNX A;  4HWD A;  2CHO A;  3ZCJ A;  5AQQ B;  2LOS A;  1YKH B;  3M3Z B;  4CI3 B;  3KV9 A;  1HX8 A;  3AA0 B;  4UVC B;  5IHY A;  3EHZ A;  3DP7 A;  2XAH B;  4DBR A;  4ZJS A;  5TVC A;  5ADX L;  2BYS A;  4G2A A;  2FUP A;  3ZEF B;  4EZH A;  4KMC A;  3EUH A;  2F4V T;  4A5X A;  3A7M A;  4UF0 A;  3AXJ B;  3I9W A;  3AAE B;  2X0Y A;  2BR8 A;  4K0U A;  3AEC A;  4U33 A;  2SPC A;  4AKR B;  4OFZ A;  4X1I E;  3EAB A;  4IE5 A;  2X67 A;  3Q5X A;  4ZRU A;  1IZN B;  4HFE A;  5KE4 A;  2V26 A;  3C50 A;  1HG2 A;  1WYC A;  2VQE T;  3SFD A;  4C90 A;  2K24 A;  2N9D A;  4JI1 T;  5LB7 B;  2CBI A;  1HNX T;  2H7V C;  1MNE A;  1W09 A;  1HCI A;  2WNJ A;  3T1Y T;  4DV2 T;  1CUN A;  3PUG A;  2KT9 A;  3LDQ B;  4I0U A;  3N9M A;  3P4W A;  4UM3 S;  2WU2 A;  3UUX B;  2UZ6 A;  1OED C;  4LFA T;  4YSZ A;  2VKJ A;  4BQT A;  4JYA T;  4GK0 E;  4H9S E;  4CI1 B;  2VAS A;  2BKP A;  4YSX A;  4O8S A;  5FKY A;  5L47 A;  3P4Q A;  2D5U A;  5FP3 A;  2A2F X;  3C98 B;  3FZF B;  2LSY A;  2CLY C;  1IJ5 A;  3RYC E;  2ZJV A;  4TNV A;  3N9N A;  2IML A;  4AFH A;  4ZS2 A;  4QAC A;  4YHJ A;  5FYM A;  2KWI B;  4UM3 A;  5KXJ A;  3ZN1 B;  2W4X A;  2UXD T;  2DI4 A;  1X9B A;  2KIN B;  2X66 A;  4HFD A;  2X0L B;  5DQW A;  2BJ0 A;  1J5E T;  3AE5 A;  2LJL A;  3HKB E;  3B13 A;  3WI3 A;  2WZH A;  4IDN A;  3O9X A;  2Y8D A;  4GIW A;  3C4W A;  3ZT7 A;  5FL0 A;  4HFI A;  1HR0 T;  3MAC A;  1N32 T;  2Y48 B;  4HE8 A;  4U7Y A;  1VCS A;  1XMO T;  3AVS A;  2GK9 A;  3KIN B;  2XQ3 A;  4U72 A;  5FY0 A;  2WCA A;  4TZ4 C;  2J4G A;  1D1A A;  2E9X A;  5L2L A;  4XAX B;  2JQH A;  2LKH A;  2CHN A;  3OVU A;  4YFS A;  5CFB A;  4IDP A;  4L5G A;  4H9O C;  3LK4 2;  3ZKR A;  5FVL A;  2BR7 A;  3UT5 E;  2P9B A;  5LGT B;  2H3R A;  4O4L E;  2BYP A;  4ERR A;  5AFM A;  3IHR A;  5JDQ A;  3RIU C;  4LMJ A;  4H63 H;  2CMR A;  4ILA A;  5A1L A;  5E0O A;  4U74 A;  1I94 T;  1WYB A;  2UXX B;  1Y64 B;  4UY2 A;  2CBJ A;  3JAF A;  2WZY A;  4JLE A;  4IL4 A;  1ZP0 A;  4AQY T;  2XQ6 A;  3PUY F;  2WDV A;  3PJA A;  4X1K E;  2YMD A;  5CJ5 A;  3AAA B;  5J5F A;  5ABF A;  1N34 T;  3C4X A;  4Z91 A;  3CML A;  4IDQ A;  2V6Y B;  4J2C A;  3CWZ B;  2BG9 E;  1UX5 A;  2WN9 A;  2ZM0 A;  4B3S T;  2YK0 A;  4UIG A;  3JC6 C;  2BYN A;  1YKE B;  2XHE B;  3CK6 A;  4DVD A;  3GN5 B;  2M6B A;  5LCY A;  1BR0 A;  1V9D A;  3ZMS B;  4TUY E;  4AKL A;  3F31 A;  2XYT A;  1KK7 A;  4NUV A;  2YU1 A;  1KF6 A;  5LGU B;  5LMN T;  2YDQ A;  3PUR A;  2XAQ B;  1WCR A;  1HX1 B;  2W0G A;  1ZHC A;  2XQ5 A;  1UX4 A;  3B5M A;  1IBL T;  1HFA A;  5AQP B;  4JI2 T;  3ZSS A;  2LSK A;  3U8L A;  3KV6 A;  4JBW F;  1VCT A;  2WY2 A;  2V1D B;  1MMA A;  2X51 A;  2HPL A;  1NEN A;  5BMV E;  5JR9 B;  3PU3 A;  4BFQ A;  1KNP A;  5ABE A;  4QAB A;  3U8K A;  5AQT B;  3C51 A;  3WIP A;  3FHN A;  2WWU A;  4G63 A;  2Q9Q D;  2BYQ A;  4EZ4 A;  3HKE E;  4QXC B;  2YOE A;  1LVF A;  3MJX A;  1SHZ C;  4EZ1 A;  2UUA T;  4UF0 B;  2W8F A;  4UM1 A;  1IBK T;  2XQ8 A;  5J5G A;  3V5U A;  2W8G A;  4IGU A;  2DWG A;  2CXD A;  5J1G A;  2XM2 A;  1KNR A;  5AQU B;  3WTM A;  1H7C A;  3HR0 A;  4GOU A;  4HEA A;  3UU5 A;  4DND A;  3E08 A;  4QX8 B;  4YXD A;  4DV3 T;  5HEG A;  1D1C A;  1UUR A;  5JH7 E;  5LHH B;  4P0A A;  4TV8 E;  2E5V A;  4JI3 T;  2IC6 A;  2L9Q A;  5AQL B;  2W63 A;  3ZDH A;  4PJL A;  4H9N C;  2LSI A;  4JUY A;  3WTI A;  2FJD A;  1WLX A;  3SQ9 A;  3QB5 K;  3O1H A;  5ABH A;  1YW0 A;  4AXP A;  4QH5 A;  4DV7 T;  2H89 A;  4IIJ E;  4HTE A;  2JMH A;  5LMU T;  1T98 A;  2N2N A;  1R8I A;  4YJ3 E;  4AQF C;  2I59 A;  4I55 E;  1WR0 A;  1UCU A;  2Y56 A;  3RRW A;  4QXH B;  4U7I A;  1Z0P A;  2BDE A;  2A3D A;  3UQ7 A;  2M67 A;  4PFO A;  1YQ4 A;  2RPA A;  3RYH E;  3PE0 A;  4ZK4 A;  3LK3 B;  4E7Z A;  1BR4 A;  4NXM T;  1S94 A;  3PUX F;  5JDN A;  1D0Z A;  1W0B A;  3WTN A;  2FJB A;  4TV9 E;  2JJ9 A;  4LF4 T;  3ZDG A;  4LML A;  5HXR A;  1FEW A;  4EAH A;  3X1D A;  1XZY A;  1MMG A;  4GKJ T;  4AKI A;  3WTO A;  2DL1 A;  2VVS A;  4DBM A;  1LKX A;  5H6R B;  4WNK A;  2UXN B;  3QB5 A;  2X9W A;  2WNC A;  3RQW A;  5JRC A;  4Q25 A;  3E22 E;  3RX6 A;  5J0Z A;  4N78 D;  4DV6 T;  2FJA A;  2W66 A;  3ZMU B;  2WM9 A;  4HWI B;  3I0O A;  4JEU B;  2BVL A;  4YHH T;  4WBO A;  5JDM A;  5KZU A;  3RYI E;  4LF6 T;  4HKA A;  4OX9 T;  2FJE A;  5HCJ A;  3RC3 A;  1Z8U A;  2L3L A;  4GYR A;  5F8P A;  3EDU A;  4DMW A;  4KUM B;  5L4H A;  4ZZB A;  2XQY A;  3SOL A;  4KHZ F;  3MA9 A;  3SWH A;  5FJV A;  2E9X B;  3AEB A;  3OYZ A;  3CPZ A;  3AEE A;  4TNW A;  3Q5W A;  1OED E;  3MK7 C;  2Y54 A;  5AFK A;  3O4X E;  2M6I A;  3CX8 B;  5L3G B;  3WAK A;  1LRZ A;  2IIU A;  2WQY A;  3NZQ A;  4NZB A;  3PJA J;  4PNI A;  4JI8 T;  3FBL A;  4KBM B;  5AFM B;  4X65 T;  3WTK A;  5LG3 A;  3ZJ1 A;  4ILC A;  4O2A E;  4DBQ A;  3ZYM A;  2IHR 1;  5LP6 E;  3PUW F;  4PK5 A;  1MIY A;  2WP9 A;  4U2Z A;  1VOM A;  3FZL B;  2EHO D;  4BJN A;  4B5D A;  3C84 A;  2VQF T;  5BR8 T;  3A5X A;  5EK3 A;  1MND A;  2PTF A;  5ABF B;  2XZ5 A;  4ZI3 D;  3ZJ2 A;  4ALX A;  4X66 T;  3AA7 B;  3GWH A;  3DJB A;  3AE9 A;  5HCM A;  3EVY A;  2XSA A;  4B3M T;  3VKH A;  3PUA A;  4LF9 T;  3P7I A;  1BR1 A;  2LRL A;  2K9A A;  4UEL A;  5HWX A;  3JAE A;  4CN4 A;  2W61 A;  3ZCI A;  3NZP A;  2Q9Q A;  4ZZC A;  5KMG P;  2MAW A;  4KX6 A;  2LM9 A;  4HN9 A;  2LRK A;  3M65 A;  4ISS A;  1HTJ F;  1FIO A;  1AJ3 A;  3QOF A;  1UGO A;  3OPC A;  4AKG A;  1MMN A;  3RF1 A;  2KND A;  4BAY B;  5F5W A;  4XK9 A;  3VR9 A;  2LHR A;  4H9P C;  5C2T A;  2NOX A;  4XBF B;  2XQA A;  4BJM A;  3T4M A;  3N5L A;  1UV6 A;  3QC9 A;  2D0U A;  3FZK B;  2HN1 A;  2LHN A;  4JV5 T;  2QVA A;  2CXF A;  5AQR B;  1GQE A;  2HPJ A;  2D2S A;  3AE4 A;  3MZK B;  3QNU A;  1DU2 A;  3ZST A;  4KHP T;  4UVB B;  4PK6 A;  3AED A;  2VB6 A;  3L09 A;  2B1E A;  3L39 A;  3N9L A;  4DUZ T;  3J7Y q;  3H3A A;  3OBV E;  4EED A;  2YU2 A;  3RIA A;  4K0K T;  4TWH A;  2DLR A;  3AA1 B;  4YLH A;  2XAJ B;  5AQF B;  3G06 A;  4BA9 A;  2HN2 A;  4UV8 B;  1ZKE A;  4YSY A;  2V6X A;  3HKD E;  3N2O A;  3F2E A;  4JI7 T;  3N2K E;  1KFY A;  3IGQ A;  2E9X C;  4ZS3 A;  3I1A A;  3C64 A;  2CA5 A;  5AQV B;  2NWB A;  2V7K A;  5LHG B;  2IAK A;  5L3C B;  2VL8 A;  4UV9 B;  4EXT A;  3K8P C;  5L4E A;  2XQ4 A;  5IYZ E;  4IT4 A;  4OK0 A;  4MHC A;  3PUS A;  1UK5 A;  5JDF A;  1E7P A;  4GKK T;  5JVD E;  1HG5 A;  4DV0 T;  3D0T A;  2H7O A;  1E1H B;  3U8N A;  4O4H E;  1D0Y A;  2LKG A;  5JME A;  4TX5 A;  4X5T A;  5EK2 A;  4XZC A;  2IC9 A;  4AKH A;  2XAG B;  3RKG A;  4IL9 A;  4DID B;  2XUE A;  3PUV F;  2AXD S;  2UU9 T;  4EOZ B;  4L9I A;  4B6X A;  3VRB A;  5J5I A;  3IBP A;  5AQJ B;  2VKH A;  5IWA T;  2IW5 B;  2CXL A;  5LBQ B;  2VUR A;  2WBL A;  4NPP A;  3BQK A;  3PV0 F;  3UUL A;  4YTM A;  3OTO T;  2CWY A;  3OYX A;  3R84 B;  2RA1 A;  3SFE A;  3T8O A;  1XNR T;  4JI6 T;  2QC1 B;  4U3C A;  5LA6 E;  3KVB A;  4IE6 A;  3N9Q A;  3SRZ A;  5JRC B;  3R6N A;  4X62 T;  2A9U A;  3OKQ A;  5JDL A;  3RQU A;  5GON E;  4LF5 T;  4TWF A;  3K1S A;  3W15 B;  1N33 T;  4FRR A;  4NIQ A;  3MXZ A;  2WB5 A;  3P50 A;  3C4Z A;  3ZMT B;  2V5D A;  3QK6 A;  2CM0 A;  2NR4 A;  5ABG A;  4CQI A;  3Q5E A;  4ZR6 A;  5DAB A;  2W2U A;  2E2A A;  2V5C A;  3N9P A;  2EHO A;  3Q5D A;  2WDR A;  2BS3 A;  4NXN T;  4ZI2 D;  5AQN B;  5CA1 E;  2ODU A;  3P4P A;  2I6H A;  4L0R A;  4DR2 T;  4U31 A;  5HXH A;  3UUN A;  1J5W A;  2R6G F;  2CWO A;  5HEH A;  3CQC B;  2KWH A;  3ETU A;  2LOP A;  4X64 T;  3KFW X;  3WTL A;  5CA0 E;  3GA8 A;  2LT3 A;  2C5K T;  2PJQ A;  3V5S A;  4ADZ A;  3SH1 A;  3LG7 A;  4EB6 E;  4B3R T;  1UUS A;  2MYS A;  4AI6 A;  2WS3 A;  3K3Q C;  3L8R A;  1U4Q A;  2UUC T;  3FB2 A;  4A97 A;  4QH1 A;  4CZZ B;  2J62 A;  3LBX A;  4ZOL E;  4PFP A;  5CB4 E;  2JQK A;  4PJJ A;  2JIW A;  4WZX A;  2JQQ A;  4HWF A;  3EDV A;  5FMN A;  5H6Q B;  3HI2 A;  2QA7 A;  2ES0 A;  3AA6 B;  3I0Q A;  4FI5 A;  4DR7 T;  1JNZ A;  5ETW A;  3RLF F;  3UUM A;  3NKZ A;  2KZ7 B;  2XTL A;  1YQ3 A;  2BG9 A;  3KBU A;  3LSV A;  1XDP A;  1ZOY A;  3S4U A;  2X9Y A;  1XNQ T;  3PU8 A;  4YY3 T;  2Q9Q B;  2BYR A;  5AQK B;  2YN6 A;  4DO0 A;  4ZHQ E;  4O4J E;  3VU7 H;  2HH7 A;  3UU3 A;  4LF7 T;  3BK9 A;  3PMZ A;  2J47 A;  4WW0 A;  2MPK A;  5TAO A;  2BBJ A;  4IHJ E;  4ZEY A;  3ZMZ B;  2V7L A;  3CVR A;  5LXB A;  2NP9 A;  3NRY A;  4HGA A;  2FBW A;  3P4R A;  3RH3 A;  3RKO A;  2QYW A;  4A98 A;  4DR6 T;  1NWM X;  5LHI B;  2XZE A;  5KDM C;  2V7M A;  3O1J A;  1W9R A;  2X0H A;  3KVA A;  5AFU L;  2YEV C;  2NW7 A;  3ONL C;  3CQX C;  4KP3 C;  3SQ6 A;  2X68 A;  2A72 A;  3LFM A;  1M7K A;  3KV5 A;  3RPU A;  2BVM A;  4EV6 A;  2WWV A;  4HWC A;  2DHR A;  3H37 A;  3EI0 A;  3ANW A;  1HF8 A;  2YME A;  5KX5 E;  1J1J A;  1QUU A;  2WSS V;  1N36 T;  3HKC E;  1VRB A;  3WTH A;  2X9X A;  4WV9 A;  5HXS A;  3KV4 A;  4EIW A;  5AQS B;  3I9Y A;  5CO5 A;  3AE3 A;  5JTG A;  1CHU A;  3H3M A;  2KXP B;  4P09 A;  1UW6 A;  3AAI A;  2LLY A;  2OA5 A;  4CXX A;  3UU8 A;  2K3W A;  3CIR A;  2OV9 A;  3CKD A;  2YDS A;  3Q2M A;  3AE8 A;  3N9O A;  2XAF B;  3O1I A;  2JPF A;  5HWY A;  1HNW T;  4DV1 T;  5JR9 A;  5AQH B;  1EZ3 A;  1YXR A;  2CEA A;  2KLQ A;  3JC6 D;  3ZYK A;  1X79 A;  4PIR A;  2YKS A;  2QRX A;  4TN7 B;  2XM1 A;  2PG8 A;  2ACX A;  2BS2 A;  5J2T E;  2BBH A;  5AFJ A;  3TLT A;  3KBT A;  2V8S V;  3SIO A;  4P1N A;  1XWM A;  2C5I T;  4DR5 T;  4AQG A;  3ETV A;  5L3D B;  2I0M A;  4Z90 A;  4ZI2 C;  2ZM8 A;  1L0V A;  2C5J A;  3BQI A;  3ZLI A;  1KNZ A;  3AE7 A;  5JRE A;  1XDO A;  2XZ6 A;  3CX7 B;  4IST A;  2Y57 A;  5IUX A;  3ZT6 A;  2PBI A;  1ZV4 X;  3VHL A;  2KSR A;  3ZT5 A;  2Q9Q C;  3IF8 B;  3ZYL A;  3RI5 A;  4U2Y A;  4JEH B;  3NRX A;  2NW9 A;  5AFH A;  4B3T T;  3FXE B;  4YJ2 E;  3WTJ A;  5AQI B;  1NEK A;  1E2A A;  4AIU A;  1SA0 E;  3RRC A;  2X00 D;  2L8K A;  4X20 E;  5LBM A;  3AE2 A;  2C0S A;  2XQ7 A;  5AIN A;  3GMI A;  2KMF A;  5DQV A;  3E0Z A;  5FL1 A;  2CRB A;  2EHO B;  4QH4 A;  4HFB A;  5HXE A;  5AFL A;  3WAJ A;  3ZC1 A;  2ZMA A;  2RP4 A;  4UR9 A;  3SS1 A;  4IDZ A;  3UUB A;  3N2G E;  1OED A;  2JQ9 A;  5C8Y E;  2VK9 A;  3RC8 A;  3VRA A;  5FXX A;  2Z6E A;  4LMK A;  2LEH A;  3PEO A;  3OJA A;  5BW2 A;  4ILU A;  3FXD B;  3ONJ A;  3RYF E;  3P8C D;  4QXB B;  5L3B B;  5HXC A;  2IDO B;  3PUQ A;  4EGW A;  1LVK A;  3JAD A;  2XYS A;  1HS7 A;  2Y58 A;  5J5H A;  1I9B A;  1W0A A;  1Y01 A;  4P0B A;  5SYO A;  3VKG A;  1US7 B;  3ESL A;  3LBX B;  5J2U E;  1JNR A;  2W67 A;  2CE7 A;  4DR1 T;  2XNV A;  5F3J A;  2IUB A;  3TLV A;  5FXW A;  1T7S A;  3CX6 B;  5DJQ C;  5FY7 A;  2WU5 A;  4UVA B;  4UM3 P;  3KDS E;  5AQG B;  1UX2 A;  2NTY A;  3Q9D A;  2W00 A;  3DTO A;  1WR6 A;  2BS4 A;  5AQO B;  2BG9 B;  5FNV E;  3NWI A;  4IE4 A;  4A56 A;  5HEO A;  1OWA A;  4CXY A;  4PJM A;  4MFR A;  3HA4 A;  1OXZ A;  3VR8 A;  1G8X A;  4MLK A;  4AFT A;  2UXC T;  1FMW A;  5L3E B;  3LK2 B;  4EEB A;  2LM2 A;  3AEG A;  4FJO A;  4PK4 A;  1D1B A;  4YTN A;  3PDY A;  5FXZ A;  4LFC T;  2DWK A;  1MIW A;  2XAS B;  5C3J A;  5LJM A;  4IRE A;  4GK5 E;  2YDR A;  3HL6 A;  3AE6 A;  4DR3 T;  5BRX A;  4V1A v;  4DR4 T;  4LFB T;  2BKO A;  3NBX X;  3ONX A;  3AXJ A;  3AB3 B;  3RIU A;  4PJN A;  1NAF A;  4YT0 A;  2C9T A;  4QX7 B;  4DUY T;  3U8M A;  1U5P A;  3UFE A;  3K3O A;  3L3P A;  2ODV A;  4C91 A;  5FY1 A;  5JQG E; 
#chains in the Genus database with same CATH homology
 2M6I A;  4QAB A;  4WV9 A;  4ZR6 A;  3RI5 A;  3U8K A;  3UQ7 A;  3WIP A;  2ZJU A;  2BR8 A;  4UY2 A;  5AFH A;  4NZB A;  5L4E A;  3JAF A;  2BYR A;  4XK9 A;  2XQ4 A;  2YN6 A;  3UU6 A;  2WZY A;  2VL0 A;  2BG9 C;  4HFC A;  4TNV A;  5HEJ A;  2BYQ A;  2ZJV A;  4UM3 P;  5CO5 A;  4ZK4 A;  3WTJ A;  4BFQ A;  2Y7Y A;  3UU3 A;  1UX2 A;  4IL4 A;  3C79 A;  3PMZ A;  4AFH A;  5AFM B;  2YOE A;  2XQA A;  4QAC A;  4ZJT A;  3TLW A;  2XQ6 A;  4UM3 A;  2X00 D;  3RIF A;  3T4M A;  2BG9 B;  4EZ1 A;  1UV6 A;  2YMD A;  2XQ7 A;  5AIN A;  4ZRU A;  3WTK A;  3WTN A;  5LG3 A;  3UU4 A;  1UW6 A;  4ILC A;  2LLY A;  4F8H A;  2W8F A;  4UM1 A;  3U8J A;  4TWD A;  4HFE A;  2XQ8 A;  3UU8 A;  5J5F A;  5KE4 A;  3U8N A;  5J5G A;  4HFD A;  2W8G A;  5LXB A;  2BJ0 A;  5HEO A;  5HEH A;  3ZDG A;  4Z91 A;  4LML A;  2LKG A;  4ZK1 A;  5JME A;  4X5T A;  5HEU A;  4HFH A;  3WTM A;  4QH4 A;  4B5D A;  4HFB A;  3C84 A;  4IL9 A;  4A98 A;  4AFT A;  5AFN A;  2BG9 E;  3WTL A;  2WN9 A;  3UQ4 A;  5AFL A;  3UU5 A;  5J5I A;  3RHW A;  3WTO A;  4HFI A;  4DBM A;  2LM2 A;  2BYN A;  2WNJ A;  3SH1 A;  2WNC A;  3RQW A;  3UUB A;  5HEG A;  2PH9 A;  2XZ5 A;  1OED A;  4D01 A;  3TLS A;  5J0Z A;  4UXU A;  4ILB A;  4NPP A;  3TLU A;  2M6B A;  4COF A;  4XHE A;  4ALX A;  4LMK A;  3EAM A;  3P4W A;  4A97 A;  4QH1 A;  2XQ3 A;  2XNT A;  3GUA A;  3PEO A;  2YKS A;  3RIA A;  4PIR A;  4TWH A;  5BW2 A;  4UM3 S;  4IRE A;  2XNU A;  5HCM A;  2XYT A;  3ZDH A;  3SQ6 A;  4HQP A;  2UZ6 A;  3JAD A;  1OED C;  5KZU A;  2LKH A;  2XYS A;  5BRX A;  5AFJ A;  3TLT A;  2QC1 B;  5CFB A;  3WTI A;  3SQ9 A;  3SIO A;  4AFG A;  5HCJ A;  2Y58 A;  2XQ5 A;  3JAE A;  4BQT A;  5J5H A;  4Z90 A;  4QH5 A;  3ZKR A;  1I9B A;  3EHZ A;  2BR7 A;  1OED B;  2PGZ A;  5BP0 A;  2XQ9 A;  4QAA A;  3EI0 A;  2C9T A;  4ZJS A;  3IGQ A;  5TVC A;  2YME A;  4ZZC A;  5L4H A;  4ZZB A;  2WNL A;  2XZ6 A;  3RQU A;  5SYO A;  2MAW A;  3U8L A;  2BYS A;  2BYP A;  4TWF A;  5L47 A;  2Y57 A;  5AFM A;  5FJV A;  5IUX A;  4FRR A;  3U8M A;  2X00 A;  2BG9 A;  3P50 A;  4LMJ A;  2KSR A;  3LSV A;  2XNV A;  4TNW A;  2Y56 A;  1OED E;  4ILA A;  3WTH A;  3TLV A;  2Y54 A;  5AFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...