4BFQA

Assembly of a triple pi-stack of ligands in the binding site of aplysia californica acetylcholine binding protein (achbp)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Assembly of a Pi-Pi Stack of Ligands in the Binding Site of an Acetylcholine Binding Protein
pubmed doi rcsb
source organism Aplysia californica
total genus 48
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4bfqA00
5BW2A 3T4MA 5J5FA 3WTLA 4A97A 3UU6A 2PGZA 2XQ4A 4AFHA 3UU8A 5HEJA 3UU4A 2YOEA 4HFIA 5L4HA 3WTHA 2BYSA 4UM3S 3UQ4A 3P50A 3TLVA 2Y58A 4LMJA 4QAAA 5HEHA 3UU3A 1UX2A 4UY2A 4AFTA 3WTKA 4TWDA 5HEOA 4LMLA 3UU5A 5AFHA 2XQ9A 4HQPA 3UUBA 3TLWA 3RI5A 5HEUA 4ILBA 3C79A 2BR8A 3ZDHA 4HFDA 4QH4A 5BP0A 5AFJA 2XQ3A 3U8MA 5L47A 4BFQA 4UXUA 4A98A 5SYOA 4Z90A 3PMZA 2BYQA 2ZJVA 2BYRA 4D01A 4WV9A 5L4EA 4NPPA 2XQ6A 3TLSA 5HCMA 2BR7A 2X00A 2XYTA 4ILCA 2XQ8A 4QH5A 2Y56A 3TLUA 2PH9A 2WNJA 3RIFA 4AFGA 2BG9C 3EI0A 3JAFA 3JAEA 2XZ6A 4UM3A 4ZZBA 3WIPA 4LMKA 4B5DA 2XQ7A 4IL4A 4NZBA 4PIRA 3U8JA 5AFMB 3PEOA 2XYSA 3LSVA 4HFEA 4QACA 5AFKA 4BQTA 3RQWA 5LXBA 4ZK4A 4ZR6A 4QABA 4ALXA 4TWHA 3RHWA 3TLTA 3C84A 3ZKRA 2WZYA 5AFMA 4XHEA 4HFHA 4TNVA 3EHZA 2C9TA 2XQAA 3SQ6A 3JADA 1I9BA 2BYNA 5JMEA 5J5HA 2QC1B 4FRRA 2Y7YA 2YMDA 3EAMA 3P4WA 2WN9A 3SH1A 4UM1A 3WTJA 3GUAA 2BJ0A 4ZJTA 2W8GA 2Y57A 2YN6A 4UM3P 4ZJSA 5LG3A 1UW6A 5J5IA 4X5TA 2XNTA 4ZK1A 5CO5A 5AFLA 2XNVA 3RIAA 3SQ9A 3U8KA 5FJVA 1UV6A 2ZJUA 4IL9A 3RQUA 4XK9A 5IUXA 5J5GA 3IGQA 2BG9A 2VL0A 5AINA 3WTNA 3ZDGA 2XNUA 5BRXA 2X00D 4F8HA 4HFBA 2YMEA 4TWFA 3WTIA 5AFNA 2BG9E 2BYPA 2XQ5A 2WNCA 4ZRUA 5KE4A 4ZZCA 3UQ7A 3U8LA 3WTOA 2W8FA 3SIOA 5J0ZA 4IREA 4TNWA 4EZ1A 5TVCA 3U8NA 2BG9B 5HCJA 5HEGA 2WNLA 4DBMA 2Y54A 5CFBA 5KZUA 4ILAA 2UZ6A 3WTMA 4QH1A 4Z91A 2YKSA 4HFCA 2XZ5A 4COFA
chains in the Genus database with same CATH superfamily
5BW2A 3T4MA 5J5FA 3WTLA 4A97A 3UU6A 2PGZA 2XQ4A 4AFHA 3UU8A 5HEJA 3UU4A 2YOEA 4HFIA 5L4HA 3WTHA 2BYSA 4UM3S 3UQ4A 3P50A 3TLVA 2Y58A 4LMJA 4QAAA 5HEHA 3UU3A 1UX2A 4UY2A 4AFTA 3WTKA 4TWDA 5HEOA 4LMLA 3UU5A 5AFHA 2XQ9A 4HQPA 3UUBA 3TLWA 3RI5A 5HEUA 4ILBA 3C79A 2BR8A 3ZDHA 4HFDA 4QH4A 5BP0A 5AFJA 2XQ3A 3U8MA 5L47A 4BFQA 4UXUA 4A98A 5SYOA 4Z90A 3PMZA 2BYQA 2ZJVA 2BYRA 4D01A 4WV9A 5L4EA 4NPPA 2XQ6A 3TLSA 5HCMA 2BR7A 2X00A 2XYTA 4ILCA 2XQ8A 4QH5A 2Y56A 3TLUA 2PH9A 2WNJA 3RIFA 4AFGA 2BG9C 3EI0A 3JAFA 3JAEA 2XZ6A 4UM3A 4ZZBA 3WIPA 4LMKA 4B5DA 2XQ7A 4IL4A 4NZBA 4PIRA 3U8JA 5AFMB 3PEOA 2XYSA 3LSVA 4HFEA 4QACA 5AFKA 4BQTA 3RQWA 5LXBA 4ZK4A 4ZR6A 4QABA 4ALXA 4TWHA 3RHWA 3TLTA 3C84A 3ZKRA 2WZYA 5AFMA 4XHEA 4HFHA 4TNVA 3EHZA 2C9TA 2XQAA 3SQ6A 3JADA 1I9BA 2BYNA 5JMEA 5J5HA 2QC1B 4FRRA 2Y7YA 2YMDA 3EAMA 3P4WA 2WN9A 3SH1A 4UM1A 3WTJA 3GUAA 2BJ0A 4ZJTA 2W8GA 2Y57A 2YN6A 4UM3P 4ZJSA 5LG3A 1UW6A 5J5IA 4X5TA 2XNTA 4ZK1A 5CO5A 5AFLA 2XNVA 3RIAA 3SQ9A 3U8KA 5FJVA 1UV6A 2ZJUA 4IL9A 3RQUA 4XK9A 5IUXA 5J5GA 3IGQA 2BG9A 2VL0A 5AINA 3WTNA 3ZDGA 2XNUA 5BRXA 2X00D 4F8HA 4HFBA 2YMEA 4TWFA 3WTIA 5AFNA 2BG9E 2BYPA 2XQ5A 2WNCA 4ZRUA 5KE4A 4ZZCA 3UQ7A 3U8LA 3WTOA 2W8FA 3SIOA 5J0ZA 4IREA 4TNWA 4EZ1A 5TVCA 3U8NA 2BG9B 5HCJA 5HEGA 2WNLA 4DBMA 2Y54A 5CFBA 5KZUA 4ILAA 2UZ6A 3WTMA 4QH1A 4Z91A 2YKSA 4HFCA 2XZ5A 4COFA
chains in the Genus database with same CATH topology
5BW2A 3T4MA 5J5FA 3WTLA 4A97A 3UU6A 2PGZA 2XQ4A 4AFHA 3UU8A 5HEJA 3UU4A 2YOEA 4HFIA 5L4HA 3WTHA 2BYSA 4UM3S 3UQ4A 3P50A 3TLVA 2Y58A 4LMJA 4QAAA 5HEHA 3UU3A 1UX2A 4UY2A 4AFTA 3WTKA 4TWDA 5HEOA 4LMLA 3UU5A 5AFHA 2XQ9A 4HQPA 3UUBA 3TLWA 3RI5A 5HEUA 4ILBA 3C79A 2BR8A 3ZDHA 4HFDA 4QH4A 5BP0A 5AFJA 2XQ3A 3U8MA 5L47A 4BFQA 4UXUA 4A98A 5SYOA 4Z90A 3PMZA 2BYQA 2ZJVA 2BYRA 4D01A 4WV9A 5L4EA 4NPPA 2XQ6A 3TLSA 5HCMA 2BR7A 2X00A 2XYTA 4ILCA 2XQ8A 4QH5A 2Y56A 3TLUA 2PH9A 2WNJA 3RIFA 4AFGA 2BG9C 3EI0A 3JAFA 3JAEA 2XZ6A 4UM3A 4ZZBA 3WIPA 4LMKA 4B5DA 2XQ7A 4IL4A 4NZBA 4PIRA 3U8JA 5AFMB 3PEOA 2XYSA 3LSVA 4HFEA 4QACA 5AFKA 4BQTA 3RQWA 5LXBA 4ZK4A 4ZR6A 4QABA 4ALXA 4TWHA 3RHWA 3TLTA 3C84A 3ZKRA 2WZYA 5AFMA 4XHEA 4HFHA 4TNVA 3EHZA 2C9TA 2XQAA 3SQ6A 3JADA 1I9BA 2BYNA 5JMEA 5J5HA 2QC1B 4FRRA 2Y7YA 2YMDA 3EAMA 3P4WA 2WN9A 3SH1A 4UM1A 3WTJA 3GUAA 2BJ0A 4ZJTA 2W8GA 2Y57A 2YN6A 4UM3P 4ZJSA 5LG3A 1UW6A 5J5IA 4X5TA 2XNTA 4ZK1A 5CO5A 5AFLA 2XNVA 3RIAA 3SQ9A 3U8KA 5FJVA 1UV6A 2ZJUA 4IL9A 3RQUA 4XK9A 5IUXA 5J5GA 3IGQA 2BG9A 2VL0A 5AINA 3WTNA 3ZDGA 2XNUA 5BRXA 2X00D 4F8HA 4HFBA 2YMEA 4TWFA 3WTIA 5AFNA 2BG9E 2BYPA 2XQ5A 2WNCA 4ZRUA 5KE4A 4ZZCA 3UQ7A 3U8LA 3WTOA 2W8FA 3SIOA 5J0ZA 4IREA 4TNWA 4EZ1A 5TVCA 3U8NA 2BG9B 5HCJA 5HEGA 2WNLA 4DBMA 2Y54A 5CFBA 5KZUA 4ILAA 2UZ6A 3WTMA 4QH1A 4Z91A 2YKSA 4HFCA 2XZ5A 4COFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BW2 A;  3T4M A;  5J5F A;  3WTL A;  4A97 A;  3UU6 A;  2PGZ A;  2XQ4 A;  4AFH A;  3UU8 A;  5HEJ A;  3UU4 A;  2YOE A;  4HFI A;  5L4H A;  3WTH A;  2BYS A;  4UM3 S;  3UQ4 A;  3P50 A;  3TLV A;  2Y58 A;  4LMJ A;  4QAA A;  5HEH A;  3UU3 A;  1UX2 A;  4UY2 A;  4AFT A;  3WTK A;  4TWD A;  5HEO A;  4LML A;  3UU5 A;  5AFH A;  2XQ9 A;  4HQP A;  3UUB A;  3TLW A;  3RI5 A;  5HEU A;  4ILB A;  3C79 A;  2BR8 A;  3ZDH A;  4HFD A;  4QH4 A;  5BP0 A;  5AFJ A;  2XQ3 A;  3U8M A;  5L47 A;  4BFQ A;  4UXU A;  4A98 A;  5SYO A;  4Z90 A;  3PMZ A;  2BYQ A;  2ZJV A;  2BYR A;  4D01 A;  4WV9 A;  5L4E A;  4NPP A;  2XQ6 A;  3TLS A;  5HCM A;  2BR7 A;  2X00 A;  2XYT A;  4ILC A;  2XQ8 A;  4QH5 A;  2Y56 A;  3TLU A;  2PH9 A;  2WNJ A;  3RIF A;  4AFG A;  2BG9 C;  3EI0 A;  3JAF A;  3JAE A;  2XZ6 A;  4UM3 A;  4ZZB A;  3WIP A;  4LMK A;  4B5D A;  2XQ7 A;  4IL4 A;  4NZB A;  4PIR A;  3U8J A;  5AFM B;  3PEO A;  2XYS A;  3LSV A;  4HFE A;  4QAC A;  5AFK A;  4BQT A;  3RQW A;  5LXB A;  4ZK4 A;  4ZR6 A;  4QAB A;  4ALX A;  4TWH A;  3RHW A;  3TLT A;  3C84 A;  3ZKR A;  2WZY A;  5AFM A;  4XHE A;  4HFH A;  4TNV A;  3EHZ A;  2C9T A;  2XQA A;  3SQ6 A;  3JAD A;  1I9B A;  2BYN A;  5JME A;  5J5H A;  2QC1 B;  4FRR A;  2Y7Y A;  2YMD A;  3EAM A;  3P4W A;  2WN9 A;  3SH1 A;  4UM1 A;  3WTJ A;  3GUA A;  2BJ0 A;  4ZJT A;  2W8G A;  2Y57 A;  2YN6 A;  4UM3 P;  4ZJS A;  5LG3 A;  1UW6 A;  5J5I A;  4X5T A;  2XNT A;  4ZK1 A;  5CO5 A;  5AFL A;  2XNV A;  3RIA A;  3SQ9 A;  3U8K A;  5FJV A;  1UV6 A;  2ZJU A;  4IL9 A;  3RQU A;  4XK9 A;  5IUX A;  5J5G A;  3IGQ A;  2BG9 A;  2VL0 A;  5AIN A;  3WTN A;  3ZDG A;  2XNU A;  5BRX A;  2X00 D;  4F8H A;  4HFB A;  2YME A;  4TWF A;  3WTI A;  5AFN A;  2BG9 E;  2BYP A;  2XQ5 A;  2WNC A;  4ZRU A;  5KE4 A;  4ZZC A;  3UQ7 A;  3U8L A;  3WTO A;  2W8F A;  3SIO A;  5J0Z A;  4IRE A;  4TNW A;  4EZ1 A;  5TVC A;  3U8N A;  2BG9 B;  5HCJ A;  5HEG A;  2WNL A;  4DBM A;  2Y54 A;  5CFB A;  5KZU A;  4ILA A;  2UZ6 A;  3WTM A;  4QH1 A;  4Z91 A;  2YKS A;  4HFC A;  2XZ5 A;  4COF A; 
#chains in the Genus database with same CATH topology
 5BW2 A;  3T4M A;  5J5F A;  3WTL A;  4A97 A;  3UU6 A;  2PGZ A;  2XQ4 A;  4AFH A;  3UU8 A;  5HEJ A;  3UU4 A;  2YOE A;  4HFI A;  5L4H A;  3WTH A;  2BYS A;  4UM3 S;  3UQ4 A;  3P50 A;  3TLV A;  2Y58 A;  4LMJ A;  4QAA A;  5HEH A;  3UU3 A;  1UX2 A;  4UY2 A;  4AFT A;  3WTK A;  4TWD A;  5HEO A;  4LML A;  3UU5 A;  5AFH A;  2XQ9 A;  4HQP A;  3UUB A;  3TLW A;  3RI5 A;  5HEU A;  4ILB A;  3C79 A;  2BR8 A;  3ZDH A;  4HFD A;  4QH4 A;  5BP0 A;  5AFJ A;  2XQ3 A;  3U8M A;  5L47 A;  4BFQ A;  4UXU A;  4A98 A;  5SYO A;  4Z90 A;  3PMZ A;  2BYQ A;  2ZJV A;  2BYR A;  4D01 A;  4WV9 A;  5L4E A;  4NPP A;  2XQ6 A;  3TLS A;  5HCM A;  2BR7 A;  2X00 A;  2XYT A;  4ILC A;  2XQ8 A;  4QH5 A;  2Y56 A;  3TLU A;  2PH9 A;  2WNJ A;  3RIF A;  4AFG A;  2BG9 C;  3EI0 A;  3JAF A;  3JAE A;  2XZ6 A;  4UM3 A;  4ZZB A;  3WIP A;  4LMK A;  4B5D A;  2XQ7 A;  4IL4 A;  4NZB A;  4PIR A;  3U8J A;  5AFM B;  3PEO A;  2XYS A;  3LSV A;  4HFE A;  4QAC A;  5AFK A;  4BQT A;  3RQW A;  5LXB A;  4ZK4 A;  4ZR6 A;  4QAB A;  4ALX A;  4TWH A;  3RHW A;  3TLT A;  3C84 A;  3ZKR A;  2WZY A;  5AFM A;  4XHE A;  4HFH A;  4TNV A;  3EHZ A;  2C9T A;  2XQA A;  3SQ6 A;  3JAD A;  1I9B A;  2BYN A;  5JME A;  5J5H A;  2QC1 B;  4FRR A;  2Y7Y A;  2YMD A;  3EAM A;  3P4W A;  2WN9 A;  3SH1 A;  4UM1 A;  3WTJ A;  3GUA A;  2BJ0 A;  4ZJT A;  2W8G A;  2Y57 A;  2YN6 A;  4UM3 P;  4ZJS A;  5LG3 A;  1UW6 A;  5J5I A;  4X5T A;  2XNT A;  4ZK1 A;  5CO5 A;  5AFL A;  2XNV A;  3RIA A;  3SQ9 A;  3U8K A;  5FJV A;  1UV6 A;  2ZJU A;  4IL9 A;  3RQU A;  4XK9 A;  5IUX A;  5J5G A;  3IGQ A;  2BG9 A;  2VL0 A;  5AIN A;  3WTN A;  3ZDG A;  2XNU A;  5BRX A;  2X00 D;  4F8H A;  4HFB A;  2YME A;  4TWF A;  3WTI A;  5AFN A;  2BG9 E;  2BYP A;  2XQ5 A;  2WNC A;  4ZRU A;  5KE4 A;  4ZZC A;  3UQ7 A;  3U8L A;  3WTO A;  2W8F A;  3SIO A;  5J0Z A;  4IRE A;  4TNW A;  4EZ1 A;  5TVC A;  3U8N A;  2BG9 B;  5HCJ A;  5HEG A;  2WNL A;  4DBM A;  2Y54 A;  5CFB A;  5KZU A;  4ILA A;  2UZ6 A;  3WTM A;  4QH1 A;  4Z91 A;  2YKS A;  4HFC A;  2XZ5 A;  4COF A; 
#chains in the Genus database with same CATH homology
 5BW2 A;  3T4M A;  5J5F A;  3WTL A;  4A97 A;  3UU6 A;  2PGZ A;  2XQ4 A;  4AFH A;  3UU8 A;  5HEJ A;  3UU4 A;  2YOE A;  4HFI A;  5L4H A;  3WTH A;  2BYS A;  4UM3 S;  3UQ4 A;  3P50 A;  3TLV A;  2Y58 A;  4LMJ A;  4QAA A;  5HEH A;  3UU3 A;  1UX2 A;  4UY2 A;  4AFT A;  3WTK A;  4TWD A;  5HEO A;  4LML A;  3UU5 A;  5AFH A;  2XQ9 A;  4HQP A;  3UUB A;  3TLW A;  3RI5 A;  5HEU A;  4ILB A;  3C79 A;  2BR8 A;  3ZDH A;  4HFD A;  4QH4 A;  5BP0 A;  5AFJ A;  2XQ3 A;  3U8M A;  5L47 A;  4BFQ A;  4UXU A;  4A98 A;  5SYO A;  4Z90 A;  3PMZ A;  2BYQ A;  2ZJV A;  2BYR A;  4D01 A;  4WV9 A;  5L4E A;  4NPP A;  2XQ6 A;  3TLS A;  5HCM A;  2BR7 A;  2X00 A;  2XYT A;  4ILC A;  2XQ8 A;  4QH5 A;  2Y56 A;  3TLU A;  2PH9 A;  2WNJ A;  3RIF A;  4AFG A;  2BG9 C;  3EI0 A;  3JAF A;  3JAE A;  2XZ6 A;  4UM3 A;  4ZZB A;  3WIP A;  4LMK A;  4B5D A;  2XQ7 A;  4IL4 A;  4NZB A;  4PIR A;  3U8J A;  5AFM B;  3PEO A;  2XYS A;  3LSV A;  4HFE A;  4QAC A;  5AFK A;  4BQT A;  3RQW A;  5LXB A;  4ZK4 A;  4ZR6 A;  4QAB A;  4ALX A;  4TWH A;  3RHW A;  3TLT A;  3C84 A;  3ZKR A;  2WZY A;  5AFM A;  4XHE A;  4HFH A;  4TNV A;  3EHZ A;  2C9T A;  2XQA A;  3SQ6 A;  3JAD A;  1I9B A;  2BYN A;  5JME A;  5J5H A;  2QC1 B;  4FRR A;  2Y7Y A;  2YMD A;  3EAM A;  3P4W A;  2WN9 A;  3SH1 A;  4UM1 A;  3WTJ A;  3GUA A;  2BJ0 A;  4ZJT A;  2W8G A;  2Y57 A;  2YN6 A;  4UM3 P;  4ZJS A;  5LG3 A;  1UW6 A;  5J5I A;  4X5T A;  2XNT A;  4ZK1 A;  5CO5 A;  5AFL A;  2XNV A;  3RIA A;  3SQ9 A;  3U8K A;  5FJV A;  1UV6 A;  2ZJU A;  4IL9 A;  3RQU A;  4XK9 A;  5IUX A;  5J5G A;  3IGQ A;  2BG9 A;  2VL0 A;  5AIN A;  3WTN A;  3ZDG A;  2XNU A;  5BRX A;  2X00 D;  4F8H A;  4HFB A;  2YME A;  4TWF A;  3WTI A;  5AFN A;  2BG9 E;  2BYP A;  2XQ5 A;  2WNC A;  4ZRU A;  5KE4 A;  4ZZC A;  3UQ7 A;  3U8L A;  3WTO A;  2W8F A;  3SIO A;  5J0Z A;  4IRE A;  4TNW A;  4EZ1 A;  5TVC A;  3U8N A;  2BG9 B;  5HCJ A;  5HEG A;  2WNL A;  4DBM A;  2Y54 A;  5CFB A;  5KZU A;  4ILA A;  2UZ6 A;  3WTM A;  4QH1 A;  4Z91 A;  2YKS A;  4HFC A;  2XZ5 A;  4COF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...