5HCMA

The glic pentameric ligand-gated ion channel 2-21' cross-linked mutant complexed to bromoform
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Sites of Anesthetic Inhibitory Action on a Cationic Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hcmA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hcmA01
3EAMA 3IGQA 5KZUA 5L4HA 4TWHA 3SH1A 3SQ6A 4UY2A 5AINA 5AFJA 4QH1A 4ZK4A 5L4EA 4HFBA 4ZJSA 5AFHA 4ILAA 2BYRA 3WTHA 4D01A 1OEDC 2Y56A 3TLSA 5J5FA 2XNVA 3PEOA 5HEGA 3RIFA 2WNLA 2Y57A 5J5HA 3P50A 3RQWA 4HQPA 3U8JA 3TLTA 5BRXA 2XQ6A 2YMEA 2ZJVA 2UZ6A 2Y58A 3JAFA 4QABA 3TLVA 5LG3A 4AFGA 5BW2A 3T4MA 3TLUA 4HFDA 5HEUA 2KSRA 3UQ7A 4QH4A 3WTJA 4AFTA 4BQTA 2BG9C 2BR7A 4UXUA 4NZBA 4ALXA 2XQ5A 4AFHA 5HEHA 4HFEA 3UU8A 2BR8A 5HCMA 3ZDGA 2XYTA 3C84A 3P4WA 4DBMA 5LXBA 2VL0A 4UM3S 1OEDE 5J5IA 2XZ6A 2LKHA 2LKGA 4HFHA 2XZ5A 2XNUA 1OEDA 4F8HA 3WIPA 3WTIA 2XQ9A 2QC1B 3LSVA 3SIOA 4HFIA 4UM3P 3UU4A 1UW6A 4Z90A 3PMZA 4ZZBA 4X5TA 3RQUA 4UM3A 5SYOA 2BYPA 5AFNA 2BG9E 1I9BA 3JADA 1UX2A 3U8NA 2WZYA 4EZ1A 4TNWA 5L47A 2BG9A 4COFA 3WTOA 5CFBA 3WTNA 2X00D 4IL4A 5HCJA 4QAAA 2XQAA 4IREA 3UU6A 4TNVA 2C9TA 3SQ9A 3TLWA 3U8MA 2BYNA 3U8KA 2BYSA 4NPPA 4TWFA 5HEJA 2BYQA 2WN9A 1UV6A 4XHEA 2ZJUA 2LLYA 4HFCA 4ILCA 3C79A 3GUAA 4ZK1A 2YMDA 2WNCA 5AFKA 5J0ZA 4WV9A 4ZRUA 4TWDA 4QACA 5AFMA 4BFQA 4LMKA 4UM1A 3UQ4A 2WNJA 2PGZA 1OEDB 4ZZCA 5JMEA 4ZJTA 3U8LA 5TVCA 2XQ3A 4ZR6A 4IL9A 3RIAA 2X00A 5J5GA 3EHZA 4A98A 2XQ8A 5CO5A 3ZKRA 2BJ0A 5BP0A 4PIRA 2MAWA 2M6IA 2LM2A 3RHWA 4XK9A 2XNTA 2Y54A 3EI0A 5IUXA 2BG9B 2YKSA 2YN6A 4LMLA 5HEOA 4ILBA 5AFLA 4LMJA 3UUBA 2Y7YA 2YOEA 2W8FA 3JAEA 3WTLA 4QH5A 3UU3A 5FJVA 5KE4A 4FRRA 3WTMA 4B5DA 2PH9A 4Z91A 3WTKA 2XQ4A 3UU5A 4A97A 2W8GA 3RI5A 2M6BA 2XYSA 2XQ7A 5AFMB 3ZDHA
chains in the Genus database with same CATH superfamily
4YSYA 3N9MA 5L4HA 2BS2A 4YHHT 4WW0A 1QUUA 5FP3A 3M65A 4JLEA 3KVBA 1CUNA 3QK6A 2UXXB 2DL1A 2VKOA 5HEUA 3KV9A 1WYBA 3RKOA 2UXBT 2ZM8A 3ZDGA 2XM1A 2XYTA 1KNRA 1VCSA 2G0UA 2XQYA 3Q2MA 3VRAA 2BS3A 3ZSSA 2V1DB 2X0LB 4GIWA 2Q9QB 4LFBT 4EEBA 3AA1B 3LSVA 4EB6E 3UU4A 4KHZF 2XY8B 5KMGP 2XZEA 2UXNB 1HNWT 5JR9A 1T72A 2E5LT 2JQHA 3SQ9A 2R6GF 3VU7H 1IBKT 2UU9T 2I0MA 3B5MA 5FY1A 3QUJA 2FJDA 2WWVA 4XBFB 3JCFA 3RIAA 3EHZA 1XWMA 3OPCA 4O2AE 2Y54A 5IUXA 2W62A 4LMLA 2YDRA 4X1IE 2L8KA 2XTLA 4QXBB 5L3FB 4FRRA 4ILUA 4P09A 3RLFF 4H63H 4ZI2C 4H9RC 4YSZA 4MHCA 4HWFA 3P7IA 4B3TT 1Y64B 1O3XA 3RRWA 4H9OC 4ZI3D 4IDZA 2DCFA 3P4QA 4YLHA 2PJQA 2X9HA 2HHHT 4YT0A 5ABEA 3AE9A 4WBNE 3N2OA 2Q9QA 4PJJA 4XAXB 5DABA 4TV9E 1OEDE 3L3PA 2WM9A 5FVLA 2XZ5A 4DUZT 1HFAA 2XAQB 5AQGB 4CN6A 1D1AA 4B3MT 1UX4A 3N9OA 5AQUB 4TNWA 2YDSA 4G2AA 4IE4A 2A3DA 2VB6A 4AQYT 2DNXA 5L3EB 2VWAA 4FJOA 4NPPA 3GN5B 3B57A 1HNXT 4MLKA 3KV5A 3I1AA 2EHOA 2KT9A 2KWIB 3AAEB 3OBVE 2AE9A 5JRCB 2E9XA 1WCRA 4ZR6A 4B3RT 4A98A 2XAFB 2VURA 3ZKRA 5BP0A 2BG9B 1SA0E 1ZEEA 2FJEA 4OK0A 3ZT6A 3JAEA 3SFEA 4X65T 4TUYE 4B5DA 3ZT5A 5LHIB 2J62A 3RKGA 3HA4A 4X1YE 2OLTA 2Q9QD 4CZZB 3PE0A 5AFHA 4GYRA 4DBRA 3FHNA 2MBGA 3RIFA 3PUYF 4EXTA 4EYYR 4IE0A 3ANWB 4EEDA 4CI2B 4HFDA 1XZYA 1SE7A 1Z0PA 3AE4A 5E0OA 4I4TE 1X79A 2DWGA 4DR3T 3C84A 2ZLYA 3P4WA 4DBMA 3RYIE 1OEDA 4NXMT 3NRYA 4NIQA 2RA1A 4UM3P 2K24A 2PG8A 4PJLA 4EGWA 4ISSA 2V7KA 2EHOD 5EK2A 3K3NA 2E9XD 5CFBA 4UF0A 3TLWA 3V5UA 3ZMSB 3U8MA 2BYSA 2XSBA 3UUXB 4GK0E 5JRCA 3K8PC 2ZM0A 5FL1A 5CA1E 2MPKA 5AQJB 2WNJA 3J9X1 5CJ5A 5TVCA 3F57A 5IHYA 3AXJA 4IL9A 2W00A 3PJAJ 3N9PA 1WRDA 4TN7B 4PIRA 4PFPA 3RHWA 4JI5T 3GA8A 4HGAA 4JI1T 4QKNA 5FMNA 5FXVA 3GWHA 2XAGB 2IDOB 2W8FA 3CX8B 4DMWA 2V8SV 1YQ3A 3LFMA 5JDHA 2FJAA 2F4VT 4WBOA 4HWHA 5LHHB 2JRKA 2WZIA 3CMLA 2ZMAA 3ZJ1A 3LBXB 4K0UA 4CI3B 2SPCA 2BYRA 3ANWA 2Y56A 3AE3A 3ZYKA 5ABFA 5KX5E 3HL6A 2DHRA 3AA0B 2UZ6A 2V6YA 3PUZF 5J2UE 4YTMA 1LVKA 2W63A 2XHEB 2XQ5A 1ZV4X 2YK0A 1BR2A 2IUBA 3RRCA 3C4XA 1N33T 4WNKA 2XNUA 2XUEA 3RPUA 1XMOT 3OTOT 2XQ9A 5HXSA 1MMDA 1UW6A 4H9NC 4BA9A 1YKEB 5JQGE 4X5TA 4PK4A 5C2TA 2C5IT 2WZYA 4IE7A 2LOPA 1T7SA 4LF7T 4QWNB 1UURA 5FY0A 2LSGA 4ERRA 2VK9A 3HKDE 3ONJA 4CXXA 3U8KA 2BKOA 1KK7A 3AA6B 1MMAA 3UUMA 2H89A 4TWDA 2V7LA 3FZHB 2XQ3A 2CWYA 2CXLA 2K3WA 2XQ8A 3BK9A 4PW8A 5CO5A 4N78D 2CE7A 4BJNA 3DP7A 3EI0A 4LFAT 5HEOA 5AQIB 2WZHA 4HEAA 3UUBA 3RYCE 1XNRT 5JH7E 2AXDS 2LRLA 4U7IA 2NR4A 2D5UA 1YXRA 2QA7A 2J4GA 3PUVF 2BZBA 4CQIA 4A5XA 2V26A 2CCQA 4UY2A 5AFJA 5H6QB 2N9DA 3A8YC 1HS7A 4CI1B 4TX5A 3VHLA 2V7JA 3S4UA 2NTXA 2CWOA 2E5VA 1BR0A 5LG3A 2WSSV 3V5SA 4QH4A 2JMHA 4NZBA 2NWBA 4ALXA 2LHRA 3DJBA 5DQWA 4DR7T 2QRXA 2X67A 5HAXA 5LXBA 3SIOA 1MIVA 2JJ9A 2BYPA 5AFNA 3VR9A 5FXZA 4COFA 3PUXF 3LK2B 4ZXLA 1Y01A 3PU8A 3T8OA 2KXPB 4YHJA 3PUGA 5IWAT 2LLYA 3GUAA 2WNCA 2XM2A 1GQEA 5HWXA 2WDRA 4IDNA 2QVAA 2C5JA 5JREA 3U8LA 2LT3A 1JNZA 2NOXA 1XMQT 4LF8T 1T8BA 3PV0F 3OYXA 2WMNA 4U33A 5TAOA 4DV5T 3L09A 3AEFA 1YQ4A 4ZOLE 3KVAA 5AFLA 3SRZA 3C51A 2X9YA 1VOMA 4JEHB 1ZHCA 2W4XA 2WBLA 3KV6A 4Z91A 4ZI2D 3UU5A 4O8SA 1UUSA 2IHR1 5KZUA 4HFVA 5AQMB 3LJCA 3MZKB 2I6HA 3KDSE 3P8CD 4WZXA 5J2TE 2K5BB 3P50A 4AQFC 4UVBB 4JI4T 2UXDT 2XQ6A 3CVRA 4QXHB 3TLVA 3TLUA 2KSRA 5KDMC 5FNVE 2D9DA 4GYSA 4Z8XA 1YKHB 5ABHA 1HG2A 2JQKA 5IYZE 2XZ6A 2P9BA 3I0QA 2NW7A 4PAGA 4JBWF 3BQIA 1IJ6A 1MNDA 3TKLB 2LSIA 4CN1A 5SYOA 2CBIA 3DTOA 4KI0F 3U8NA 2CLYC 4U74A 2LHNA 4BJMA 1IAPA 3AEBA 4AQGA 2BYNA 4X1KE 4H9SE 2H88A 5HXCA 3P4RA 3RIUC 4XHEA 1L0VA 3C79A 3PJAA 4OFZA 4UIGA 3NBXX 2IIUA 2DI4A 3OYZA 3AE7A 2UXCT 5LB7B 4KX6A 1G8XA 2JQ9A 3LG7A 3ETVA 5HXRA 4XK9A 4EIWA 5EK4A 4A56A 4KBMB 2YU1A 2JMKA 2VKDA 2B1EA 2PH9A 2Z6EA 2YINA 2XQ4A 5LHGB 2EHOB 3IGQA 2FBWA 3SH1A 2WAUA 2E9XB 3O1JA 3SQ6A 3UULA 4MFRA 2QYWA 2K9AA 5HEGA 4NXNT 3AE6A 5AQPB 2V6XA 2E2AA 3IBPA 3UQ7A 2BR7A 3NWIA 1D0YA 5LMUT 3F31A 4HFHA 2V5CA 3WIPA 4HKAA 3N2GE 3ZYLA 5EZYE 3A7MA 3K3OA 3U78A 4UM3A 2BDEA 2H3RA 2DLRA 4JI2T 4L5GA 3RYFE 2VQFT 2CHNA 2WY2A 1I6ZA 4YJ3E 3C4ZA 4IDOA 4TV8E 1HCIA 1W0BA 1UV6A 4ZHQE 4HFCA 4ZK1A 1IZNB 1OEDB 4LFCT 1QSDA 4DR4T 3ZCJA 1HNZT 2FUPA 4L0RA 4NUUA 4UF0B 1E7PA 2IW5B 5F3JA 4QX7B 4QH5A 2KMFA 5KE4A 4DR6T 4IDQA 3WTKA 4GKKT 2QGSA 1U4QA 3MJXA 2WP9A 5DQVA 5AINA 2J1DG 3AXJB 4U2ZA 5J5HA 4OX9T 3IHRA 3T4MA 4AFTA 1UCUA 3VKGA 1E1HB 1BR4A 1OWAA 2CXDA 4MALA 5HYAA 3PUQA 2D2SA 3CK6A 1JNRA 3RYHE 1VCTA 2LOSA 3ZN1B 5ABFB 4I43B 4AXPA 2XQAA 2C9TA 3AE8A 5AQNB 2V6YB 1H7CA 2KNDA 2VVNA 3QNUA 3KBTA 2BYQA 3R6NA 4ASKA 5AQTB 2XAJB 3MACA 5AQKB 2LE8A 3ZN0B 4EAHA 3Q5EA 1ZOYA 1S35A 5KXJA 1FMVA 2N2NA 4DR2T 5BR8T 3MK7C 3Q5XA 4Q25A 3ZC1A 4H9QC 2KLQA 2X9XA 1KF6A 3FBZA 3NKZA 3IF8B 4F6RC 1FEWA 3D0TA 5JDNA 3SWHA 5HXHA 4JI8T 5JR9C 5L2LA 1NEKA 2XPKA 4X20E 2Y6XA 4K0KT 4DV0T 4YJ2E 1D0XA 4TWHA 4P0BA 3RX6A 1FMWA 4L9IA 1N32T 4UELA 4HFBA 1G73A 1UGOA 3NVOA 3TLSA 3RC3A 3MXZA 5AQVB 1FIOA 4CXYA 2CHOA 4QABA 2Y58A 3ETUA 3P4SA 2VQET 1EZ3A 1S94A 4PFOA 5JDFA 5J5IA 2LKGA 2KZ7B 1X9BA 3ESLA 5LA6E 3H37A 4AQFA 4TZ4C 4ZI7E 2HH7A 4OYKA 2I59A 4OYJA 2J47A 3E0ZA 3NZQA 5LMNT 2YEVC 5HEJA 2HN1A 1J5WA 1M7KA 5J0ZA 5FL0A 5AFUL 2PGZA 4ZJTA 3FXDB 4X64T 2OA5A 4U2YA 2A72A 3UFEA 2X00A 1VRBA 1Z8UA 2M6IA 2X0YA 3KFWX 3OVUA 4ADZA 4DV7T 2UUBT 2CPTA 3UT5E 3RIUA 1N36T 2X0HA 4LMJA 1HR0T 3AB3B 4QXCB 3WTMA 2UUCT 3I0OA 4O4IE 4MBQA 4EV6A 1YW0A 2PTFA 2CMRA 4DV3T 5L4EA 1I94T 3VRBA 5J5FA 1J1JA 3L39A 4DVDA 2ZJVA 4DV1T 1MIWA 5M4YA 5BW2A 3WTJA 3AEAA 4ZS2A 2ODUA 3UU8A 3BQLA 3J7Yq 2UUAT 1NWMX 5JDGA 2BVMA 1LKXA 4ZS3A 2ZM2A 4U7YA 5AQOB 4J2CA 3IA3A 3Q5DA 4KP3C 5FXWA 2X00D 2X68A 4DMVA 3EDUA 2X51A 4IL4A 1IBLT 2WDQA 1B7TA 3ZLIA 2E8IA 3WAJA 3PUSA 3PTRB 4TWFA 1NAFA 4H9PC 4BFQA 2IMLA 1M62A 4ZEYA 2XAHB 3AEDA 3AE2A 1E2AA 4AKRB 3G06A 5A1LA 2LSJA 4HE8A 5LYJE 2Y7YA 5FJVA 3AAIA 4UVAB 3LK42 3C50A 1NENA 2W8GA 2M6BA 3KINB 4XZCA 1IBMT 3ZDHA 4IDPA 2JPFA 3CKDA 1MIYA 1MMGA 2V7IA 4YY3T 4AKGA 3QB5K 2D0TA 3RQWA 4AIUA 4HQPA 1XDPA 3U8JA 2W67A 1HX8A 3JAFA 2HPJA 4AFGA 3ZYMA 3SS1A 1ZP0A 3AAAB 3AE5A 2BG9C 5FY7A 2BS4A 2LSKA 4KUMB 4X62T 2BR8A 4HWIB 4PNIA 3F2EA 2LKHA 1FJGT 4F8HA 1WR6A 2X9WA 5AQRB 3AEEA 3LK3B 3PMZA 4UV8B 1AJ3A 3RQUA 4LF4T 2HN2A 3WTNA 5HCJA 4TNVA 4YTNA 5BMVE 4KHPT 5C8YE 2WN9A 2RP4A 2YMDA 5AFKA 2C0SA 5AFMA 4P0AA 4LMKA 4UM1A 5GONE 2VKJA 5J5GA 2NW9A 1IJ5A 3UTKA 2LJLA 4U72A 3NRXA 2LEHA 2LM2A 2LM9A 2GK9A 2YN6A 2CRBA 3RC8A 4AKHA 1YD8G 5LP6E 3PUWF 4FI5A 4X66T 3OJAA 2XYSA 2W61A 1D0ZA 4ZK4A 3FZMB 3N9NA 4ILAA 4JUYA 5C3JA 4GOUA 2CM0A 2BBHA 5DJQC 4O4LE 3K1SA 4UXNB 3E08A 4BQTA 3EUHA 1WR0A 4UXUA 1KEYA 1D1CA 2MOZA 4M1PA 4HWDA 3EVYA 1UK5A 5LJNA 3CX6B 1V9DA 4PJMA 4YTPA 3BQKA 5JDMA 1MMNA 1UX2A 3N5LA 4EZ4A 5LJMA 4EYUA 3HKCE 3UU6A 2W2UA 3C4WA 5ADXL 2XJ7A 3C98B 4JYAT 2ZJUA 1OXZA 2MYSA 5F5WA 5FXXA 1W0AA 3M3ZB 3HI2A 4QACA 3QOFA 3ZMVB 4ZZCA 4IE6A 4WYVA 2VL8A 5L3GB 3AVRA 3PUAA 2V5DA 3R84B 3JC6C 3N9LA 3WTLA 3O1IA 4V1Av 4B3ST 2IC9A 5LG4A 3K3QC 5CGMA 2BVLA 2L3LA 3AEGA 3EAMA 2PBIA 2M67A 5F8PA 2N1GA 5LOVE 1R8IA 4ZJSA 2K48A 2ODVA 3WTHA 4IHJE 2XNVA 3CX7B 1SUMB 2CBJA 2VVSA 3FZKB 4JI7T 1MNEA 5HEHA 2C5KT 3CIRA 3P4PA 1KNZA 5FKYA 3FZLB 5LBQB 2QC1B 3CQGB 4I0UA 3WAKA 4GKJT 4LF6T 1DU2A 2BG9E 3JADA 4B6XA 3ZEFB 3WTOA 4O4JE 4E7SA 4C90A 4JI0T 2ACXA 4HN9A 2LRKA 1SHZC 4P1NA 4WV9A 3AECA 1WFDA 4EOZB 4CXWA 2L9QA 2WU5A 2BJ0A 1W09A 5L3CB 2MAWA 2WU2A 2XNTA 4IT4A 2IC6A 2YOEA 3AE1A 4UV9B 2Y48B 4AI6A 5LGUB 2A9UA 2XSAA 2V7MA 4UR9A 3RI5A 4I50E 2CLYB 2IAKA 4ZI3C 2RPAA 4YXDA 1U5PA 4D01A 2B76A 4LF9T 3PEOA 3PU3A 2YMEA 3T1HT 3B13A 3PDYA 3GN5A 4G63A 5HCMA 2HPLA 2BKPA 3LDQB 1HF8A 2WS3A 3QB5A 2OV9A 4Z90A 4AKIA 2D0UA 4UEMA 4EZ1A 3MKDA 2BG9A 2XASB 5AQQB 2WB5A 2NW8A 4IREA 3UFGA 3C64A 3IEEA 4BAYB 3CQXC 3U3IA 4IGUA 2WMOA 4DV6T 2MTQA 4E7ZA 3EABA 2H7VC 4ZRUA 3ONLC 2Y8DA 3ZPOA 3HKBE 4AKLA 5L3DB 4ANJA 5JMEA 3KV4A 2FJBA 3RH3A 4O4HE 4UVCB 5AQLB 2BBJA 2X66A 3L8RA 4JEUB 4JV5T 3O1HA 3ZCIA 1BR1A 3AVSA 1KFYA 4ILBA 3CWZB 1W9RA 4U31A 5FVKA 4DR1T 5LCYA 3FXEB 3ZC0A 5LNKA 1XDOA 1D1BA 2XQ7A 2YDQA 4QX8B 3FBLA 1N34T 3ZJ2A 2Q9QC 3ZMTB 3CPZA 3QC9A 4QH1A 2CEAA 5JVDE 2LSYA 3HR0A 4DO0A 2H7OA 2NTYA 4H63V 5BRXA 3TLTA 5LGTB 3T1YT 4YSXA 4HFEA 4PJNA 2WQYA 1LRZA 4KMCA 2VL0A 1XNQT 3N2KE 4PK6A 3SFDA 1J5ET 3A5XA 3FZFB 4HFIA 1WYCA 1HG5A 1ZKEA 2WCAA 4EZHA 2EHOC 2DWKA 1US7B 2ZM6T 1I9BA 3SOLA 4DUYT 5L47A 2E9XC 1HTJF 4C91A 4DR5T 4QAAA 5L3BB 4AISA 3O4XE 5JDLA 5CA0E 4DV4T 5AQFB 3ONXA 1WLXA 5ETWA 4ILCA 2KINB 3WI3A 4DNDA 3OKQA 4PK5A 3ZMUB 4NUVA 3E22E 1CHUA 2CA5A 2PFVA 3LBXA 3NZPA 3GMIA 2W66A 5HXEA 3I9WA 4JI3T 5AQSB 5ABGA 4OHFA 4DV2T 3UU3A 5FYMA 5HWYA 5JDQA 2YU2A 3AA7B 4HWCA 4A97A 5AFMB 2BKNA 1QLBA 3RF1A 3VR8A 2CXFA 4O2BE 1KNPA 1OEDC 2WNLA 2Y57A 5JTGA 1UX5A 2VASA 4YFSA 4U3CA 3O9XA 3ZT7A 4AFHA 4ISTA 4CN4A 3CQCB 4IIJE 5AQHB 4UM3S 3EDVA 3WTIA 1LVFA 4I55E 4ZZBA 3H3AA 3Q9DA 3X1DA 3KBUA 2W0GA 5LGNB 3HKEE 1T98A 3VKHA 3FB2A 2WWUA 5JR9B 2NP9A 2KWHA 3ZSTA 4IE5A 3UUNA 3Q5WA 4DIDB 2VKHA 3N9QA 1HX1B 4GK5E 2ES0A 3UQ4A 5EK3A 4DBQA 5CB4E 5LXTE 3ABVA 5H6RB 4JI6T 3PURA 3I9YA 5J1GA 2ACZA 2YKSA 3MA9A 2JIWA 2WDVA 3JC6D 2JQQA 3W15B 4QHOA 2A2FX 4LF5T 3ZMZB 3H3MA 5LBMA 4HTEA 3RGLA
chains in the Genus database with same CATH topology
3EAMA 3IGQA 5KZUA 5L4HA 4TWHA 3SH1A 3SQ6A 4UY2A 5AINA 5AFJA 4QH1A 4ZK4A 5L4EA 4HFBA 4ZJSA 5AFHA 4ILAA 2BYRA 3WTHA 4D01A 1OEDC 2Y56A 3TLSA 5J5FA 2XNVA 3PEOA 5HEGA 3RIFA 2WNLA 2Y57A 5J5HA 3P50A 3RQWA 4HQPA 3U8JA 3TLTA 5BRXA 2XQ6A 2YMEA 2ZJVA 2UZ6A 2Y58A 3JAFA 4QABA 3TLVA 5LG3A 4AFGA 5BW2A 3T4MA 3TLUA 4HFDA 5HEUA 2KSRA 3UQ7A 4QH4A 3WTJA 4AFTA 4BQTA 2BG9C 2BR7A 4UXUA 4NZBA 4ALXA 2XQ5A 4AFHA 5HEHA 4HFEA 3UU8A 2BR8A 5HCMA 3ZDGA 2XYTA 3C84A 3P4WA 4DBMA 5LXBA 2VL0A 4UM3S 1OEDE 5J5IA 2XZ6A 2LKHA 2LKGA 4HFHA 2XZ5A 2XNUA 1OEDA 4F8HA 3WIPA 3WTIA 2XQ9A 2QC1B 3LSVA 3SIOA 4HFIA 4UM3P 3UU4A 1UW6A 4Z90A 3PMZA 4ZZBA 4X5TA 3RQUA 4UM3A 5SYOA 2BYPA 5AFNA 2BG9E 1I9BA 3JADA 1UX2A 3U8NA 2WZYA 4EZ1A 4TNWA 5L47A 2BG9A 4COFA 3WTOA 5CFBA 3WTNA 2X00D 4IL4A 5HCJA 4QAAA 2XQAA 4IREA 3UU6A 4TNVA 2C9TA 3SQ9A 3TLWA 3U8MA 2BYNA 3U8KA 2BYSA 4NPPA 4TWFA 5HEJA 2BYQA 2WN9A 1UV6A 4XHEA 2ZJUA 2LLYA 4HFCA 4ILCA 3C79A 3GUAA 4ZK1A 2YMDA 2WNCA 5AFKA 5J0ZA 4WV9A 4ZRUA 4TWDA 4QACA 5AFMA 4BFQA 4LMKA 4UM1A 3UQ4A 2WNJA 2PGZA 1OEDB 4ZZCA 5JMEA 4ZJTA 3U8LA 5TVCA 2XQ3A 4ZR6A 4IL9A 3RIAA 2X00A 5J5GA 3EHZA 4A98A 2XQ8A 5CO5A 3ZKRA 2BJ0A 5BP0A 4PIRA 2MAWA 2M6IA 2LM2A 3RHWA 4XK9A 2XNTA 2Y54A 3EI0A 5IUXA 2BG9B 2YKSA 2YN6A 4LMLA 5HEOA 4ILBA 5AFLA 4LMJA 3UUBA 2Y7YA 2YOEA 2W8FA 3JAEA 3WTLA 4QH5A 3UU3A 5FJVA 5KE4A 4FRRA 3WTMA 4B5DA 2PH9A 4Z91A 3WTKA 2XQ4A 3UU5A 4A97A 2W8GA 3RI5A 2M6BA 2XYSA 2XQ7A 5AFMB 3ZDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EAM A;  3IGQ A;  5KZU A;  5L4H A;  4TWH A;  3SH1 A;  3SQ6 A;  4UY2 A;  5AIN A;  5AFJ A;  4QH1 A;  4ZK4 A;  5L4E A;  4HFB A;  4ZJS A;  5AFH A;  4ILA A;  2BYR A;  3WTH A;  4D01 A;  1OED C;  2Y56 A;  3TLS A;  5J5F A;  2XNV A;  3PEO A;  5HEG A;  3RIF A;  2WNL A;  2Y57 A;  5J5H A;  3P50 A;  3RQW A;  4HQP A;  3U8J A;  3TLT A;  5BRX A;  2XQ6 A;  2YME A;  2ZJV A;  2UZ6 A;  2Y58 A;  3JAF A;  4QAB A;  3TLV A;  5LG3 A;  4AFG A;  5BW2 A;  3T4M A;  3TLU A;  4HFD A;  5HEU A;  2KSR A;  3UQ7 A;  4QH4 A;  3WTJ A;  4AFT A;  4BQT A;  2BG9 C;  2BR7 A;  4UXU A;  4NZB A;  4ALX A;  2XQ5 A;  4AFH A;  5HEH A;  4HFE A;  3UU8 A;  2BR8 A;  5HCM A;  3ZDG A;  2XYT A;  3C84 A;  3P4W A;  4DBM A;  5LXB A;  2VL0 A;  4UM3 S;  1OED E;  5J5I A;  2XZ6 A;  2LKH A;  2LKG A;  4HFH A;  2XZ5 A;  2XNU A;  1OED A;  4F8H A;  3WIP A;  3WTI A;  2XQ9 A;  2QC1 B;  3LSV A;  3SIO A;  4HFI A;  4UM3 P;  3UU4 A;  1UW6 A;  4Z90 A;  3PMZ A;  4ZZB A;  4X5T A;  3RQU A;  4UM3 A;  5SYO A;  2BYP A;  5AFN A;  2BG9 E;  1I9B A;  3JAD A;  1UX2 A;  3U8N A;  2WZY A;  4EZ1 A;  4TNW A;  5L47 A;  2BG9 A;  4COF A;  3WTO A;  5CFB A;  3WTN A;  2X00 D;  4IL4 A;  5HCJ A;  4QAA A;  2XQA A;  4IRE A;  3UU6 A;  4TNV A;  2C9T A;  3SQ9 A;  3TLW A;  3U8M A;  2BYN A;  3U8K A;  2BYS A;  4NPP A;  4TWF A;  5HEJ A;  2BYQ A;  2WN9 A;  1UV6 A;  4XHE A;  2ZJU A;  2LLY A;  4HFC A;  4ILC A;  3C79 A;  3GUA A;  4ZK1 A;  2YMD A;  2WNC A;  5AFK A;  5J0Z A;  4WV9 A;  4ZRU A;  4TWD A;  4QAC A;  5AFM A;  4BFQ A;  4LMK A;  4UM1 A;  3UQ4 A;  2WNJ A;  2PGZ A;  1OED B;  4ZZC A;  5JME A;  4ZJT A;  3U8L A;  5TVC A;  2XQ3 A;  4ZR6 A;  4IL9 A;  3RIA A;  2X00 A;  5J5G A;  3EHZ A;  4A98 A;  2XQ8 A;  5CO5 A;  3ZKR A;  2BJ0 A;  5BP0 A;  4PIR A;  2MAW A;  2M6I A;  2LM2 A;  3RHW A;  4XK9 A;  2XNT A;  2Y54 A;  3EI0 A;  5IUX A;  2BG9 B;  2YKS A;  2YN6 A;  4LML A;  5HEO A;  4ILB A;  5AFL A;  4LMJ A;  3UUB A;  2Y7Y A;  2YOE A;  2W8F A;  3JAE A;  3WTL A;  4QH5 A;  3UU3 A;  5FJV A;  5KE4 A;  4FRR A;  3WTM A;  4B5D A;  2PH9 A;  4Z91 A;  3WTK A;  2XQ4 A;  3UU5 A;  4A97 A;  2W8G A;  3RI5 A;  2M6B A;  2XYS A;  2XQ7 A;  5AFM B;  3ZDH A; 
#chains in the Genus database with same CATH topology
 4YSY A;  3N9M A;  5L4H A;  2BS2 A;  4YHH T;  4WW0 A;  1QUU A;  5FP3 A;  3M65 A;  4JLE A;  3KVB A;  1CUN A;  3QK6 A;  2UXX B;  2DL1 A;  2VKO A;  5HEU A;  3KV9 A;  1WYB A;  3RKO A;  2UXB T;  2ZM8 A;  3ZDG A;  2XM1 A;  2XYT A;  1KNR A;  1VCS A;  2G0U A;  2XQY A;  3Q2M A;  3VRA A;  2BS3 A;  3ZSS A;  2V1D B;  2X0L B;  4GIW A;  2Q9Q B;  4LFB T;  4EEB A;  3AA1 B;  3LSV A;  4EB6 E;  3UU4 A;  4KHZ F;  2XY8 B;  5KMG P;  2XZE A;  2UXN B;  1HNW T;  5JR9 A;  1T72 A;  2E5L T;  2JQH A;  3SQ9 A;  2R6G F;  3VU7 H;  1IBK T;  2UU9 T;  2I0M A;  3B5M A;  5FY1 A;  3QUJ A;  2FJD A;  2WWV A;  4XBF B;  3JCF A;  3RIA A;  3EHZ A;  1XWM A;  3OPC A;  4O2A E;  2Y54 A;  5IUX A;  2W62 A;  4LML A;  2YDR A;  4X1I E;  2L8K A;  2XTL A;  4QXB B;  5L3F B;  4FRR A;  4ILU A;  4P09 A;  3RLF F;  4H63 H;  4ZI2 C;  4H9R C;  4YSZ A;  4MHC A;  4HWF A;  3P7I A;  4B3T T;  1Y64 B;  1O3X A;  3RRW A;  4H9O C;  4ZI3 D;  4IDZ A;  2DCF A;  3P4Q A;  4YLH A;  2PJQ A;  2X9H A;  2HHH T;  4YT0 A;  5ABE A;  3AE9 A;  4WBN E;  3N2O A;  2Q9Q A;  4PJJ A;  4XAX B;  5DAB A;  4TV9 E;  1OED E;  3L3P A;  2WM9 A;  5FVL A;  2XZ5 A;  4DUZ T;  1HFA A;  2XAQ B;  5AQG B;  4CN6 A;  1D1A A;  4B3M T;  1UX4 A;  3N9O A;  5AQU B;  4TNW A;  2YDS A;  4G2A A;  4IE4 A;  2A3D A;  2VB6 A;  4AQY T;  2DNX A;  5L3E B;  2VWA A;  4FJO A;  4NPP A;  3GN5 B;  3B57 A;  1HNX T;  4MLK A;  3KV5 A;  3I1A A;  2EHO A;  2KT9 A;  2KWI B;  3AAE B;  3OBV E;  2AE9 A;  5JRC B;  2E9X A;  1WCR A;  4ZR6 A;  4B3R T;  4A98 A;  2XAF B;  2VUR A;  3ZKR A;  5BP0 A;  2BG9 B;  1SA0 E;  1ZEE A;  2FJE A;  4OK0 A;  3ZT6 A;  3JAE A;  3SFE A;  4X65 T;  4TUY E;  4B5D A;  3ZT5 A;  5LHI B;  2J62 A;  3RKG A;  3HA4 A;  4X1Y E;  2OLT A;  2Q9Q D;  4CZZ B;  3PE0 A;  5AFH A;  4GYR A;  4DBR A;  3FHN A;  2MBG A;  3RIF A;  3PUY F;  4EXT A;  4EYY R;  4IE0 A;  3ANW B;  4EED A;  4CI2 B;  4HFD A;  1XZY A;  1SE7 A;  1Z0P A;  3AE4 A;  5E0O A;  4I4T E;  1X79 A;  2DWG A;  4DR3 T;  3C84 A;  2ZLY A;  3P4W A;  4DBM A;  3RYI E;  1OED A;  4NXM T;  3NRY A;  4NIQ A;  2RA1 A;  4UM3 P;  2K24 A;  2PG8 A;  4PJL A;  4EGW A;  4ISS A;  2V7K A;  2EHO D;  5EK2 A;  3K3N A;  2E9X D;  5CFB A;  4UF0 A;  3TLW A;  3V5U A;  3ZMS B;  3U8M A;  2BYS A;  2XSB A;  3UUX B;  4GK0 E;  5JRC A;  3K8P C;  2ZM0 A;  5FL1 A;  5CA1 E;  2MPK A;  5AQJ B;  2WNJ A;  3J9X 1;  5CJ5 A;  5TVC A;  3F57 A;  5IHY A;  3AXJ A;  4IL9 A;  2W00 A;  3PJA J;  3N9P A;  1WRD A;  4TN7 B;  4PIR A;  4PFP A;  3RHW A;  4JI5 T;  3GA8 A;  4HGA A;  4JI1 T;  4QKN A;  5FMN A;  5FXV A;  3GWH A;  2XAG B;  2IDO B;  2W8F A;  3CX8 B;  4DMW A;  2V8S V;  1YQ3 A;  3LFM A;  5JDH A;  2FJA A;  2F4V T;  4WBO A;  4HWH A;  5LHH B;  2JRK A;  2WZI A;  3CML A;  2ZMA A;  3ZJ1 A;  3LBX B;  4K0U A;  4CI3 B;  2SPC A;  2BYR A;  3ANW A;  2Y56 A;  3AE3 A;  3ZYK A;  5ABF A;  5KX5 E;  3HL6 A;  2DHR A;  3AA0 B;  2UZ6 A;  2V6Y A;  3PUZ F;  5J2U E;  4YTM A;  1LVK A;  2W63 A;  2XHE B;  2XQ5 A;  1ZV4 X;  2YK0 A;  1BR2 A;  2IUB A;  3RRC A;  3C4X A;  1N33 T;  4WNK A;  2XNU A;  2XUE A;  3RPU A;  1XMO T;  3OTO T;  2XQ9 A;  5HXS A;  1MMD A;  1UW6 A;  4H9N C;  4BA9 A;  1YKE B;  5JQG E;  4X5T A;  4PK4 A;  5C2T A;  2C5I T;  2WZY A;  4IE7 A;  2LOP A;  1T7S A;  4LF7 T;  4QWN B;  1UUR A;  5FY0 A;  2LSG A;  4ERR A;  2VK9 A;  3HKD E;  3ONJ A;  4CXX A;  3U8K A;  2BKO A;  1KK7 A;  3AA6 B;  1MMA A;  3UUM A;  2H89 A;  4TWD A;  2V7L A;  3FZH B;  2XQ3 A;  2CWY A;  2CXL A;  2K3W A;  2XQ8 A;  3BK9 A;  4PW8 A;  5CO5 A;  4N78 D;  2CE7 A;  4BJN A;  3DP7 A;  3EI0 A;  4LFA T;  5HEO A;  5AQI B;  2WZH A;  4HEA A;  3UUB A;  3RYC E;  1XNR T;  5JH7 E;  2AXD S;  2LRL A;  4U7I A;  2NR4 A;  2D5U A;  1YXR A;  2QA7 A;  2J4G A;  3PUV F;  2BZB A;  4CQI A;  4A5X A;  2V26 A;  2CCQ A;  4UY2 A;  5AFJ A;  5H6Q B;  2N9D A;  3A8Y C;  1HS7 A;  4CI1 B;  4TX5 A;  3VHL A;  2V7J A;  3S4U A;  2NTX A;  2CWO A;  2E5V A;  1BR0 A;  5LG3 A;  2WSS V;  3V5S A;  4QH4 A;  2JMH A;  4NZB A;  2NWB A;  4ALX A;  2LHR A;  3DJB A;  5DQW A;  4DR7 T;  2QRX A;  2X67 A;  5HAX A;  5LXB A;  3SIO A;  1MIV A;  2JJ9 A;  2BYP A;  5AFN A;  3VR9 A;  5FXZ A;  4COF A;  3PUX F;  3LK2 B;  4ZXL A;  1Y01 A;  3PU8 A;  3T8O A;  2KXP B;  4YHJ A;  3PUG A;  5IWA T;  2LLY A;  3GUA A;  2WNC A;  2XM2 A;  1GQE A;  5HWX A;  2WDR A;  4IDN A;  2QVA A;  2C5J A;  5JRE A;  3U8L A;  2LT3 A;  1JNZ A;  2NOX A;  1XMQ T;  4LF8 T;  1T8B A;  3PV0 F;  3OYX A;  2WMN A;  4U33 A;  5TAO A;  4DV5 T;  3L09 A;  3AEF A;  1YQ4 A;  4ZOL E;  3KVA A;  5AFL A;  3SRZ A;  3C51 A;  2X9Y A;  1VOM A;  4JEH B;  1ZHC A;  2W4X A;  2WBL A;  3KV6 A;  4Z91 A;  4ZI2 D;  3UU5 A;  4O8S A;  1UUS A;  2IHR 1;  5KZU A;  4HFV A;  5AQM B;  3LJC A;  3MZK B;  2I6H A;  3KDS E;  3P8C D;  4WZX A;  5J2T E;  2K5B B;  3P50 A;  4AQF C;  4UVB B;  4JI4 T;  2UXD T;  2XQ6 A;  3CVR A;  4QXH B;  3TLV A;  3TLU A;  2KSR A;  5KDM C;  5FNV E;  2D9D A;  4GYS A;  4Z8X A;  1YKH B;  5ABH A;  1HG2 A;  2JQK A;  5IYZ E;  2XZ6 A;  2P9B A;  3I0Q A;  2NW7 A;  4PAG A;  4JBW F;  3BQI A;  1IJ6 A;  1MND A;  3TKL B;  2LSI A;  4CN1 A;  5SYO A;  2CBI A;  3DTO A;  4KI0 F;  3U8N A;  2CLY C;  4U74 A;  2LHN A;  4BJM A;  1IAP A;  3AEB A;  4AQG A;  2BYN A;  4X1K E;  4H9S E;  2H88 A;  5HXC A;  3P4R A;  3RIU C;  4XHE A;  1L0V A;  3C79 A;  3PJA A;  4OFZ A;  4UIG A;  3NBX X;  2IIU A;  2DI4 A;  3OYZ A;  3AE7 A;  2UXC T;  5LB7 B;  4KX6 A;  1G8X A;  2JQ9 A;  3LG7 A;  3ETV A;  5HXR A;  4XK9 A;  4EIW A;  5EK4 A;  4A56 A;  4KBM B;  2YU1 A;  2JMK A;  2VKD A;  2B1E A;  2PH9 A;  2Z6E A;  2YIN A;  2XQ4 A;  5LHG B;  2EHO B;  3IGQ A;  2FBW A;  3SH1 A;  2WAU A;  2E9X B;  3O1J A;  3SQ6 A;  3UUL A;  4MFR A;  2QYW A;  2K9A A;  5HEG A;  4NXN T;  3AE6 A;  5AQP B;  2V6X A;  2E2A A;  3IBP A;  3UQ7 A;  2BR7 A;  3NWI A;  1D0Y A;  5LMU T;  3F31 A;  4HFH A;  2V5C A;  3WIP A;  4HKA A;  3N2G E;  3ZYL A;  5EZY E;  3A7M A;  3K3O A;  3U78 A;  4UM3 A;  2BDE A;  2H3R A;  2DLR A;  4JI2 T;  4L5G A;  3RYF E;  2VQF T;  2CHN A;  2WY2 A;  1I6Z A;  4YJ3 E;  3C4Z A;  4IDO A;  4TV8 E;  1HCI A;  1W0B A;  1UV6 A;  4ZHQ E;  4HFC A;  4ZK1 A;  1IZN B;  1OED B;  4LFC T;  1QSD A;  4DR4 T;  3ZCJ A;  1HNZ T;  2FUP A;  4L0R A;  4NUU A;  4UF0 B;  1E7P A;  2IW5 B;  5F3J A;  4QX7 B;  4QH5 A;  2KMF A;  5KE4 A;  4DR6 T;  4IDQ A;  3WTK A;  4GKK T;  2QGS A;  1U4Q A;  3MJX A;  2WP9 A;  5DQV A;  5AIN A;  2J1D G;  3AXJ B;  4U2Z A;  5J5H A;  4OX9 T;  3IHR A;  3T4M A;  4AFT A;  1UCU A;  3VKG A;  1E1H B;  1BR4 A;  1OWA A;  2CXD A;  4MAL A;  5HYA A;  3PUQ A;  2D2S A;  3CK6 A;  1JNR A;  3RYH E;  1VCT A;  2LOS A;  3ZN1 B;  5ABF B;  4I43 B;  4AXP A;  2XQA A;  2C9T A;  3AE8 A;  5AQN B;  2V6Y B;  1H7C A;  2KND A;  2VVN A;  3QNU A;  3KBT A;  2BYQ A;  3R6N A;  4ASK A;  5AQT B;  2XAJ B;  3MAC A;  5AQK B;  2LE8 A;  3ZN0 B;  4EAH A;  3Q5E A;  1ZOY A;  1S35 A;  5KXJ A;  1FMV A;  2N2N A;  4DR2 T;  5BR8 T;  3MK7 C;  3Q5X A;  4Q25 A;  3ZC1 A;  4H9Q C;  2KLQ A;  2X9X A;  1KF6 A;  3FBZ A;  3NKZ A;  3IF8 B;  4F6R C;  1FEW A;  3D0T A;  5JDN A;  3SWH A;  5HXH A;  4JI8 T;  5JR9 C;  5L2L A;  1NEK A;  2XPK A;  4X20 E;  2Y6X A;  4K0K T;  4DV0 T;  4YJ2 E;  1D0X A;  4TWH A;  4P0B A;  3RX6 A;  1FMW A;  4L9I A;  1N32 T;  4UEL A;  4HFB A;  1G73 A;  1UGO A;  3NVO A;  3TLS A;  3RC3 A;  3MXZ A;  5AQV B;  1FIO A;  4CXY A;  2CHO A;  4QAB A;  2Y58 A;  3ETU A;  3P4S A;  2VQE T;  1EZ3 A;  1S94 A;  4PFO A;  5JDF A;  5J5I A;  2LKG A;  2KZ7 B;  1X9B A;  3ESL A;  5LA6 E;  3H37 A;  4AQF A;  4TZ4 C;  4ZI7 E;  2HH7 A;  4OYK A;  2I59 A;  4OYJ A;  2J47 A;  3E0Z A;  3NZQ A;  5LMN T;  2YEV C;  5HEJ A;  2HN1 A;  1J5W A;  1M7K A;  5J0Z A;  5FL0 A;  5AFU L;  2PGZ A;  4ZJT A;  3FXD B;  4X64 T;  2OA5 A;  4U2Y A;  2A72 A;  3UFE A;  2X00 A;  1VRB A;  1Z8U A;  2M6I A;  2X0Y A;  3KFW X;  3OVU A;  4ADZ A;  4DV7 T;  2UUB T;  2CPT A;  3UT5 E;  3RIU A;  1N36 T;  2X0H A;  4LMJ A;  1HR0 T;  3AB3 B;  4QXC B;  3WTM A;  2UUC T;  3I0O A;  4O4I E;  4MBQ A;  4EV6 A;  1YW0 A;  2PTF A;  2CMR A;  4DV3 T;  5L4E A;  1I94 T;  3VRB A;  5J5F A;  1J1J A;  3L39 A;  4DVD A;  2ZJV A;  4DV1 T;  1MIW A;  5M4Y A;  5BW2 A;  3WTJ A;  3AEA A;  4ZS2 A;  2ODU A;  3UU8 A;  3BQL A;  3J7Y q;  2UUA T;  1NWM X;  5JDG A;  2BVM A;  1LKX A;  4ZS3 A;  2ZM2 A;  4U7Y A;  5AQO B;  4J2C A;  3IA3 A;  3Q5D A;  4KP3 C;  5FXW A;  2X00 D;  2X68 A;  4DMV A;  3EDU A;  2X51 A;  4IL4 A;  1IBL T;  2WDQ A;  1B7T A;  3ZLI A;  2E8I A;  3WAJ A;  3PUS A;  3PTR B;  4TWF A;  1NAF A;  4H9P C;  4BFQ A;  2IML A;  1M62 A;  4ZEY A;  2XAH B;  3AED A;  3AE2 A;  1E2A A;  4AKR B;  3G06 A;  5A1L A;  2LSJ A;  4HE8 A;  5LYJ E;  2Y7Y A;  5FJV A;  3AAI A;  4UVA B;  3LK4 2;  3C50 A;  1NEN A;  2W8G A;  2M6B A;  3KIN B;  4XZC A;  1IBM T;  3ZDH A;  4IDP A;  2JPF A;  3CKD A;  1MIY A;  1MMG A;  2V7I A;  4YY3 T;  4AKG A;  3QB5 K;  2D0T A;  3RQW A;  4AIU A;  4HQP A;  1XDP A;  3U8J A;  2W67 A;  1HX8 A;  3JAF A;  2HPJ A;  4AFG A;  3ZYM A;  3SS1 A;  1ZP0 A;  3AAA B;  3AE5 A;  2BG9 C;  5FY7 A;  2BS4 A;  2LSK A;  4KUM B;  4X62 T;  2BR8 A;  4HWI B;  4PNI A;  3F2E A;  2LKH A;  1FJG T;  4F8H A;  1WR6 A;  2X9W A;  5AQR B;  3AEE A;  3LK3 B;  3PMZ A;  4UV8 B;  1AJ3 A;  3RQU A;  4LF4 T;  2HN2 A;  3WTN A;  5HCJ A;  4TNV A;  4YTN A;  5BMV E;  4KHP T;  5C8Y E;  2WN9 A;  2RP4 A;  2YMD A;  5AFK A;  2C0S A;  5AFM A;  4P0A A;  4LMK A;  4UM1 A;  5GON E;  2VKJ A;  5J5G A;  2NW9 A;  1IJ5 A;  3UTK A;  2LJL A;  4U72 A;  3NRX A;  2LEH A;  2LM2 A;  2LM9 A;  2GK9 A;  2YN6 A;  2CRB A;  3RC8 A;  4AKH A;  1YD8 G;  5LP6 E;  3PUW F;  4FI5 A;  4X66 T;  3OJA A;  2XYS A;  2W61 A;  1D0Z A;  4ZK4 A;  3FZM B;  3N9N A;  4ILA A;  4JUY A;  5C3J A;  4GOU A;  2CM0 A;  2BBH A;  5DJQ C;  4O4L E;  3K1S A;  4UXN B;  3E08 A;  4BQT A;  3EUH A;  1WR0 A;  4UXU A;  1KEY A;  1D1C A;  2MOZ A;  4M1P A;  4HWD A;  3EVY A;  1UK5 A;  5LJN A;  3CX6 B;  1V9D A;  4PJM A;  4YTP A;  3BQK A;  5JDM A;  1MMN A;  1UX2 A;  3N5L A;  4EZ4 A;  5LJM A;  4EYU A;  3HKC E;  3UU6 A;  2W2U A;  3C4W A;  5ADX L;  2XJ7 A;  3C98 B;  4JYA T;  2ZJU A;  1OXZ A;  2MYS A;  5F5W A;  5FXX A;  1W0A A;  3M3Z B;  3HI2 A;  4QAC A;  3QOF A;  3ZMV B;  4ZZC A;  4IE6 A;  4WYV A;  2VL8 A;  5L3G B;  3AVR A;  3PUA A;  2V5D A;  3R84 B;  3JC6 C;  3N9L A;  3WTL A;  3O1I A;  4V1A v;  4B3S T;  2IC9 A;  5LG4 A;  3K3Q C;  5CGM A;  2BVL A;  2L3L A;  3AEG A;  3EAM A;  2PBI A;  2M67 A;  5F8P A;  2N1G A;  5LOV E;  1R8I A;  4ZJS A;  2K48 A;  2ODV A;  3WTH A;  4IHJ E;  2XNV A;  3CX7 B;  1SUM B;  2CBJ A;  2VVS A;  3FZK B;  4JI7 T;  1MNE A;  5HEH A;  2C5K T;  3CIR A;  3P4P A;  1KNZ A;  5FKY A;  3FZL B;  5LBQ B;  2QC1 B;  3CQG B;  4I0U A;  3WAK A;  4GKJ T;  4LF6 T;  1DU2 A;  2BG9 E;  3JAD A;  4B6X A;  3ZEF B;  3WTO A;  4O4J E;  4E7S A;  4C90 A;  4JI0 T;  2ACX A;  4HN9 A;  2LRK A;  1SHZ C;  4P1N A;  4WV9 A;  3AEC A;  1WFD A;  4EOZ B;  4CXW A;  2L9Q A;  2WU5 A;  2BJ0 A;  1W09 A;  5L3C B;  2MAW A;  2WU2 A;  2XNT A;  4IT4 A;  2IC6 A;  2YOE A;  3AE1 A;  4UV9 B;  2Y48 B;  4AI6 A;  5LGU B;  2A9U A;  2XSA A;  2V7M A;  4UR9 A;  3RI5 A;  4I50 E;  2CLY B;  2IAK A;  4ZI3 C;  2RPA A;  4YXD A;  1U5P A;  4D01 A;  2B76 A;  4LF9 T;  3PEO A;  3PU3 A;  2YME A;  3T1H T;  3B13 A;  3PDY A;  3GN5 A;  4G63 A;  5HCM A;  2HPL A;  2BKP A;  3LDQ B;  1HF8 A;  2WS3 A;  3QB5 A;  2OV9 A;  4Z90 A;  4AKI A;  2D0U A;  4UEM A;  4EZ1 A;  3MKD A;  2BG9 A;  2XAS B;  5AQQ B;  2WB5 A;  2NW8 A;  4IRE A;  3UFG A;  3C64 A;  3IEE A;  4BAY B;  3CQX C;  3U3I A;  4IGU A;  2WMO A;  4DV6 T;  2MTQ A;  4E7Z A;  3EAB A;  2H7V C;  4ZRU A;  3ONL C;  2Y8D A;  3ZPO A;  3HKB E;  4AKL A;  5L3D B;  4ANJ A;  5JME A;  3KV4 A;  2FJB A;  3RH3 A;  4O4H E;  4UVC B;  5AQL B;  2BBJ A;  2X66 A;  3L8R A;  4JEU B;  4JV5 T;  3O1H A;  3ZCI A;  1BR1 A;  3AVS A;  1KFY A;  4ILB A;  3CWZ B;  1W9R A;  4U31 A;  5FVK A;  4DR1 T;  5LCY A;  3FXE B;  3ZC0 A;  5LNK A;  1XDO A;  1D1B A;  2XQ7 A;  2YDQ A;  4QX8 B;  3FBL A;  1N34 T;  3ZJ2 A;  2Q9Q C;  3ZMT B;  3CPZ A;  3QC9 A;  4QH1 A;  2CEA A;  5JVD E;  2LSY A;  3HR0 A;  4DO0 A;  2H7O A;  2NTY A;  4H63 V;  5BRX A;  3TLT A;  5LGT B;  3T1Y T;  4YSX A;  4HFE A;  4PJN A;  2WQY A;  1LRZ A;  4KMC A;  2VL0 A;  1XNQ T;  3N2K E;  4PK6 A;  3SFD A;  1J5E T;  3A5X A;  3FZF B;  4HFI A;  1WYC A;  1HG5 A;  1ZKE A;  2WCA A;  4EZH A;  2EHO C;  2DWK A;  1US7 B;  2ZM6 T;  1I9B A;  3SOL A;  4DUY T;  5L47 A;  2E9X C;  1HTJ F;  4C91 A;  4DR5 T;  4QAA A;  5L3B B;  4AIS A;  3O4X E;  5JDL A;  5CA0 E;  4DV4 T;  5AQF B;  3ONX A;  1WLX A;  5ETW A;  4ILC A;  2KIN B;  3WI3 A;  4DND A;  3OKQ A;  4PK5 A;  3ZMU B;  4NUV A;  3E22 E;  1CHU A;  2CA5 A;  2PFV A;  3LBX A;  3NZP A;  3GMI A;  2W66 A;  5HXE A;  3I9W A;  4JI3 T;  5AQS B;  5ABG A;  4OHF A;  4DV2 T;  3UU3 A;  5FYM A;  5HWY A;  5JDQ A;  2YU2 A;  3AA7 B;  4HWC A;  4A97 A;  5AFM B;  2BKN A;  1QLB A;  3RF1 A;  3VR8 A;  2CXF A;  4O2B E;  1KNP A;  1OED C;  2WNL A;  2Y57 A;  5JTG A;  1UX5 A;  2VAS A;  4YFS A;  4U3C A;  3O9X A;  3ZT7 A;  4AFH A;  4IST A;  4CN4 A;  3CQC B;  4IIJ E;  5AQH B;  4UM3 S;  3EDV A;  3WTI A;  1LVF A;  4I55 E;  4ZZB A;  3H3A A;  3Q9D A;  3X1D A;  3KBU A;  2W0G A;  5LGN B;  3HKE E;  1T98 A;  3VKH A;  3FB2 A;  2WWU A;  5JR9 B;  2NP9 A;  2KWH A;  3ZST A;  4IE5 A;  3UUN A;  3Q5W A;  4DID B;  2VKH A;  3N9Q A;  1HX1 B;  4GK5 E;  2ES0 A;  3UQ4 A;  5EK3 A;  4DBQ A;  5CB4 E;  5LXT E;  3ABV A;  5H6R B;  4JI6 T;  3PUR A;  3I9Y A;  5J1G A;  2ACZ A;  2YKS A;  3MA9 A;  2JIW A;  2WDV A;  3JC6 D;  2JQQ A;  3W15 B;  4QHO A;  2A2F X;  4LF5 T;  3ZMZ B;  3H3M A;  5LBM A;  4HTE A;  3RGL A; 
#chains in the Genus database with same CATH homology
 3EAM A;  3IGQ A;  5KZU A;  5L4H A;  4TWH A;  3SH1 A;  3SQ6 A;  4UY2 A;  5AIN A;  5AFJ A;  4QH1 A;  4ZK4 A;  5L4E A;  4HFB A;  4ZJS A;  5AFH A;  4ILA A;  2BYR A;  3WTH A;  4D01 A;  1OED C;  2Y56 A;  3TLS A;  5J5F A;  2XNV A;  3PEO A;  5HEG A;  3RIF A;  2WNL A;  2Y57 A;  5J5H A;  3P50 A;  3RQW A;  4HQP A;  3U8J A;  3TLT A;  5BRX A;  2XQ6 A;  2YME A;  2ZJV A;  2UZ6 A;  2Y58 A;  3JAF A;  4QAB A;  3TLV A;  5LG3 A;  4AFG A;  5BW2 A;  3T4M A;  3TLU A;  4HFD A;  5HEU A;  2KSR A;  3UQ7 A;  4QH4 A;  3WTJ A;  4AFT A;  4BQT A;  2BG9 C;  2BR7 A;  4UXU A;  4NZB A;  4ALX A;  2XQ5 A;  4AFH A;  5HEH A;  4HFE A;  3UU8 A;  2BR8 A;  5HCM A;  3ZDG A;  2XYT A;  3C84 A;  3P4W A;  4DBM A;  5LXB A;  2VL0 A;  4UM3 S;  1OED E;  5J5I A;  2XZ6 A;  2LKH A;  2LKG A;  4HFH A;  2XZ5 A;  2XNU A;  1OED A;  4F8H A;  3WIP A;  3WTI A;  2XQ9 A;  2QC1 B;  3LSV A;  3SIO A;  4HFI A;  4UM3 P;  3UU4 A;  1UW6 A;  4Z90 A;  3PMZ A;  4ZZB A;  4X5T A;  3RQU A;  4UM3 A;  5SYO A;  2BYP A;  5AFN A;  2BG9 E;  1I9B A;  3JAD A;  1UX2 A;  3U8N A;  2WZY A;  4EZ1 A;  4TNW A;  5L47 A;  2BG9 A;  4COF A;  3WTO A;  5CFB A;  3WTN A;  2X00 D;  4IL4 A;  5HCJ A;  4QAA A;  2XQA A;  4IRE A;  3UU6 A;  4TNV A;  2C9T A;  3SQ9 A;  3TLW A;  3U8M A;  2BYN A;  3U8K A;  2BYS A;  4NPP A;  4TWF A;  5HEJ A;  2BYQ A;  2WN9 A;  1UV6 A;  4XHE A;  2ZJU A;  2LLY A;  4HFC A;  4ILC A;  3C79 A;  3GUA A;  4ZK1 A;  2YMD A;  2WNC A;  5AFK A;  5J0Z A;  4WV9 A;  4ZRU A;  4TWD A;  4QAC A;  5AFM A;  4BFQ A;  4LMK A;  4UM1 A;  3UQ4 A;  2WNJ A;  2PGZ A;  1OED B;  4ZZC A;  5JME A;  4ZJT A;  3U8L A;  5TVC A;  2XQ3 A;  4ZR6 A;  4IL9 A;  3RIA A;  2X00 A;  5J5G A;  3EHZ A;  4A98 A;  2XQ8 A;  5CO5 A;  3ZKR A;  2BJ0 A;  5BP0 A;  4PIR A;  2MAW A;  2M6I A;  2LM2 A;  3RHW A;  4XK9 A;  2XNT A;  2Y54 A;  3EI0 A;  5IUX A;  2BG9 B;  2YKS A;  2YN6 A;  4LML A;  5HEO A;  4ILB A;  5AFL A;  4LMJ A;  3UUB A;  2Y7Y A;  2YOE A;  2W8F A;  3JAE A;  3WTL A;  4QH5 A;  3UU3 A;  5FJV A;  5KE4 A;  4FRR A;  3WTM A;  4B5D A;  2PH9 A;  4Z91 A;  3WTK A;  2XQ4 A;  3UU5 A;  4A97 A;  2W8G A;  3RI5 A;  2M6B A;  2XYS A;  2XQ7 A;  5AFM B;  3ZDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...