4HFEA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to ethanol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfeA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfeA01
4HFDA 3ZKRA 2BYRA 3U8MA 2YKSA 5IUXA 3U8KA 3TLTA 4B5DA 3P50A 2M6IA 5HCMA 4F8HA 3WTLA 2WNCA 4TNVA 5AFHA 2UZ6A 2XQAA 3C79A 2LKGA 2WZYA 3SQ9A 4AFHA 2YMEA 2VL0A 3EAMA 5HEJA 5BRXA 4PIRA 5TVCA 4QH5A 3WTKA 5J5FA 2BG9C 4TWDA 2YN6A 5J5IA 2XQ6A 4ZRUA 3UU4A 3LSVA 3WTMA 4AFGA 4QH4A 2XYTA 3RHWA 4ILCA 4UXUA 2C9TA 2BJ0A 5AFNA 5HCJA 4QH1A 5L4HA 5J5HA 5AFLA 2LLYA 4IREA 3WTOA 5FJVA 4ZZBA 5LXBA 4ZZCA 2XYSA 2XQ3A 4IL9A 5LG3A 4BFQA 2Y7YA 2XQ5A 4HFEA 4LMKA 4A97A 2XNVA 3WTHA 3ZDGA 5BW2A 3JAEA 3UU6A 3SH1A 4COFA 3UU8A 2XQ8A 5HEGA 2ZJVA 3UU5A 2BYSA 4UY2A 2LM2A 4WV9A 2ZJUA 2BR7A 4QACA 4HFBA 4A98A 1OEDC 3PMZA 2W8FA 5HEUA 4EZ1A 4ZK1A 2YOEA 4BQTA 2QC1B 2W8GA 4NZBA 4QAAA 5HEOA 5AFJA 1UX2A 3TLWA 4XHEA 3UQ4A 5KZUA 2WN9A 4HFCA 2BG9E 4IL4A 2XQ9A 3UU3A 2BYNA 2WNLA 3WTIA 5CFBA 4UM1A 3UQ7A 5AINA 4DBMA 4ILAA 4LMJA 3UUBA 3U8NA 2PH9A 4AFTA 4HFIA 1UV6A 3RIAA 3RIFA 2BG9A 3WIPA 3SQ6A 4TWFA 5L4EA 3PEOA 3U8JA 3EI0A 4Z90A 2BG9B 4ALXA 4UM3A 2XQ4A 2Y57A 2Y58A 3RQUA 1I9BA 5JMEA 5CO5A 4LMLA 5HEHA 3U8LA 2XZ6A 2M6BA 4HFHA 1UW6A 5KE4A 5J0ZA 3EHZA 4ILBA 4D01A 4TWHA 4ZJTA 5L47A 2WNJA 2X00A 4NPPA 2XQ7A 1OEDE 3RI5A 2BYQA 3TLSA 3WTNA 3JAFA 4X5TA 2XZ5A 2X00D 2Y56A 5J5GA 5AFKA 4Z91A 2PGZA 4FRRA 5SYOA 5BP0A 3P4WA 1OEDA 5AFMA 3TLVA 2LKHA 4ZJSA 3ZDHA 4TNWA 4QABA 4XK9A 3WTJA 3RQWA 3C84A 3GUAA 2KSRA 1OEDB 3JADA 2XNUA 2BR8A 5AFMB 2MAWA 3T4MA 4UM3S 2YMDA 2Y54A 3TLUA 4ZR6A 3IGQA 3SIOA 4UM3P 4HQPA 4ZK4A 2XNTA 2BYPA
chains in the Genus database with same CATH superfamily
1UK5A 3PUYF 1J5ET 2M6IA 2BZBA 4CZZB 2IC6A 1KNPA 2B1EA 4H9NC 2A3DA 3AEFA 3FZMB 4Q25A 3AE9A 5JH7E 3ZT7A 4UXNB 3G06A 2BG9C 2XQ6A 4OK0A 2V5CA 2JIWA 2AE9A 3N9LA 4O4IE 2CM0A 4H9RC 2WQYA 2WM9A 4CN6A 4QKNA 4HFBA 2L3LA 3BK9A 1WLXA 2WDVA 4HWDA 2V7KA 5HEOA 5LBQB 3U78A 2WDRA 5LG4A 1HG2A 3Q5DA 3UQ7A 3F57A 3NZPA 4CXYA 3I9WA 2E5LT 2SPCA 5AQTB 2W00A 1YKHB 2XZ6A 5IHYA 5KE4A 3ONXA 1HS7A 2W66A 3PJAJ 3BQLA 4B3MT 2XTLA 4DV7T 4L9IA 4XK9A 5M4YA 3JADA 2YINA 3HKCE 1BR4A 3MZKB 3FZHB 4QXCB 3ZMZB 4AKGA 5JRCA 1N34T 1UX4A 3PJAA 3HL6A 4UV9B 3E0ZA 4KX6A 3ANWA 1HFAA 2WU5A 3O1IA 3PU8A 5HXEA 4U7IA 4CQIA 4AKRB 2DNXA 3UU4A 3AE3A 3ZC0A 2ZLYA 4GK5E 5KXJA 3MK7C 4DBQA 3OVUA 3VRAA 3KDSE 4BFQA 4DR3T 2JMHA 5JDMA 5LMUT 2F4VT 2XQ5A 3RRCA 1UCUA 3LJCA 4JI5T 2BVLA 2Q9QD 5FMNA 1I94T 4EZ1A 2LOSA 4QX7B 2XJ7A 3A8YC 1HCIA 5CGMA 5J2TE 5ETWA 2WZIA 1D1CA 2WN9A 3P4RA 4EV6A 4YFSA 3P8CD 3HA4A 4DBMA 1HR0T 5JDGA 2J4GA 4IE7A 3ZYKA 1KNRA 3GMIA 1R8IA 3NRXA 3ZEFB 4I55E 4ALXA 2J1DG 3K3NA 2ZMAA 4DR6T 3PU3A 2BYQA 3RYHE 2L8KA 5H6QB 4X5TA 4BJMA 5AQHB 4ZJSA 4QABA 2XNUA 2IHR1 1YQ4A 3AAIA 3I0QA 2XSAA 4TUYE 4ZK4A 4I43B 3OYXA 3VU7H 3UULA 3U8MA 2V5DA 1XMQT 5DJQC 2VURA 2A2FX 2R6GF 5FVKA 5LHIB 4P0AA 4JI3T 4XBFB 4YTMA 1WR0A 5LGUB 1WRDA 1NAFA 3PTRB 4TWDA 3RLFF 4ZRUA 2KXPB 2XUEA 3WTMA 4IT4A 3RHWA 3NVOA 4DR7T 4OX9T 3FZLB 2EHOD 3ZJ1A 5JVDE 1CUNA 2K48A 3LBXB 2ZJVA 5FY1A 3KV4A 4AXPA 3NRYA 2ZJUA 4L0RA 2ES0A 4JI6T 3C50A 2VQET 2V7JA 5JTGA 2NP9A 3LK42 3KVAA 2QRXA 4YY3T 3UQ4A 4MALA 2FJAA 2KNDA 2X66A 3AE7A 2JQ9A 3ESLA 5JR9C 3NWIA 4G63A 3AE4A 2OLTA 2FJBA 4MBQA 2JQKA 3ZPOA 1UW6A 2KZ7B 1OXZA 3VRBA 4ANJA 4DBRA 4ZJTA 2CLYB 3J9X1 3RI5A 3MKDA 2LT3A 3JAFA 2V7MA 4OYKA 2HH7A 3ZDHA 3QB5A 4NXNT 3MXZA 2BR8A 5FXVA 3O1HA 2YK0A 4KBMB 4Z8XA 4IHJE 1KEYA 4U72A 1AJ3A 4F8HA 2KWHA 2XQAA 4ADZA 2RA1A 2KWIB 3F31A 1E7PA 3WTKA 5FY0A 5J5IA 1VCTA 2X9HA 3LSVA 4HWIB 4L5GA 1E1HB 2X9YA 4YSYA 5LNKA 5IYZE 3ABVA 3EUHA 2Q9QB 4WV9A 4AI6A 2QGSA 4EGWA 3RGLA 4AQFC 4ZK1A 4LF4T 2JJ9A 2QC1B 4KHZF 3ZCIA 3PUSA 2CWOA 3KBUA 4GYSA 4O2BE 4AQYT 5AQNB 3C4ZA 2RPAA 3WIPA 4YXDA 4Z90A 4UM3A 2BBHA 2XPKA 3UUMA 2HPJA 4I4TE 2VKHA 5LOVE 2VVSA 1SA0E 1IJ6A 4OHFA 4ZI3C 3RH3A 3O1JA 1MMNA 2X00D 5FVLA 4C91A 3CWZB 1ZP0A 3RIUA 1M62A 5C2TA 3N2KE 4MHCA 4IDPA 2I59A 4B5DA 2MTQA 4JYAT 2V6YB 2A9UA 2WNCA 4GK0E 2X0LB 4DR1T 3UUNA 4GKJT 1ZHCA 4QXBB 4UVAB 5LA6E 4UXUA 2WU2A 4QH1A 3WTOA 5LXBA 2YU1A 2VKJA 2P9BA 4IIJE 2EHOB 3N2OA 4OFZA 3P4QA 3LBXA 3SH1A 1L0VA 2XQ8A 4B6XA 5FXZA 3R84B 5AQFB 2LM2A 4ASKA 5A1LA 2W67A 2YDQA 2WZHA 4KHPT 4ZI7E 2DL1A 3EDUA 5ABFB 3TLWA 2FJDA 4XHEA 4K0KT 4QX8B 5TAOA 4UM1A 1LRZA 3ZYMA 3H3AA 4HWCA 4DV0T 2BG9B 4DO0A 2NW9A 4K0UA 3LFMA 1LVKA 4P09A 1MMGA 3GWHA 4ILBA 4D01A 2W62A 1LVFA 4NPPA 4CI1B 1HF8A 3TLSA 2V7LA 3ZYLA 3RRWA 4XZCA 1WR6A 3RQWA 3SWHA 4LF7T 2FUPA 3Q2MA 2D5UA 2XAJB 4H9QC 1FEWA 5BMVE 1WYCA 2XHEB 4ZS3A 3OTOT 1HNZT 4P1NA 4EIWA 2NTYA 4IDZA 4JLEA 5IUXA 4H63H 2CBIA 3PE0A 1WYBA 2E9XD 5HEJA 3ONJA 4J2CA 1HX8A 4QH5A 5J5FA 4DNDA 4AFGA 5AFNA 5J5HA 5L4HA 5AFLA 4HE8A 3ONLC 3N9MA 3M3ZB 3DJBA 1MNDA 2CMRA 2Q9QA 4LFCT 2A72A 3K3QC 2CE7A 2N2NA 4TV8E 4CN4A 1XDOA 5FXWA 1MIVA 1SUMB 2JQHA 4H9SE 3PURA 5LXTE 2QVAA 3O4XE 1W0AA 3P4SA 3U8NA 3N2GE 5AQKB 3RIAA 2RP4A 4TWFA 4X20E 1FMWA 4YLHA 3PEOA 2CXLA 1OWAA 3PUZF 2JMKA 2LSYA 4X1KE 5JQGE 2C0SA 4JI1T 3PV0F 2VWAA 3RYIE 4TV9E 4E7SA 2CXFA 4YHHT 2WSSV 4GOUA 2BKOA 2Y56A 3NKZA 3PUVF 3C84A 5L3GB 5ABEA 2ZM2A 3X1DA 4U2YA 2C5IT 2V6YA 2ZM0A 2CHNA 2YKSA 3D0TA 4PJNA 2X68A 3C79A 2ODUA 2YMEA 4BAYB 4HEAA 5AFUL 5LCYA 2V7IA 1LKXA 2ZM8A 1KK7A 2WY2A 4UIGA 2C9TA 2EHOA 3AE2A 1S94A 5FJVA 4DIDB 3MACA 1BR0A 4ZI3D 4JEHB 3AEBA 2J62A 2BYSA 5ABHA 1ZEEA 4BJNA 1QLBA 4PK4A 5JDFA 2K5BB 3L8RA 5ABFA 3IF8B 4BQTA 4QAAA 1VRBA 1G8XA 2YU2A 1X9BA 3UU3A 2J47A 3T1HT 3B13A 2WWUA 3ZN0B 2UUBT 3CQGB 5KDMC 2BG9A 2H89A 2CBJA 5AQOB 2WBLA 3RQUA 2M67A 1FJGT 2LRLA 4LFAT 2NOXA 4TWHA 3JC6D 1OEDE 4X65T 4JV5T 2VKOA 2IW5B 5LGTB 4OYJA 4ZI2C 2IDOB 2YDRA 4LF8T 2BKNA 3K3OA 4LFBT 4EYYR 4ZR6A 1KF6A 2BYPA 4EZ4A 5L2LA 4X66T 2LHRA 4ZOLE 1IZNB 3AB3B 3FHNA 4AFHA 5JR9B 4PIRA 1W0BA 1S35A 2LOPA 3CVRA 2LSJA 3C4WA 2NW8A 2CXDA 2X0YA 1H7CA 4NIQA 3UFEA 1MIYA 2BJ0A 1NENA 4B3TT 3LK3B 4O4JE 2X0HA 4KMCA 2XNVA 3ZDGA 2XM1A 4DUZT 4PJLA 5HEGA 2XAQB 3CPZA 4A98A 4PNIA 2W8FA 4YT0A 1JNZA 3V5UA 5CJ5A 1D0ZA 2IC9A 4HWHA 2XM2A 3AA1B 4NUUA 2V26A 3PDYA 3EI0A 4O4HE 3ZJ2A 4DR5T 2MYSA 3RF1A 2XQ4A 2WDQA 4JUYA 4EAHA 3IA3A 5AQPB 2Y58A 5JMEA 3WAKA 4X62T 5L3BB 3OPCA 4HFHA 3SFEA 3AA6B 2X00A 2IIUA 5JREA 2LEHA 2NW7A 4DVDA 3PUQA 3QOFA 5LGNB 3PUGA 4FRRA 2L9QA 2E9XC 1YD8G 5AFMB 2MAWA 3T4MA 4UM3S 4JI2T 3N9NA 4HFDA 5GONE 1X79A 2KT9A 1UX5A 4X1IE 4QHOA 2NWBA 5E0OA 3AVSA 2H7VC 3FZFB 5BRXA 5LHGB 2X9WA 2D0TA 3RKOA 5AQRB 4C90A 2XYTA 1UUSA 1VCSA 5EK4A 3PUXF 4EEDA 4DUYT 5F8PA 4ZZBA 1QUUA 3KFWX 2DCFA 4JI4T 5DQWA 5BW2A 3UU6A 5CA0E 2ZM6T 2IMLA 2PFVA 4HFVA 2UXXB 3N9QA 2HN1A 1OEDC 4CN1A 2UXDT 2CEAA 4JI0T 3CMLA 4IDNA 5F5WA 2W2UA 1XNQT 2X9XA 4AISA 1ZOYA 4DMWA 2WB5A 5JDQA 2NR4A 2C5KT 3SQ6A 2VKDA 4EB6E 2QYWA 5AQJB 1I9BA 4LMLA 3AE8A 1UGOA 3U8LA 2E5VA 3AE5A 3CX6B 1E2AA 2XZ5A 5AFKA 2PGZA 3CX7B 1MNEA 1T72A 3P7IA 2LKHA 5AQGB 3TKLB 2V6XA 4WBOA 2YMDA 4AKLA 1WCRA 2LM9A 3ZKRA 2BYRA 2CLYC 4CI3B 1J5WA 2MPKA 2I6HA 5C3JA 2ACZA 5HCMA 5LJNA 5JR9A 4TNVA 4LF9T 2B76A 2WMOA 2D0UA 4ZEYA 3HI2A 3AEEA 1N33T 3MA9A 3OJAA 3R6NA 3ZT5A 2YDSA 4UVCB 4ZS2A 4ILCA 3J7Yq 2VQFT 2LLYA 4QWNB 4IREA 4U3CA 5AQIB 2LRKA 5LG3A 5AQMB 4ZI2D 3T1YT 1GQEA 4V1Av 5KMGP 2E8IA 5L3DB 1YW0A 4TX5A 2W4XA 3CQCB 1XDPA 2WCAA 3I1AA 2WS3A 4JEUB 4NZBA 4DV2T 3AEAA 5AFJA 2UXBT 3JC6C 3H3MA 1SE7A 1XNRT 1HTJF 3UUBA 2H7OA 5L3CB 2LJLA 3RYFE 4JI7T 5IWAT 2Y57A 2DHRA 2OA5A 4U7YA 2BS2A 1IBLT 3FXEB 2V8SV 2MBGA 5C8YE 2DLRA 4JI8T 2K9AA 2KMFA 5LJMA 4Z91A 1T8BA 5SYOA 5BP0A 3P4WA 3HKEE 2CCQA 5AFMA 1W9RA 2VASA 1Z8UA 1ZKEA 5FL0A 4AQFA 4UELA 1IAPA 3CQXC 2XAGB 4YSXA 4UM3P 3EDVA 3ZT6A 4UF0B 1I6ZA 3TLTA 1V9DA 4U31A 3RC3A 4DMVA 3ZMVB 4U33A 3SQ9A 1O3XA 3Q5WA 3EAMA 4F6RC 2BS4A 3FZKB 1IJ5A 3ZC1A 3O9XA 5DQVA 4B3ST 4DV6T 4ISSA 1IBKT 2Y7YA 3AE6A 5EK3A 4HFEA 4COFA 5AQVB 4CXWA 1D0XA 4IDQA 4CI2B 2XAFB 5HEUA 4WYVA 4MLKA 3KV6A 5KZUA 4JBWF 3RX6A 3NZQA 4GKKT 5CFBA 5HWYA 3CKDA 5CA1E 5JDLA 3B57A 3FXDB 3Q5EA 5HEHA 4ZHQE 1T98A 2PJQA 5L3FB 5L47A 4HGAA 5HXSA 1BR2A 4WZXA 2Y48B 3KV9A 2H3RA 3DTOA 2WAUA 3AA7B 2X67A 3TLUA 2XNTA 3ZSTA 4KP3C 1U5PA 3U8KA 4AQGA 3SS1A 2WMNA 3KINB 4DR2T 4EYUA 1HG5A 4DV4T 2K24A 2YN6A 2N1GA 4ZXLA 3AA0B 3AXJB 4QH4A 4DV3T 2WP9A 1T7SA 2FBWA 5LBMA 4WBNE 3PUWF 4WW0A 4G2AA 4FJOA 2W63A 2AXDS 1SHZC 1ZV4X 4AIUA 4GYRA 4UV8B 3WAJA 3LK2B 5HWXA 2FJEA 2UXCT 1Y64B 4H9PC 4FI5A 3DP7A 2OV9A 1J1JA 2QA7A 4A56A 4HFIA 3U3IA 3HR0A 4EEBA 5L4EA 3HKDE 2V1DB 2UUCT 3JCFA 4NUVA 5EZYE 2K3WA 2LHNA 2YEVC 3KV5A 5EK2A 4AKHA 4ISTA 5J5GA 3HKBE 5LMNT 1YQ3A 3M65A 3WTJA 2KSRA 3CK6A 2Y54A 3AAEB 4UF0A 2Y6XA 3ZMUB 5F3JA 2IAKA 3AEDA 2LE8A 3ZCJA 5TVCA 3QNUA 1VOMA 3ETUA 3EABA 4MFRA 2LSKA 3B5MA 2I0MA 4YTNA 5HCJA 5FYMA 3N9OA 1Y01A 2VB6A 4ZZCA 4TN7B 3UTKA 3I9YA 2E9XB 2CWYA 4PJMA 4IE0A 4UVBB 4U2ZA 1JNRA 4U74A 2MOZA 4HFCA 2WNLA 4IL4A 4P0BA 4AFTA 1UV6A 5J2UE 4PK6A 1NWMX 5DABA 5JDHA 4GIWA 5FL1A 4HWFA 4KUMB 2PTFA 3FBZA 3EHZA 1EZ3A 2CHOA 2WNJA 3WTNA 5AQQB 4IE6A 4A5XA 4PK5A 4TNWA 4I50E 3GUAA 1OEDB 2X51A 4ERRA 2PG8A 4QXHB 3SIOA 3AVRA 4HQPA 3IHRA 1U4QA 2CRBA 2UU9T 1HX1B 3C64A 5HYAA 3A5XA 3WTLA 5HXCA 1YXRA 4IE4A 2XSBA 3A7MA 2LKGA 3NBXX 3PUAA 5L3EB 4LF6T 2KLQA 5AQUB 3IEEA 3QC9A 3AXJA 4IE5A 3RKGA 4IGUA 3QUJA 5HXHA 3SFDA 2BVMA 1UURA 2XZEA 2JQQA 3L39A 1FIOA 2XQ3A 4IL9A 2VL8A 3WTHA 3JAEA 5FY7A 3UU8A 1MMDA 4N78D 2PBIA 3IBPA 3UU5A 3RPUA 4UY2A 2HPLA 4QACA 2Y8DA 3P4PA 3L09A 3RIUC 1HNWT 1Z0PA 2VVNA 2W8GA 1XZYA 2XQ9A 4YSZA 5AINA 5HAXA 4H9OC 4ILAA 3AE1A 1D0YA 2N9DA 3KVBA 3RIFA 4PFOA 5FP3A 3E22E 3ZN1B 5ADXL 3KBTA 5AQLB 2M6BA 3I0OA 2ODVA 3FB2A 1DU2A 3S4UA 3UUXB 1YKEB 3MJXA 2HN2A 2WWVA 4EXTA 5BR8T 3GN5B 3QK6A 4TZ4C 1US7B 3TLVA 3L3PA 4NXMT 2G0UA 3T8OA 2CA5A 3IGQA 1QSDA 3P50A 2UZ6A 2LSGA 4DV1T 3VR9A 5JDNA 2WZYA 2VL0A 1BR1A 4LF5T 1IBMT 4H63V 2D2SA 4YJ3E 2DWGA 2IUBA 3EVYA 4UR9A 4I0UA 4LMKA 2E9XA 4PFPA 3OYZA 4M1PA 4EZHA 4B3RT 3W15B 3H37A 5H6RB 2KINB 4O8SA 2GK9A 2CPTA 2YOEA 3ZLIA 2BKPA 4O2AE 3V5SA 5FXXA 1W09A 4X64T 3Q9DA 2ACXA 3FBLA 2BG9E 2E2AA 4YJ2E 2UXNB 4EOZB 1D1AA 3C98B 3N5LA 2H88A 3ZMSB 4DV5T 1KNZA 4CXXA 3U8JA 2JPFA 3OBVE 2BS3A 3BQKA 4XAXB 3UFGA 5CO5A 3UT5E 4X1YE 5LYJE 3ZMTB 3SOLA 2XY8B 3ZSSA 1XWMA 2XQ7A 4HN9A 3LDQB 1N32T 3AEGA 1OEDA 2Q9QC 4DR4T 3LG7A 3VR8A 5CB4E 4ILUA 3WI3A 2Z6EA 3E08A 4O4LE 5AQSB 5JRCB 4WNKA 4E7ZA 4IDOA 2NTXA 5AFHA 2BBJA 4BA9A 3ANWB 2W61A 4UEMA 5FKYA 4YHJA 1NEKA 3RYCE 3Q5XA 2D9DA 4HKAA 5HXRA 3K8PC 2XASB 3VHLA 1WFDA 5FNVE 3AAAB 5KX5E 4YTPA 3CX8B 5LB7B 3QB5K 2DWKA 2XYSA 1N36T 1FMVA 4HTEA 3RC8A 1KFYA 4A97A 1M7KA 2W0GA 3CIRA 1MIWA 2BR7A 3PMZA 4KI0F 1D1BA 5ABGA 2XAHB 2HHHT 2BDEA 3ETVA 3C4XA 3BQIA 1UX2A 2UUAT 2DI4A 2BYNA 1G73A 5LP6E 3WTIA 3C51A 4PW8A 4LMJA 5LHHB 2PH9A 2JRKA 3K1SA 2C5JA 3F2EA 4PAGA 1B7TA 1CHUA 2XQYA 3SRZA 4PJJA 5J0ZA 1HNXT 3OKQA 5J1GA 2EHOC 3AECA 1MMAA 3VKHA 3VKGA 3GN5A 4AKIA 2LSIA 2VK9A 1XMOT 3GA8A 3N9PA
chains in the Genus database with same CATH topology
4HFDA 3ZKRA 2BYRA 3U8MA 2YKSA 5IUXA 3U8KA 3TLTA 4B5DA 3P50A 2M6IA 5HCMA 4F8HA 3WTLA 2WNCA 4TNVA 5AFHA 2UZ6A 2XQAA 3C79A 2LKGA 2WZYA 3SQ9A 4AFHA 2YMEA 2VL0A 3EAMA 5HEJA 5BRXA 4PIRA 5TVCA 4QH5A 3WTKA 5J5FA 2BG9C 4TWDA 2YN6A 5J5IA 2XQ6A 4ZRUA 3UU4A 3LSVA 3WTMA 4AFGA 4QH4A 2XYTA 3RHWA 4ILCA 4UXUA 2C9TA 2BJ0A 5AFNA 5HCJA 4QH1A 5L4HA 5J5HA 5AFLA 2LLYA 4IREA 3WTOA 5FJVA 4ZZBA 5LXBA 4ZZCA 2XYSA 2XQ3A 4IL9A 5LG3A 4BFQA 2Y7YA 2XQ5A 4HFEA 4LMKA 4A97A 2XNVA 3WTHA 3ZDGA 5BW2A 3JAEA 3UU6A 3SH1A 4COFA 3UU8A 2XQ8A 5HEGA 2ZJVA 3UU5A 2BYSA 4UY2A 2LM2A 4WV9A 2ZJUA 2BR7A 4QACA 4HFBA 4A98A 1OEDC 3PMZA 2W8FA 5HEUA 4EZ1A 4ZK1A 2YOEA 4BQTA 2QC1B 2W8GA 4NZBA 4QAAA 5HEOA 5AFJA 1UX2A 3TLWA 4XHEA 3UQ4A 5KZUA 2WN9A 4HFCA 2BG9E 4IL4A 2XQ9A 3UU3A 2BYNA 2WNLA 3WTIA 5CFBA 4UM1A 3UQ7A 5AINA 4DBMA 4ILAA 4LMJA 3UUBA 3U8NA 2PH9A 4AFTA 4HFIA 1UV6A 3RIAA 3RIFA 2BG9A 3WIPA 3SQ6A 4TWFA 5L4EA 3PEOA 3U8JA 3EI0A 4Z90A 2BG9B 4ALXA 4UM3A 2XQ4A 2Y57A 2Y58A 3RQUA 1I9BA 5JMEA 5CO5A 4LMLA 5HEHA 3U8LA 2XZ6A 2M6BA 4HFHA 1UW6A 5KE4A 5J0ZA 3EHZA 4ILBA 4D01A 4TWHA 4ZJTA 5L47A 2WNJA 2X00A 4NPPA 2XQ7A 1OEDE 3RI5A 2BYQA 3TLSA 3WTNA 3JAFA 4X5TA 2XZ5A 2X00D 2Y56A 5J5GA 5AFKA 4Z91A 2PGZA 4FRRA 5SYOA 5BP0A 3P4WA 1OEDA 5AFMA 3TLVA 2LKHA 4ZJSA 3ZDHA 4TNWA 4QABA 4XK9A 3WTJA 3RQWA 3C84A 3GUAA 2KSRA 1OEDB 3JADA 2XNUA 2BR8A 5AFMB 2MAWA 3T4MA 4UM3S 2YMDA 2Y54A 3TLUA 4ZR6A 3IGQA 3SIOA 4UM3P 4HQPA 4ZK4A 2XNTA 2BYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFD A;  3ZKR A;  2BYR A;  3U8M A;  2YKS A;  5IUX A;  3U8K A;  3TLT A;  4B5D A;  3P50 A;  2M6I A;  5HCM A;  4F8H A;  3WTL A;  2WNC A;  4TNV A;  5AFH A;  2UZ6 A;  2XQA A;  3C79 A;  2LKG A;  2WZY A;  3SQ9 A;  4AFH A;  2YME A;  2VL0 A;  3EAM A;  5HEJ A;  5BRX A;  4PIR A;  5TVC A;  4QH5 A;  3WTK A;  5J5F A;  2BG9 C;  4TWD A;  2YN6 A;  5J5I A;  2XQ6 A;  4ZRU A;  3UU4 A;  3LSV A;  3WTM A;  4AFG A;  4QH4 A;  2XYT A;  3RHW A;  4ILC A;  4UXU A;  2C9T A;  2BJ0 A;  5AFN A;  5HCJ A;  4QH1 A;  5L4H A;  5J5H A;  5AFL A;  2LLY A;  4IRE A;  3WTO A;  5FJV A;  4ZZB A;  5LXB A;  4ZZC A;  2XYS A;  2XQ3 A;  4IL9 A;  5LG3 A;  4BFQ A;  2Y7Y A;  2XQ5 A;  4HFE A;  4LMK A;  4A97 A;  2XNV A;  3WTH A;  3ZDG A;  5BW2 A;  3JAE A;  3UU6 A;  3SH1 A;  4COF A;  3UU8 A;  2XQ8 A;  5HEG A;  2ZJV A;  3UU5 A;  2BYS A;  4UY2 A;  2LM2 A;  4WV9 A;  2ZJU A;  2BR7 A;  4QAC A;  4HFB A;  4A98 A;  1OED C;  3PMZ A;  2W8F A;  5HEU A;  4EZ1 A;  4ZK1 A;  2YOE A;  4BQT A;  2QC1 B;  2W8G A;  4NZB A;  4QAA A;  5HEO A;  5AFJ A;  1UX2 A;  3TLW A;  4XHE A;  3UQ4 A;  5KZU A;  2WN9 A;  4HFC A;  2BG9 E;  4IL4 A;  2XQ9 A;  3UU3 A;  2BYN A;  2WNL A;  3WTI A;  5CFB A;  4UM1 A;  3UQ7 A;  5AIN A;  4DBM A;  4ILA A;  4LMJ A;  3UUB A;  3U8N A;  2PH9 A;  4AFT A;  4HFI A;  1UV6 A;  3RIA A;  3RIF A;  2BG9 A;  3WIP A;  3SQ6 A;  4TWF A;  5L4E A;  3PEO A;  3U8J A;  3EI0 A;  4Z90 A;  2BG9 B;  4ALX A;  4UM3 A;  2XQ4 A;  2Y57 A;  2Y58 A;  3RQU A;  1I9B A;  5JME A;  5CO5 A;  4LML A;  5HEH A;  3U8L A;  2XZ6 A;  2M6B A;  4HFH A;  1UW6 A;  5KE4 A;  5J0Z A;  3EHZ A;  4ILB A;  4D01 A;  4TWH A;  4ZJT A;  5L47 A;  2WNJ A;  2X00 A;  4NPP A;  2XQ7 A;  1OED E;  3RI5 A;  2BYQ A;  3TLS A;  3WTN A;  3JAF A;  4X5T A;  2XZ5 A;  2X00 D;  2Y56 A;  5J5G A;  5AFK A;  4Z91 A;  2PGZ A;  4FRR A;  5SYO A;  5BP0 A;  3P4W A;  1OED A;  5AFM A;  3TLV A;  2LKH A;  4ZJS A;  3ZDH A;  4TNW A;  4QAB A;  4XK9 A;  3WTJ A;  3RQW A;  3C84 A;  3GUA A;  2KSR A;  1OED B;  3JAD A;  2XNU A;  2BR8 A;  5AFM B;  2MAW A;  3T4M A;  4UM3 S;  2YMD A;  2Y54 A;  3TLU A;  4ZR6 A;  3IGQ A;  3SIO A;  4UM3 P;  4HQP A;  4ZK4 A;  2XNT A;  2BYP A; 
#chains in the Genus database with same CATH topology
 1UK5 A;  3PUY F;  1J5E T;  2M6I A;  2BZB A;  4CZZ B;  2IC6 A;  1KNP A;  2B1E A;  4H9N C;  2A3D A;  3AEF A;  3FZM B;  4Q25 A;  3AE9 A;  5JH7 E;  3ZT7 A;  4UXN B;  3G06 A;  2BG9 C;  2XQ6 A;  4OK0 A;  2V5C A;  2JIW A;  2AE9 A;  3N9L A;  4O4I E;  2CM0 A;  4H9R C;  2WQY A;  2WM9 A;  4CN6 A;  4QKN A;  4HFB A;  2L3L A;  3BK9 A;  1WLX A;  2WDV A;  4HWD A;  2V7K A;  5HEO A;  5LBQ B;  3U78 A;  2WDR A;  5LG4 A;  1HG2 A;  3Q5D A;  3UQ7 A;  3F57 A;  3NZP A;  4CXY A;  3I9W A;  2E5L T;  2SPC A;  5AQT B;  2W00 A;  1YKH B;  2XZ6 A;  5IHY A;  5KE4 A;  3ONX A;  1HS7 A;  2W66 A;  3PJA J;  3BQL A;  4B3M T;  2XTL A;  4DV7 T;  4L9I A;  4XK9 A;  5M4Y A;  3JAD A;  2YIN A;  3HKC E;  1BR4 A;  3MZK B;  3FZH B;  4QXC B;  3ZMZ B;  4AKG A;  5JRC A;  1N34 T;  1UX4 A;  3PJA A;  3HL6 A;  4UV9 B;  3E0Z A;  4KX6 A;  3ANW A;  1HFA A;  2WU5 A;  3O1I A;  3PU8 A;  5HXE A;  4U7I A;  4CQI A;  4AKR B;  2DNX A;  3UU4 A;  3AE3 A;  3ZC0 A;  2ZLY A;  4GK5 E;  5KXJ A;  3MK7 C;  4DBQ A;  3OVU A;  3VRA A;  3KDS E;  4BFQ A;  4DR3 T;  2JMH A;  5JDM A;  5LMU T;  2F4V T;  2XQ5 A;  3RRC A;  1UCU A;  3LJC A;  4JI5 T;  2BVL A;  2Q9Q D;  5FMN A;  1I94 T;  4EZ1 A;  2LOS A;  4QX7 B;  2XJ7 A;  3A8Y C;  1HCI A;  5CGM A;  5J2T E;  5ETW A;  2WZI A;  1D1C A;  2WN9 A;  3P4R A;  4EV6 A;  4YFS A;  3P8C D;  3HA4 A;  4DBM A;  1HR0 T;  5JDG A;  2J4G A;  4IE7 A;  3ZYK A;  1KNR A;  3GMI A;  1R8I A;  3NRX A;  3ZEF B;  4I55 E;  4ALX A;  2J1D G;  3K3N A;  2ZMA A;  4DR6 T;  3PU3 A;  2BYQ A;  3RYH E;  2L8K A;  5H6Q B;  4X5T A;  4BJM A;  5AQH B;  4ZJS A;  4QAB A;  2XNU A;  2IHR 1;  1YQ4 A;  3AAI A;  3I0Q A;  2XSA A;  4TUY E;  4ZK4 A;  4I43 B;  3OYX A;  3VU7 H;  3UUL A;  3U8M A;  2V5D A;  1XMQ T;  5DJQ C;  2VUR A;  2A2F X;  2R6G F;  5FVK A;  5LHI B;  4P0A A;  4JI3 T;  4XBF B;  4YTM A;  1WR0 A;  5LGU B;  1WRD A;  1NAF A;  3PTR B;  4TWD A;  3RLF F;  4ZRU A;  2KXP B;  2XUE A;  3WTM A;  4IT4 A;  3RHW A;  3NVO A;  4DR7 T;  4OX9 T;  3FZL B;  2EHO D;  3ZJ1 A;  5JVD E;  1CUN A;  2K48 A;  3LBX B;  2ZJV A;  5FY1 A;  3KV4 A;  4AXP A;  3NRY A;  2ZJU A;  4L0R A;  2ES0 A;  4JI6 T;  3C50 A;  2VQE T;  2V7J A;  5JTG A;  2NP9 A;  3LK4 2;  3KVA A;  2QRX A;  4YY3 T;  3UQ4 A;  4MAL A;  2FJA A;  2KND A;  2X66 A;  3AE7 A;  2JQ9 A;  3ESL A;  5JR9 C;  3NWI A;  4G63 A;  3AE4 A;  2OLT A;  2FJB A;  4MBQ A;  2JQK A;  3ZPO A;  1UW6 A;  2KZ7 B;  1OXZ A;  3VRB A;  4ANJ A;  4DBR A;  4ZJT A;  2CLY B;  3J9X 1;  3RI5 A;  3MKD A;  2LT3 A;  3JAF A;  2V7M A;  4OYK A;  2HH7 A;  3ZDH A;  3QB5 A;  4NXN T;  3MXZ A;  2BR8 A;  5FXV A;  3O1H A;  2YK0 A;  4KBM B;  4Z8X A;  4IHJ E;  1KEY A;  4U72 A;  1AJ3 A;  4F8H A;  2KWH A;  2XQA A;  4ADZ A;  2RA1 A;  2KWI B;  3F31 A;  1E7P A;  3WTK A;  5FY0 A;  5J5I A;  1VCT A;  2X9H A;  3LSV A;  4HWI B;  4L5G A;  1E1H B;  2X9Y A;  4YSY A;  5LNK A;  5IYZ E;  3ABV A;  3EUH A;  2Q9Q B;  4WV9 A;  4AI6 A;  2QGS A;  4EGW A;  3RGL A;  4AQF C;  4ZK1 A;  4LF4 T;  2JJ9 A;  2QC1 B;  4KHZ F;  3ZCI A;  3PUS A;  2CWO A;  3KBU A;  4GYS A;  4O2B E;  4AQY T;  5AQN B;  3C4Z A;  2RPA A;  3WIP A;  4YXD A;  4Z90 A;  4UM3 A;  2BBH A;  2XPK A;  3UUM A;  2HPJ A;  4I4T E;  2VKH A;  5LOV E;  2VVS A;  1SA0 E;  1IJ6 A;  4OHF A;  4ZI3 C;  3RH3 A;  3O1J A;  1MMN A;  2X00 D;  5FVL A;  4C91 A;  3CWZ B;  1ZP0 A;  3RIU A;  1M62 A;  5C2T A;  3N2K E;  4MHC A;  4IDP A;  2I59 A;  4B5D A;  2MTQ A;  4JYA T;  2V6Y B;  2A9U A;  2WNC A;  4GK0 E;  2X0L B;  4DR1 T;  3UUN A;  4GKJ T;  1ZHC A;  4QXB B;  4UVA B;  5LA6 E;  4UXU A;  2WU2 A;  4QH1 A;  3WTO A;  5LXB A;  2YU1 A;  2VKJ A;  2P9B A;  4IIJ E;  2EHO B;  3N2O A;  4OFZ A;  3P4Q A;  3LBX A;  3SH1 A;  1L0V A;  2XQ8 A;  4B6X A;  5FXZ A;  3R84 B;  5AQF B;  2LM2 A;  4ASK A;  5A1L A;  2W67 A;  2YDQ A;  2WZH A;  4KHP T;  4ZI7 E;  2DL1 A;  3EDU A;  5ABF B;  3TLW A;  2FJD A;  4XHE A;  4K0K T;  4QX8 B;  5TAO A;  4UM1 A;  1LRZ A;  3ZYM A;  3H3A A;  4HWC A;  4DV0 T;  2BG9 B;  4DO0 A;  2NW9 A;  4K0U A;  3LFM A;  1LVK A;  4P09 A;  1MMG A;  3GWH A;  4ILB A;  4D01 A;  2W62 A;  1LVF A;  4NPP A;  4CI1 B;  1HF8 A;  3TLS A;  2V7L A;  3ZYL A;  3RRW A;  4XZC A;  1WR6 A;  3RQW A;  3SWH A;  4LF7 T;  2FUP A;  3Q2M A;  2D5U A;  2XAJ B;  4H9Q C;  1FEW A;  5BMV E;  1WYC A;  2XHE B;  4ZS3 A;  3OTO T;  1HNZ T;  4P1N A;  4EIW A;  2NTY A;  4IDZ A;  4JLE A;  5IUX A;  4H63 H;  2CBI A;  3PE0 A;  1WYB A;  2E9X D;  5HEJ A;  3ONJ A;  4J2C A;  1HX8 A;  4QH5 A;  5J5F A;  4DND A;  4AFG A;  5AFN A;  5J5H A;  5L4H A;  5AFL A;  4HE8 A;  3ONL C;  3N9M A;  3M3Z B;  3DJB A;  1MND A;  2CMR A;  2Q9Q A;  4LFC T;  2A72 A;  3K3Q C;  2CE7 A;  2N2N A;  4TV8 E;  4CN4 A;  1XDO A;  5FXW A;  1MIV A;  1SUM B;  2JQH A;  4H9S E;  3PUR A;  5LXT E;  2QVA A;  3O4X E;  1W0A A;  3P4S A;  3U8N A;  3N2G E;  5AQK B;  3RIA A;  2RP4 A;  4TWF A;  4X20 E;  1FMW A;  4YLH A;  3PEO A;  2CXL A;  1OWA A;  3PUZ F;  2JMK A;  2LSY A;  4X1K E;  5JQG E;  2C0S A;  4JI1 T;  3PV0 F;  2VWA A;  3RYI E;  4TV9 E;  4E7S A;  2CXF A;  4YHH T;  2WSS V;  4GOU A;  2BKO A;  2Y56 A;  3NKZ A;  3PUV F;  3C84 A;  5L3G B;  5ABE A;  2ZM2 A;  3X1D A;  4U2Y A;  2C5I T;  2V6Y A;  2ZM0 A;  2CHN A;  2YKS A;  3D0T A;  4PJN A;  2X68 A;  3C79 A;  2ODU A;  2YME A;  4BAY B;  4HEA A;  5AFU L;  5LCY A;  2V7I A;  1LKX A;  2ZM8 A;  1KK7 A;  2WY2 A;  4UIG A;  2C9T A;  2EHO A;  3AE2 A;  1S94 A;  5FJV A;  4DID B;  3MAC A;  1BR0 A;  4ZI3 D;  4JEH B;  3AEB A;  2J62 A;  2BYS A;  5ABH A;  1ZEE A;  4BJN A;  1QLB A;  4PK4 A;  5JDF A;  2K5B B;  3L8R A;  5ABF A;  3IF8 B;  4BQT A;  4QAA A;  1VRB A;  1G8X A;  2YU2 A;  1X9B A;  3UU3 A;  2J47 A;  3T1H T;  3B13 A;  2WWU A;  3ZN0 B;  2UUB T;  3CQG B;  5KDM C;  2BG9 A;  2H89 A;  2CBJ A;  5AQO B;  2WBL A;  3RQU A;  2M67 A;  1FJG T;  2LRL A;  4LFA T;  2NOX A;  4TWH A;  3JC6 D;  1OED E;  4X65 T;  4JV5 T;  2VKO A;  2IW5 B;  5LGT B;  4OYJ A;  4ZI2 C;  2IDO B;  2YDR A;  4LF8 T;  2BKN A;  3K3O A;  4LFB T;  4EYY R;  4ZR6 A;  1KF6 A;  2BYP A;  4EZ4 A;  5L2L A;  4X66 T;  2LHR A;  4ZOL E;  1IZN B;  3AB3 B;  3FHN A;  4AFH A;  5JR9 B;  4PIR A;  1W0B A;  1S35 A;  2LOP A;  3CVR A;  2LSJ A;  3C4W A;  2NW8 A;  2CXD A;  2X0Y A;  1H7C A;  4NIQ A;  3UFE A;  1MIY A;  2BJ0 A;  1NEN A;  4B3T T;  3LK3 B;  4O4J E;  2X0H A;  4KMC A;  2XNV A;  3ZDG A;  2XM1 A;  4DUZ T;  4PJL A;  5HEG A;  2XAQ B;  3CPZ A;  4A98 A;  4PNI A;  2W8F A;  4YT0 A;  1JNZ A;  3V5U A;  5CJ5 A;  1D0Z A;  2IC9 A;  4HWH A;  2XM2 A;  3AA1 B;  4NUU A;  2V26 A;  3PDY A;  3EI0 A;  4O4H E;  3ZJ2 A;  4DR5 T;  2MYS A;  3RF1 A;  2XQ4 A;  2WDQ A;  4JUY A;  4EAH A;  3IA3 A;  5AQP B;  2Y58 A;  5JME A;  3WAK A;  4X62 T;  5L3B B;  3OPC A;  4HFH A;  3SFE A;  3AA6 B;  2X00 A;  2IIU A;  5JRE A;  2LEH A;  2NW7 A;  4DVD A;  3PUQ A;  3QOF A;  5LGN B;  3PUG A;  4FRR A;  2L9Q A;  2E9X C;  1YD8 G;  5AFM B;  2MAW A;  3T4M A;  4UM3 S;  4JI2 T;  3N9N A;  4HFD A;  5GON E;  1X79 A;  2KT9 A;  1UX5 A;  4X1I E;  4QHO A;  2NWB A;  5E0O A;  3AVS A;  2H7V C;  3FZF B;  5BRX A;  5LHG B;  2X9W A;  2D0T A;  3RKO A;  5AQR B;  4C90 A;  2XYT A;  1UUS A;  1VCS A;  5EK4 A;  3PUX F;  4EED A;  4DUY T;  5F8P A;  4ZZB A;  1QUU A;  3KFW X;  2DCF A;  4JI4 T;  5DQW A;  5BW2 A;  3UU6 A;  5CA0 E;  2ZM6 T;  2IML A;  2PFV A;  4HFV A;  2UXX B;  3N9Q A;  2HN1 A;  1OED C;  4CN1 A;  2UXD T;  2CEA A;  4JI0 T;  3CML A;  4IDN A;  5F5W A;  2W2U A;  1XNQ T;  2X9X A;  4AIS A;  1ZOY A;  4DMW A;  2WB5 A;  5JDQ A;  2NR4 A;  2C5K T;  3SQ6 A;  2VKD A;  4EB6 E;  2QYW A;  5AQJ B;  1I9B A;  4LML A;  3AE8 A;  1UGO A;  3U8L A;  2E5V A;  3AE5 A;  3CX6 B;  1E2A A;  2XZ5 A;  5AFK A;  2PGZ A;  3CX7 B;  1MNE A;  1T72 A;  3P7I A;  2LKH A;  5AQG B;  3TKL B;  2V6X A;  4WBO A;  2YMD A;  4AKL A;  1WCR A;  2LM9 A;  3ZKR A;  2BYR A;  2CLY C;  4CI3 B;  1J5W A;  2MPK A;  2I6H A;  5C3J A;  2ACZ A;  5HCM A;  5LJN A;  5JR9 A;  4TNV A;  4LF9 T;  2B76 A;  2WMO A;  2D0U A;  4ZEY A;  3HI2 A;  3AEE A;  1N33 T;  3MA9 A;  3OJA A;  3R6N A;  3ZT5 A;  2YDS A;  4UVC B;  4ZS2 A;  4ILC A;  3J7Y q;  2VQF T;  2LLY A;  4QWN B;  4IRE A;  4U3C A;  5AQI B;  2LRK A;  5LG3 A;  5AQM B;  4ZI2 D;  3T1Y T;  1GQE A;  4V1A v;  5KMG P;  2E8I A;  5L3D B;  1YW0 A;  4TX5 A;  2W4X A;  3CQC B;  1XDP A;  2WCA A;  3I1A A;  2WS3 A;  4JEU B;  4NZB A;  4DV2 T;  3AEA A;  5AFJ A;  2UXB T;  3JC6 C;  3H3M A;  1SE7 A;  1XNR T;  1HTJ F;  3UUB A;  2H7O A;  5L3C B;  2LJL A;  3RYF E;  4JI7 T;  5IWA T;  2Y57 A;  2DHR A;  2OA5 A;  4U7Y A;  2BS2 A;  1IBL T;  3FXE B;  2V8S V;  2MBG A;  5C8Y E;  2DLR A;  4JI8 T;  2K9A A;  2KMF A;  5LJM A;  4Z91 A;  1T8B A;  5SYO A;  5BP0 A;  3P4W A;  3HKE E;  2CCQ A;  5AFM A;  1W9R A;  2VAS A;  1Z8U A;  1ZKE A;  5FL0 A;  4AQF A;  4UEL A;  1IAP A;  3CQX C;  2XAG B;  4YSX A;  4UM3 P;  3EDV A;  3ZT6 A;  4UF0 B;  1I6Z A;  3TLT A;  1V9D A;  4U31 A;  3RC3 A;  4DMV A;  3ZMV B;  4U33 A;  3SQ9 A;  1O3X A;  3Q5W A;  3EAM A;  4F6R C;  2BS4 A;  3FZK B;  1IJ5 A;  3ZC1 A;  3O9X A;  5DQV A;  4B3S T;  4DV6 T;  4ISS A;  1IBK T;  2Y7Y A;  3AE6 A;  5EK3 A;  4HFE A;  4COF A;  5AQV B;  4CXW A;  1D0X A;  4IDQ A;  4CI2 B;  2XAF B;  5HEU A;  4WYV A;  4MLK A;  3KV6 A;  5KZU A;  4JBW F;  3RX6 A;  3NZQ A;  4GKK T;  5CFB A;  5HWY A;  3CKD A;  5CA1 E;  5JDL A;  3B57 A;  3FXD B;  3Q5E A;  5HEH A;  4ZHQ E;  1T98 A;  2PJQ A;  5L3F B;  5L47 A;  4HGA A;  5HXS A;  1BR2 A;  4WZX A;  2Y48 B;  3KV9 A;  2H3R A;  3DTO A;  2WAU A;  3AA7 B;  2X67 A;  3TLU A;  2XNT A;  3ZST A;  4KP3 C;  1U5P A;  3U8K A;  4AQG A;  3SS1 A;  2WMN A;  3KIN B;  4DR2 T;  4EYU A;  1HG5 A;  4DV4 T;  2K24 A;  2YN6 A;  2N1G A;  4ZXL A;  3AA0 B;  3AXJ B;  4QH4 A;  4DV3 T;  2WP9 A;  1T7S A;  2FBW A;  5LBM A;  4WBN E;  3PUW F;  4WW0 A;  4G2A A;  4FJO A;  2W63 A;  2AXD S;  1SHZ C;  1ZV4 X;  4AIU A;  4GYR A;  4UV8 B;  3WAJ A;  3LK2 B;  5HWX A;  2FJE A;  2UXC T;  1Y64 B;  4H9P C;  4FI5 A;  3DP7 A;  2OV9 A;  1J1J A;  2QA7 A;  4A56 A;  4HFI A;  3U3I A;  3HR0 A;  4EEB A;  5L4E A;  3HKD E;  2V1D B;  2UUC T;  3JCF A;  4NUV A;  5EZY E;  2K3W A;  2LHN A;  2YEV C;  3KV5 A;  5EK2 A;  4AKH A;  4IST A;  5J5G A;  3HKB E;  5LMN T;  1YQ3 A;  3M65 A;  3WTJ A;  2KSR A;  3CK6 A;  2Y54 A;  3AAE B;  4UF0 A;  2Y6X A;  3ZMU B;  5F3J A;  2IAK A;  3AED A;  2LE8 A;  3ZCJ A;  5TVC A;  3QNU A;  1VOM A;  3ETU A;  3EAB A;  4MFR A;  2LSK A;  3B5M A;  2I0M A;  4YTN A;  5HCJ A;  5FYM A;  3N9O A;  1Y01 A;  2VB6 A;  4ZZC A;  4TN7 B;  3UTK A;  3I9Y A;  2E9X B;  2CWY A;  4PJM A;  4IE0 A;  4UVB B;  4U2Z A;  1JNR A;  4U74 A;  2MOZ A;  4HFC A;  2WNL A;  4IL4 A;  4P0B A;  4AFT A;  1UV6 A;  5J2U E;  4PK6 A;  1NWM X;  5DAB A;  5JDH A;  4GIW A;  5FL1 A;  4HWF A;  4KUM B;  2PTF A;  3FBZ A;  3EHZ A;  1EZ3 A;  2CHO A;  2WNJ A;  3WTN A;  5AQQ B;  4IE6 A;  4A5X A;  4PK5 A;  4TNW A;  4I50 E;  3GUA A;  1OED B;  2X51 A;  4ERR A;  2PG8 A;  4QXH B;  3SIO A;  3AVR A;  4HQP A;  3IHR A;  1U4Q A;  2CRB A;  2UU9 T;  1HX1 B;  3C64 A;  5HYA A;  3A5X A;  3WTL A;  5HXC A;  1YXR A;  4IE4 A;  2XSB A;  3A7M A;  2LKG A;  3NBX X;  3PUA A;  5L3E B;  4LF6 T;  2KLQ A;  5AQU B;  3IEE A;  3QC9 A;  3AXJ A;  4IE5 A;  3RKG A;  4IGU A;  3QUJ A;  5HXH A;  3SFD A;  2BVM A;  1UUR A;  2XZE A;  2JQQ A;  3L39 A;  1FIO A;  2XQ3 A;  4IL9 A;  2VL8 A;  3WTH A;  3JAE A;  5FY7 A;  3UU8 A;  1MMD A;  4N78 D;  2PBI A;  3IBP A;  3UU5 A;  3RPU A;  4UY2 A;  2HPL A;  4QAC A;  2Y8D A;  3P4P A;  3L09 A;  3RIU C;  1HNW T;  1Z0P A;  2VVN A;  2W8G A;  1XZY A;  2XQ9 A;  4YSZ A;  5AIN A;  5HAX A;  4H9O C;  4ILA A;  3AE1 A;  1D0Y A;  2N9D A;  3KVB A;  3RIF A;  4PFO A;  5FP3 A;  3E22 E;  3ZN1 B;  5ADX L;  3KBT A;  5AQL B;  2M6B A;  3I0O A;  2ODV A;  3FB2 A;  1DU2 A;  3S4U A;  3UUX B;  1YKE B;  3MJX A;  2HN2 A;  2WWV A;  4EXT A;  5BR8 T;  3GN5 B;  3QK6 A;  4TZ4 C;  1US7 B;  3TLV A;  3L3P A;  4NXM T;  2G0U A;  3T8O A;  2CA5 A;  3IGQ A;  1QSD A;  3P50 A;  2UZ6 A;  2LSG A;  4DV1 T;  3VR9 A;  5JDN A;  2WZY A;  2VL0 A;  1BR1 A;  4LF5 T;  1IBM T;  4H63 V;  2D2S A;  4YJ3 E;  2DWG A;  2IUB A;  3EVY A;  4UR9 A;  4I0U A;  4LMK A;  2E9X A;  4PFP A;  3OYZ A;  4M1P A;  4EZH A;  4B3R T;  3W15 B;  3H37 A;  5H6R B;  2KIN B;  4O8S A;  2GK9 A;  2CPT A;  2YOE A;  3ZLI A;  2BKP A;  4O2A E;  3V5S A;  5FXX A;  1W09 A;  4X64 T;  3Q9D A;  2ACX A;  3FBL A;  2BG9 E;  2E2A A;  4YJ2 E;  2UXN B;  4EOZ B;  1D1A A;  3C98 B;  3N5L A;  2H88 A;  3ZMS B;  4DV5 T;  1KNZ A;  4CXX A;  3U8J A;  2JPF A;  3OBV E;  2BS3 A;  3BQK A;  4XAX B;  3UFG A;  5CO5 A;  3UT5 E;  4X1Y E;  5LYJ E;  3ZMT B;  3SOL A;  2XY8 B;  3ZSS A;  1XWM A;  2XQ7 A;  4HN9 A;  3LDQ B;  1N32 T;  3AEG A;  1OED A;  2Q9Q C;  4DR4 T;  3LG7 A;  3VR8 A;  5CB4 E;  4ILU A;  3WI3 A;  2Z6E A;  3E08 A;  4O4L E;  5AQS B;  5JRC B;  4WNK A;  4E7Z A;  4IDO A;  2NTX A;  5AFH A;  2BBJ A;  4BA9 A;  3ANW B;  2W61 A;  4UEM A;  5FKY A;  4YHJ A;  1NEK A;  3RYC E;  3Q5X A;  2D9D A;  4HKA A;  5HXR A;  3K8P C;  2XAS B;  3VHL A;  1WFD A;  5FNV E;  3AAA B;  5KX5 E;  4YTP A;  3CX8 B;  5LB7 B;  3QB5 K;  2DWK A;  2XYS A;  1N36 T;  1FMV A;  4HTE A;  3RC8 A;  1KFY A;  4A97 A;  1M7K A;  2W0G A;  3CIR A;  1MIW A;  2BR7 A;  3PMZ A;  4KI0 F;  1D1B A;  5ABG A;  2XAH B;  2HHH T;  2BDE A;  3ETV A;  3C4X A;  3BQI A;  1UX2 A;  2UUA T;  2DI4 A;  2BYN A;  1G73 A;  5LP6 E;  3WTI A;  3C51 A;  4PW8 A;  4LMJ A;  5LHH B;  2PH9 A;  2JRK A;  3K1S A;  2C5J A;  3F2E A;  4PAG A;  1B7T A;  1CHU A;  2XQY A;  3SRZ A;  4PJJ A;  5J0Z A;  1HNX T;  3OKQ A;  5J1G A;  2EHO C;  3AEC A;  1MMA A;  3VKH A;  3VKG A;  3GN5 A;  4AKI A;  2LSI A;  2VK9 A;  1XMO T;  3GA8 A;  3N9P A; 
#chains in the Genus database with same CATH homology
 4HFD A;  3ZKR A;  2BYR A;  3U8M A;  2YKS A;  5IUX A;  3U8K A;  3TLT A;  4B5D A;  3P50 A;  2M6I A;  5HCM A;  4F8H A;  3WTL A;  2WNC A;  4TNV A;  5AFH A;  2UZ6 A;  2XQA A;  3C79 A;  2LKG A;  2WZY A;  3SQ9 A;  4AFH A;  2YME A;  2VL0 A;  3EAM A;  5HEJ A;  5BRX A;  4PIR A;  5TVC A;  4QH5 A;  3WTK A;  5J5F A;  2BG9 C;  4TWD A;  2YN6 A;  5J5I A;  2XQ6 A;  4ZRU A;  3UU4 A;  3LSV A;  3WTM A;  4AFG A;  4QH4 A;  2XYT A;  3RHW A;  4ILC A;  4UXU A;  2C9T A;  2BJ0 A;  5AFN A;  5HCJ A;  4QH1 A;  5L4H A;  5J5H A;  5AFL A;  2LLY A;  4IRE A;  3WTO A;  5FJV A;  4ZZB A;  5LXB A;  4ZZC A;  2XYS A;  2XQ3 A;  4IL9 A;  5LG3 A;  4BFQ A;  2Y7Y A;  2XQ5 A;  4HFE A;  4LMK A;  4A97 A;  2XNV A;  3WTH A;  3ZDG A;  5BW2 A;  3JAE A;  3UU6 A;  3SH1 A;  4COF A;  3UU8 A;  2XQ8 A;  5HEG A;  2ZJV A;  3UU5 A;  2BYS A;  4UY2 A;  2LM2 A;  4WV9 A;  2ZJU A;  2BR7 A;  4QAC A;  4HFB A;  4A98 A;  1OED C;  3PMZ A;  2W8F A;  5HEU A;  4EZ1 A;  4ZK1 A;  2YOE A;  4BQT A;  2QC1 B;  2W8G A;  4NZB A;  4QAA A;  5HEO A;  5AFJ A;  1UX2 A;  3TLW A;  4XHE A;  3UQ4 A;  5KZU A;  2WN9 A;  4HFC A;  2BG9 E;  4IL4 A;  2XQ9 A;  3UU3 A;  2BYN A;  2WNL A;  3WTI A;  5CFB A;  4UM1 A;  3UQ7 A;  5AIN A;  4DBM A;  4ILA A;  4LMJ A;  3UUB A;  3U8N A;  2PH9 A;  4AFT A;  4HFI A;  1UV6 A;  3RIA A;  3RIF A;  2BG9 A;  3WIP A;  3SQ6 A;  4TWF A;  5L4E A;  3PEO A;  3U8J A;  3EI0 A;  4Z90 A;  2BG9 B;  4ALX A;  4UM3 A;  2XQ4 A;  2Y57 A;  2Y58 A;  3RQU A;  1I9B A;  5JME A;  5CO5 A;  4LML A;  5HEH A;  3U8L A;  2XZ6 A;  2M6B A;  4HFH A;  1UW6 A;  5KE4 A;  5J0Z A;  3EHZ A;  4ILB A;  4D01 A;  4TWH A;  4ZJT A;  5L47 A;  2WNJ A;  2X00 A;  4NPP A;  2XQ7 A;  1OED E;  3RI5 A;  2BYQ A;  3TLS A;  3WTN A;  3JAF A;  4X5T A;  2XZ5 A;  2X00 D;  2Y56 A;  5J5G A;  5AFK A;  4Z91 A;  2PGZ A;  4FRR A;  5SYO A;  5BP0 A;  3P4W A;  1OED A;  5AFM A;  3TLV A;  2LKH A;  4ZJS A;  3ZDH A;  4TNW A;  4QAB A;  4XK9 A;  3WTJ A;  3RQW A;  3C84 A;  3GUA A;  2KSR A;  1OED B;  3JAD A;  2XNU A;  2BR8 A;  5AFM B;  2MAW A;  3T4M A;  4UM3 S;  2YMD A;  2Y54 A;  3TLU A;  4ZR6 A;  3IGQ A;  3SIO A;  4UM3 P;  4HQP A;  4ZK4 A;  2XNT A;  2BYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...