4HFEA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to ethanol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfeA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfeA01
5AFMB 3UUBA 3IGQA 1OEDE 4Z91A 4TNWA 5IUXA 4HFEA 2LKHA 3TLTA 3WTMA 4ZJTA 2LKGA 4ZK4A 5LG3A 2BG9E 4QAAA 1OEDC 3WTKA 2LM2A 3LSVA 3RIAA 3EHZA 2XYSA 2BYNA 5J5GA 4A98A 4NPPA 3U8MA 4IL9A 2YMDA 2W8FA 5AFKA 5J0ZA 4ZJSA 3U8LA 2PH9A 5SYOA 3ZKRA 2BG9C 5AFJA 1UV6A 3UQ4A 3RHWA 2W8GA 3UU5A 4TNVA 4ILBA 2QC1B 4PIRA 2XNUA 2YOEA 4AFGA 2Y57A 2MAWA 4UM1A 2BYPA 3SH1A 3ZDGA 5HEJA 3ZDHA 4BQTA 1UX2A 4ZK1A 5J5FA 4ZZBA 4UM3A 5L4EA 4COFA 2XQ3A 3U8KA 3P50A 2VL0A 4LMKA 5HEOA 2Y56A 2WZYA 2Y54A 3U8NA 3JAEA 4HFIA 3SQ9A 4Z90A 5BW2A 3SQ6A 3TLVA 5J5IA 4QH4A 3PMZA 2XZ6A 2XQ5A 4QABA 3TLSA 4IL4A 2XQ8A 3JADA 4ZR6A 5CFBA 5TVCA 5AFNA 5JMEA 2BYRA 2KSRA 4AFTA 4FRRA 2X00D 3UQ7A 3JAFA 3UU8A 4F8HA 3RIFA 2Y7YA 4ZRUA 3WTNA 4TWHA 4IREA 4UXUA 3UU3A 2XZ5A 2M6IA 4UM3S 3WTHA 4XHEA 2LLYA 2XNTA 3C79A 3EAMA 4UM3P 5J5HA 5HEGA 3TLUA 5FJVA 3T4MA 3U8JA 4TWFA 4HFDA 4D01A 2BR7A 2XNVA 2XYTA 4XK9A 4ALXA 2XQ6A 3PEOA 3P4WA 4EZ1A 5AFMA 2XQ4A 2XQ7A 2UZ6A 5AFLA 3GUAA 4HFHA 2BYSA 4NZBA 2WN9A 2YN6A 3RQUA 2WNCA 4QACA 4TWDA 5HCJA 2ZJUA 5BP0A 4DBMA 4B5DA 2X00A 3UU6A 5HEUA 3RI5A 1OEDA 3RQWA 1UW6A 2M6BA 3TLWA 4AFHA 5BRXA 3C84A 4BFQA 4UY2A 2PGZA 5L4HA 4X5TA 4QH5A 2WNLA 4WV9A 5KE4A 4LMLA 2BYQA 3SIOA 2BG9A 3UU4A 5L47A 4A97A 1OEDB 2Y58A 4LMJA 2ZJVA 5CO5A 2BR8A 2XQ9A 3WTOA 4HFBA 4ILAA 2XQAA 3EI0A 2BG9B 5LXBA 2YMEA 4QH1A 4ILCA 4ZZCA 2C9TA 2WNJA 3WTJA 5AFHA 4HQPA 3WTLA 3WTIA 5HEHA 2YKSA 1I9BA 5HCMA 4HFCA 5AINA 2BJ0A 5KZUA 3WIPA
chains in the Genus database with same CATH superfamily
4EZHA 3WTMA 3SOLA 2KLQA 1X9BA 1OXZA 1D0XA 3L3PA 4IL9A 2CLYC 2WCAA 3Q2MA 3ZC0A 2YOEA 3D0TA 5H6RB 3OBVE 2KMFA 2XQ3A 2ZLYA 2LJLA 4HWIB 2XQ5A 3P4PA 2XQ8A 3E08A 4DUYT 5JTGA 3C51A 1J1JA 3CX7B 1T98A 3FHNA 1YQ3A 2QRXA 1AJ3A 4YSXA 4IE5A 1QSDA 2XYTA 3QC9A 3PEOA 2V5CA 1W9RA 5AFMA 1BR1A 2IMLA 5AFLA 1M7KA 3AA7B 4AXPA 1ZOYA 3ONLC 4TWDA 4EOZB 3PUXF 4GK5E 3L39A 1S94A 2XHEB 5L4HA 4QH5A 3ZJ2A 4WV9A 2R6GF 5AQKB 3CQCB 3PU3A 2JRKA 3N2OA 2CLYB 5LXBA 1UK5A 4TN7B 1HNWT 2YMEA 4I50E 2XJ7A 1YW0A 3Q5EA 3EDUA 3ZCJA 4KBMB 2WZIA 2LHRA 1HCIA 4CI2B 5J5GA 1LKXA 4NPPA 1UV6A 2BVLA 5LHHB 2X0HA 4GYSA 4ILBA 4LF4T 5IWAT 3EDVA 2QVAA 3K1SA 4BQTA 2BYPA 3PV0F 5HEJA 5AQIB 2WZYA 3CKDA 4U31A 3SQ6A 3RLFF 3OVUA 1MIYA 1Z8UA 3GN5B 4YJ3E 4HWHA 4ASKA 3O9XA 2K48A 4H63H 1ZEEA 1I6ZA 3UQ7A 4F8HA 2X9XA 4IREA 1KNPA 2B76A 2XAGB 1QLBA 3UT5E 2NTXA 2H89A 4PJLA 1T7SA 4CXXA 3BQLA 2WMNA 5DQVA 2A9UA 4XK9A 4PJNA 2B1EA 2WZHA 3AE2A 4DV7T 5FNVE 2M6BA 3ZYLA 3C84A 3DJBA 3AA6B 2WNLA 3VRAA 4YTNA 3QOFA 2BR8A 5ADXL 4ILAA 2X9WA 5H6QB 4XZCA 4QH1A 3RYCE 3AVSA 3WTJA 4A56A 2X9YA 5LMNT 3WTLA 4A5XA 1XMOT 2MYSA 3UUBA 1US7B 5IUXA 4O2AE 1WCRA 3UFGA 2OA5A 4YJ2E 2H3RA 4ZI2D 5HXHA 2LM2A 5J0ZA 2RP4A 3P4QA 4IDNA 4DMVA 1GQEA 1BR2A 2D0TA 3PJAJ 4UM1A 3ZMZB 3C50A 4HEAA 4JI4T 4COFA 2IHR1 2WS3A 4H9QC 4O4IE 1KEYA 4HFIA 1V9DA 5BW2A 1MMGA 3CWZB 5AFUL 3PUQA 5CB4E 2W4XA 2XY8B 5J5IA 3TKLB 5JH7E 4O4HE 2WAUA 4MALA 4Q25A 2NWBA 2BYRA 2CA5A 5AQQB 4PJMA 5CGMA 3LK3B 2Q9QA 3AE7A 3CIRA 3ZMVB 2LHNA 2A72A 2XQ6A 2QA7A 4IIJE 2LSJA 2LSIA 3RF1A 2CWOA 5HCJA 1VRBA 3RQWA 4BAYB 3PU8A 2ACZA 3FZHB 4G2AA 3UU4A 3FZFB 4EXTA 4IDOA 5F3JA 2CCQA 2J47A 2XQAA 3KBUA 3CQXC 3Q5WA 2WNJA 2YU1A 4X66T 4HFCA 3TLTA 2W2UA 2CHNA 2WWUA 4LFCT 1OEDE 1HF8A 2RA1A 4KUMB 1N33T 2X0LB 4ANJA 4JYAT 2XQYA 4IDQA 2YMDA 5AFKA 3U8LA 3FBZA 4X20E 1D0ZA 4ZI3D 2WB5A 4AI6A 1MMDA 2NW9A 4LMKA 4NUVA 2Y56A 1UURA 3QUJA 3K3NA 3C98B 3ONJA 4Z90A 3PMZA 2E2AA 4HKAA 3LBXB 5C8YE 1IZNB 3UU8A 2CBIA 2Y7YA 2VB6A 3RX6A 3M65A 2VL8A 4FJOA 3PUZF 2E9XA 3LK42 5JDLA 5AQFB 5IYZE 4AQFC 4ALXA 2DI4A 2XQ4A 3IF8B 3HL6A 4CXWA 5HXEA 1E2AA 4NZBA 4AKRB 5JRCB 4DR1T 4B5DA 1UUSA 4DO0A 5BRXA 3KV6A 4U2ZA 2E5LT 1FMVA 3BQIA 4L5GA 2WWVA 4DV5T 3WTOA 3GMIA 1LVKA 2FJDA 2LOSA 4ZI2C 5LGUB 5LGTB 3QK6A 2BS4A 4EEDA 3E0ZA 4IE7A 4ZS2A 4UF0B 4E7ZA 4EV6A 1Y64B 3RC3A 4QX8B 4AQYT 4P09A 1DU2A 4E7SA 5J5FA 4EB6E 3PJAA 2LSGA 3KV9A 5AQLB 3PUSA 2V7JA 4JLEA 2A2FX 2JQKA 2Y8DA 2UXBT 1MMNA 3AEAA 2NOXA 2V7LA 2MTQA 1NAFA 2LM9A 3ZYMA 2E5VA 4GOUA 2J1DG 2KSRA 2XSBA 3C4XA 4AFTA 3CMLA 1WYCA 4ISSA 5C3JA 3VHLA 4IDPA 3J7Yq 3BK9A 3NVOA 5FJVA 1KK7A 1CUNA 4UV8B 2BR7A 3HR0A 5LP6E 4DR5T 4EZ1A 4H9NC 4HFHA 1BR0A 2X9HA 3N9QA 2JQHA 2CXDA 2WM9A 3RI5A 1UW6A 5DQWA 2VVSA 4BFQA 4UY2A 5AQOB 2ACXA 2WDRA 2V6YB 4GKKT 2WU5A 4CXYA 5FXXA 4B3TT 4DV6T 1Z0PA 2KWHA 4HFBA 4EZ4A 5HXCA 5KX5E 2C9TA 1E7PA 2VKOA 4HQPA 1L0VA 5LXTE 3HI2A 2HHHT 2MPKA 4MBQA 4ZI3C 4ZJTA 4DR2T 4PAGA 3GN5A 2Y48B 2BG9C 4K0KT 3Q5XA 2W67A 3RKOA 4AFGA 2Y57A 3SH1A 3RH3A 4H9SE 3RIUC 5L4EA 3SFDA 5FYMA 4AKHA 3T1YT 4ERRA 1KNRA 2WP9A 2V7IA 3N5LA 1YXRA 2LEHA 2XZ6A 5AQMB 4QABA 5AFNA 3JCFA 5JDMA 4DBQA 1KNZA 4IE0A 4ZRUA 4H9OC 5LGNB 5EZYE 2CXFA 3ZPOA 2VASA 3RKGA 2QYWA 2UXDT 5HWXA 3K3OA 4ZI7E 1ZHCA 3PUYF 2XQ7A 2IC9A 3RPUA 4UR9A 2K3WA 3UUXB 3P8CD 4QACA 4YFSA 4U7YA 3AEEA 5BP0A 3ZMTB 3SS1A 2ZM6T 5TAOA 2JIWA 3LK2B 3UUNA 2RPAA 1WR0A 4DVDA 5LBQB 2XPKA 3N9PA 3ZMSB 4P1NA 2BG9B 4JI3T 4YTMA 4PW8A 2XUEA 3OJAA 4JI2T 4CN4A 1MNDA 2CHOA 4ZXLA 2UUCT 2LKHA 2LKGA 1WYBA 4JBWF 3WTKA 2FJAA 5EK4A 2ZM0A 5AQRB 2W8FA 5HXRA 2BBHA 2PH9A 4I0UA 4WYVA 3UU5A 3AE5A 3I9YA 4YSYA 4QWNB 5JR9C 5LHIB 3ZDHA 3CPZA 3PE0A 2CE7A 3WAJA 3MXZA 3JAEA 1VCTA 5FY1A 2DCFA 1D1BA 4HWFA 4WBNE 2X68A 3B13A 1XZYA 1IBLT 2VQET 1R8IA 1SE7A 3ZYKA 2X00D 2CMRA 2CXLA 3F57A 5L3CB 4HWDA 2XZ5A 2P9BA 3WTHA 4ZEYA 4IE4A 5HXSA 4JV5T 2WDQA 4YSZA 1MIWA 3SFEA 1LVFA 1MIVA 1YKHB 3ZN1B 2WN9A 4OX9T 3TLWA 3ABVA 2HH7A 3H37A 5JDQA 4EGWA 2Y58A 4JI5T 4BJNA 2MBGA 3QB5A 2DLRA 3EI0A 5LJNA 4LF6T 4YT0A 1UX4A 3MJXA 2A3DA 3C4WA 3ANWA 5JR9B 3VRBA 4HFEA 5E0OA 3LBXA 4IDZA 2VKHA 4DR4T 1XNRT 4ZJSA 5AQNB 3OYZA 2QC1B 1H7CA 4AKIA 4HWCA 1Y01A 2OV9A 1HX8A 3U8KA 3AAEB 4DR7T 1D0YA 1BR4A 2CPTA 5JRCA 4CI1B 3RYIE 4X64T 3PUAA 4JI1T 4DR6T 4M1PA 4UELA 4K0UA 2UXCT 3MKDA 3V5SA 2JQ9A 4OYKA 3UU3A 2V7MA 3NKZA 1IJ5A 4XHEA 3O1JA 4MFRA 1WR6A 4U74A 1XDOA 3AE3A 5LG4A 4UF0A 3ZN0B 4CQIA 2YN6A 2VQFT 2L3LA 5LCYA 1VOMA 4GKJT 2DL1A 3NZQA 3HKEE 4P0AA 5L47A 3ZMUB 3A5XA 5FY7A 1HS7A 2EHOD 5BR8T 2VURA 5FXVA 4GYRA 3CVRA 5HEHA 2NW7A 5AINA 3AEDA 4BA9A 5LBMA 3RIAA 2JPFA 3O1HA 4CZZB 2V6XA 2XAFB 4DV3T 2AE9A 5AFJA 2W8GA 2C5KT 3FZKB 2HPLA 4WBOA 4PFOA 2HPJA 3VR9A 3ZCIA 1XNQT 4NUUA 3U8NA 3MACA 4TUYE 1ZP0A 1E1HB 3LFMA 2BS2A 4YY3T 4QH4A 5JREA 3ZSSA 3AE9A 3N9OA 2C5IT 2V6YA 1NEKA 3ONXA 5J2TE 3RIFA 4EEBA 4UM3S 3MZKB 4TX5A 4AISA 3ZJ1A 2CM0A 4JUYA 3PUGA 2XAHB 3U3IA 2Z6EA 2H88A 3C64A 5GONE 5JDGA 4LFBT 3RQUA 4DBMA 4DUZT 3AB3B 1OEDA 2D0UA 4EYYR 4P0BA 3P7IA 5AQUB 3AECA 5LNKA 3AEGA 4U7IA 3ESLA 3T1HT 2X51A 4UXNB 1D1AA 1X79A 3RRWA 1FMWA 1EZ3A 3ZLIA 3AAIA 4O2BE 4HE8A 5ABHA 3O1IA 1HX1B 2BG9E 4CI3B 3QNUA 3EHZA 3U8MA 3CX8B 1W0AA 4DV1T 3B57A 5AQHB 4OK0A 3S4UA 3I9WA 4LF9T 2VKJA 3ZDGA 1G73A 4X1IE 4ZOLE 4B3ST 4ZHQE 4ADZA 2Y54A 2IAKA 2V7KA 5CJ5A 1NWMX 1N32T 4YXDA 4OYJA 5TVCA 2GK9A 4HGAA 4WNKA 2I59A 3KDSE 4UV9B 5HEGA 3VR8A 2BBJA 2I6HA 3ZSTA 2NR4A 2XNVA 4IHJE 1ZV4X 3EVYA 4CN1A 2ZM8A 5IHYA 1MMAA 3RIUA 3AXJB 3K8PC 5ABFB 2K5BB 2VK9A 2UXXB 2EHOC 2WMOA 4PK6A 3FXEB 3KV5A 5M4YA 4LF5T 2BYQA 3SIOA 3A7MA 2W0GA 3AE1A 5AQPB 3L09A 3KVBA 3O4XE 2E9XC 5JDNA 2VKDA 4HFVA 2XZEA 3CK6A 5HCMA 5L3EB 4H9RC 1YKEB 2WBLA 4DNDA 1J5WA 4EYUA 5ABGA 5A1LA 5LG3A 5FP3A 3NRYA 5KDMC 2XYSA 5FY0A 3A8YC 3GA8A 4X62T 4TV8E 3SWHA 4TNVA 2WY2A 3EABA 4KX6A 2XSAA 4DV2T 4PFPA 4X1KE 2BDEA 2F4VT 4DIDB 4X65T 4AIUA 2V5DA 3SQ9A 5KMGP 4NIQA 2JQQA 2UXNB 3RC8A 4ISTA 4L0RA 5J2UE 4FRRA 5AQVB 3FZLB 3VKHA 3IBPA 2YDQA 2EHOB 2WU2A 2C0SA 5C2TA 1U4QA 4OFZA 3H3MA 2MOZA 3FZMB 2DHRA 2LSYA 5L3DB 2IIUA 3WI3A 5JR9A 4ZS3A 4JEHB 2UZ6A 2UU9T 4QX7B 2WNCA 4X1YE 3ZT5A 1XWMA 5HYAA 3WAKA 3KVAA 3M3ZB 1QUUA 4B3MT 2M67A 5L3FB 2YEVC 2IC6A 5LJMA 2LSKA 3N2GE 5AFHA 4MHCA 1JNZA 3OTOT 2YKSA 4Z8XA 2BJ0A 2YK0A 2LRKA 4QXCB 2BVMA 1SUMB 4LF7T 2AXDS 3AE8A 2BYNA 1SHZC 4I4TE 2W00A 4IE6A 3ZKRA 1HTJF 4DBRA 2WDVA 3N9NA 2PBIA 4ZK1A 2PJQA 2CEAA 5AQGB 4KHZF 3RGLA 2VWAA 5HEOA 1WRDA 1N36T 4B3RT 4QKNA 3ETVA 3EUHA 2LOPA 1T72A 5JMEA 2WSSV 1UCUA 4U2YA 4UEMA 4G63A 4TZ4C 5FMNA 3HKBE 2ZM2A 3J9X1 3N2KE 5LA6E 3PTRB 5CA0E 5EK2A 5LMUT 2CBJA 3VKGA 5AQTB 4MLKA 2DWGA 2LE8A 3VU7H 1UX5A 2ODVA 5KXJA 4DV0T 2X0YA 1G8XA 4TV9E 2UUBT 4WZXA 2FBWA 5CO5A 2DNXA 3HKCE 3F2EA 3JC6C 1NENA 4JEUB 3OYXA 1I9BA 5KE4A 3WIPA 4GIWA 2FJEA 2W61A 1IBMT 5LB7B 3E22E 3MK7C 4A98A 1U5PA 1W0BA 4OHFA 3AA1B 2ZMAA 3G06A 2YDSA 2KT9A 4B6XA 2MAWA 2V8SV 2Q9QD 3V5UA 4ZZBA 4ILUA 2ODUA 2VL0A 3FBLA 3ZC1A 2BKPA 1O3XA 3C4ZA 4U72A 2K24A 4N78D 3TLSA 4ZR6A 4JI8T 4KHPT 1HG5A 2G0UA 3LJCA 3WTNA 3PDYA 4TWHA 5J1GA 4UXUA 3L8RA 5HAXA 2N2NA 1UGOA 3C79A 4UM3P 3T4MA 4O4LE 3U8JA 2E8IA 5HWYA 4HFDA 4NXNT 3B5MA 5DABA 1I94T 3GUAA 2BYSA 4QXBB 2ZJUA 2X00A 3NZPA 3DP7A 3N9LA 1VCSA 4KMCA 4CN6A 2JMKA 1N34T 3ZEFB 1WFDA 3AEBA 4LMLA 4PNIA 5BMVE 3CX6B 3LG7A 3UFEA 2L8KA 1D1CA 2W63A 4A97A 2BKNA 1HNXT 2XQ9A 5LYJE 1HR0T 1M62A 5FVKA 5FVLA 2W66A 3X1DA 4ZZCA 2IUBA 2N1GA 3WTIA 3HKDE 3PUWF 5AFMB 3IGQA 4TNWA 2FJBA 3I0QA 2FUPA 1LRZA 4QAAA 1FIOA 1XDPA 2XM1A 3AAAB 2NTYA 2XAQB 2XM2A 4PIRA 4U33A 2XNUA 4PK4A 1IJ6A 4UIGA 3DTOA 4AQFA 2E9XD 3QB5K 5AQSB 3AXJA 5ABEA 5ABFA 1IBKT 3FXDB 3TLVA 4UVCB 3ZT6A 5LHGB 5L2LA 5AQJB 4GK0E 2J4GA 3JADA 2NP9A 4YHJA 5EK3A 3BQKA 3JAFA 5JVDE 2KXPB 4H63V 5FL1A 1JNRA 5JQGE 3NWIA 5L3GB 4I55E 2X67A 2H7VC 4J2CA 2PG8A 4D01A 3KINB 4PK5A 2KNDA 3Q5DA 2J62A 1SA0E 4O4JE 2D2SA 4U3CA 3UU6A 3UULA 2LT3A 2K9AA 2C5JA 4DR3T 2I0MA 4EAHA 3AE6A 4JI0T 4LMJA 4AKLA 4F6RC 4LF8T 3R84B 3W15B 1HFAA 2KWIB 3IA3A 2BS3A 1B7TA 4YLHA 4PJJA 2WQYA 1J5ET 5KZUA 4IGUA 1FEWA 3KBTA 3AA0B 2L9QA 4QXHB 2VVNA 2YU2A 2BZBA 1T8BA 3UUMA 2ES0A 3ANWB 2Q9QC 3LSVA 4KI0F 4IT4A 5ETWA 1YD8G 2EHOA 4V1Av 3UQ4A 3RHWA 3Q9DA 4UM3A 2NW8A 3P50A 5L3BB 4NXMT 2QGSA 4HTEA 3CQGB 2W62A 2HN2A 3GWHA 3KFWX 4BJMA 2DWKA 2V1DB 5JDHA 1CHUA 3IHRA 2IW5B 3F31A 4DV4T 3RRCA 3OPCA 3HA4A 3R6NA 2LLYA 2YDRA 3H3AA 1YQ4A 4AQGA 5CA1E 4TWFA 3P4RA 3T8OA 1ZKEA 4JI6T 5F8PA 3ZT7A 3I1AA 3NRXA 3OKQA 3RYHE 3MA9A 4UVBB 1IAPA 2YINA 4H9PC 3NBXX 2PFVA 2X66A 2JJ9A 4JI7T 5HEUA 4AFHA 1FJGT 4XBFB 2PGZA 1S35A 5FKYA 2BG9A 3LDQB 2Q9QB 2KZ7B 2OLTA 2XTLA 2V26A 3UTKA 4HN9A 4XAXB 3PUVF 3U78A 2UUAT 1KF6A 4LFAT 4WW0A 1W09A 3FB2A 1WLXA 3PURA 3AVRA 4Z91A 4ZK4A 1OEDC 5FL0A 4O8SA 4EIWA 5SYOA 2HN1A 2LRLA 3K3QC 4I43B 1UX2A 2PTFA 3P4SA 5FXZA 2KINB 4AKGA 4KP3C 4YTPA 5F5WA 3JC6D 2D5UA 4UVAB 3RYFE 4IL4A 5CFBA 4YHHT 4C90A 3I0OA 3AE4A 4QHOA 2CWYA 2CRBA 2M6IA 2N9DA 2XNTA 5J5HA 3EAMA 3TLUA 4FI5A 1XMQT 2BKOA 2IDOB 3P4WA 5DJQC 2H7OA 3ETUA 3N9MA 1HG2A 5LOVE 2XAJB 3SRZA 3AEFA 2JMHA 2D9DA 1KFYA 5FXWA 1HNZT 4X5TA 2XASB 3KV4A 1OEDB 2ZJVA 2SPCA 4L9IA 1OWAA 3IEEA 2E9XB 4ILCA 4DMWA 1MNEA 5JDFA 2Y6XA 4C91A
chains in the Genus database with same CATH topology
5AFMB 3UUBA 3IGQA 1OEDE 4Z91A 4TNWA 5IUXA 4HFEA 2LKHA 3TLTA 3WTMA 4ZJTA 2LKGA 4ZK4A 5LG3A 2BG9E 4QAAA 1OEDC 3WTKA 2LM2A 3LSVA 3RIAA 3EHZA 2XYSA 2BYNA 5J5GA 4A98A 4NPPA 3U8MA 4IL9A 2YMDA 2W8FA 5AFKA 5J0ZA 4ZJSA 3U8LA 2PH9A 5SYOA 3ZKRA 2BG9C 5AFJA 1UV6A 3UQ4A 3RHWA 2W8GA 3UU5A 4TNVA 4ILBA 2QC1B 4PIRA 2XNUA 2YOEA 4AFGA 2Y57A 2MAWA 4UM1A 2BYPA 3SH1A 3ZDGA 5HEJA 3ZDHA 4BQTA 1UX2A 4ZK1A 5J5FA 4ZZBA 4UM3A 5L4EA 4COFA 2XQ3A 3U8KA 3P50A 2VL0A 4LMKA 5HEOA 2Y56A 2WZYA 2Y54A 3U8NA 3JAEA 4HFIA 3SQ9A 4Z90A 5BW2A 3SQ6A 3TLVA 5J5IA 4QH4A 3PMZA 2XZ6A 2XQ5A 4QABA 3TLSA 4IL4A 2XQ8A 3JADA 4ZR6A 5CFBA 5TVCA 5AFNA 5JMEA 2BYRA 2KSRA 4AFTA 4FRRA 2X00D 3UQ7A 3JAFA 3UU8A 4F8HA 3RIFA 2Y7YA 4ZRUA 3WTNA 4TWHA 4IREA 4UXUA 3UU3A 2XZ5A 2M6IA 4UM3S 3WTHA 4XHEA 2LLYA 2XNTA 3C79A 3EAMA 4UM3P 5J5HA 5HEGA 3TLUA 5FJVA 3T4MA 3U8JA 4TWFA 4HFDA 4D01A 2BR7A 2XNVA 2XYTA 4XK9A 4ALXA 2XQ6A 3PEOA 3P4WA 4EZ1A 5AFMA 2XQ4A 2XQ7A 2UZ6A 5AFLA 3GUAA 4HFHA 2BYSA 4NZBA 2WN9A 2YN6A 3RQUA 2WNCA 4QACA 4TWDA 5HCJA 2ZJUA 5BP0A 4DBMA 4B5DA 2X00A 3UU6A 5HEUA 3RI5A 1OEDA 3RQWA 1UW6A 2M6BA 3TLWA 4AFHA 5BRXA 3C84A 4BFQA 4UY2A 2PGZA 5L4HA 4X5TA 4QH5A 2WNLA 4WV9A 5KE4A 4LMLA 2BYQA 3SIOA 2BG9A 3UU4A 5L47A 4A97A 1OEDB 2Y58A 4LMJA 2ZJVA 5CO5A 2BR8A 2XQ9A 3WTOA 4HFBA 4ILAA 2XQAA 3EI0A 2BG9B 5LXBA 2YMEA 4QH1A 4ILCA 4ZZCA 2C9TA 2WNJA 3WTJA 5AFHA 4HQPA 3WTLA 3WTIA 5HEHA 2YKSA 1I9BA 5HCMA 4HFCA 5AINA 2BJ0A 5KZUA 3WIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFM B;  3UUB A;  3IGQ A;  1OED E;  4Z91 A;  4TNW A;  5IUX A;  4HFE A;  2LKH A;  3TLT A;  3WTM A;  4ZJT A;  2LKG A;  4ZK4 A;  5LG3 A;  2BG9 E;  4QAA A;  1OED C;  3WTK A;  2LM2 A;  3LSV A;  3RIA A;  3EHZ A;  2XYS A;  2BYN A;  5J5G A;  4A98 A;  4NPP A;  3U8M A;  4IL9 A;  2YMD A;  2W8F A;  5AFK A;  5J0Z A;  4ZJS A;  3U8L A;  2PH9 A;  5SYO A;  3ZKR A;  2BG9 C;  5AFJ A;  1UV6 A;  3UQ4 A;  3RHW A;  2W8G A;  3UU5 A;  4TNV A;  4ILB A;  2QC1 B;  4PIR A;  2XNU A;  2YOE A;  4AFG A;  2Y57 A;  2MAW A;  4UM1 A;  2BYP A;  3SH1 A;  3ZDG A;  5HEJ A;  3ZDH A;  4BQT A;  1UX2 A;  4ZK1 A;  5J5F A;  4ZZB A;  4UM3 A;  5L4E A;  4COF A;  2XQ3 A;  3U8K A;  3P50 A;  2VL0 A;  4LMK A;  5HEO A;  2Y56 A;  2WZY A;  2Y54 A;  3U8N A;  3JAE A;  4HFI A;  3SQ9 A;  4Z90 A;  5BW2 A;  3SQ6 A;  3TLV A;  5J5I A;  4QH4 A;  3PMZ A;  2XZ6 A;  2XQ5 A;  4QAB A;  3TLS A;  4IL4 A;  2XQ8 A;  3JAD A;  4ZR6 A;  5CFB A;  5TVC A;  5AFN A;  5JME A;  2BYR A;  2KSR A;  4AFT A;  4FRR A;  2X00 D;  3UQ7 A;  3JAF A;  3UU8 A;  4F8H A;  3RIF A;  2Y7Y A;  4ZRU A;  3WTN A;  4TWH A;  4IRE A;  4UXU A;  3UU3 A;  2XZ5 A;  2M6I A;  4UM3 S;  3WTH A;  4XHE A;  2LLY A;  2XNT A;  3C79 A;  3EAM A;  4UM3 P;  5J5H A;  5HEG A;  3TLU A;  5FJV A;  3T4M A;  3U8J A;  4TWF A;  4HFD A;  4D01 A;  2BR7 A;  2XNV A;  2XYT A;  4XK9 A;  4ALX A;  2XQ6 A;  3PEO A;  3P4W A;  4EZ1 A;  5AFM A;  2XQ4 A;  2XQ7 A;  2UZ6 A;  5AFL A;  3GUA A;  4HFH A;  2BYS A;  4NZB A;  2WN9 A;  2YN6 A;  3RQU A;  2WNC A;  4QAC A;  4TWD A;  5HCJ A;  2ZJU A;  5BP0 A;  4DBM A;  4B5D A;  2X00 A;  3UU6 A;  5HEU A;  3RI5 A;  1OED A;  3RQW A;  1UW6 A;  2M6B A;  3TLW A;  4AFH A;  5BRX A;  3C84 A;  4BFQ A;  4UY2 A;  2PGZ A;  5L4H A;  4X5T A;  4QH5 A;  2WNL A;  4WV9 A;  5KE4 A;  4LML A;  2BYQ A;  3SIO A;  2BG9 A;  3UU4 A;  5L47 A;  4A97 A;  1OED B;  2Y58 A;  4LMJ A;  2ZJV A;  5CO5 A;  2BR8 A;  2XQ9 A;  3WTO A;  4HFB A;  4ILA A;  2XQA A;  3EI0 A;  2BG9 B;  5LXB A;  2YME A;  4QH1 A;  4ILC A;  4ZZC A;  2C9T A;  2WNJ A;  3WTJ A;  5AFH A;  4HQP A;  3WTL A;  3WTI A;  5HEH A;  2YKS A;  1I9B A;  5HCM A;  4HFC A;  5AIN A;  2BJ0 A;  5KZU A;  3WIP A; 
#chains in the Genus database with same CATH topology
 4EZH A;  3WTM A;  3SOL A;  2KLQ A;  1X9B A;  1OXZ A;  1D0X A;  3L3P A;  4IL9 A;  2CLY C;  2WCA A;  3Q2M A;  3ZC0 A;  2YOE A;  3D0T A;  5H6R B;  3OBV E;  2KMF A;  2XQ3 A;  2ZLY A;  2LJL A;  4HWI B;  2XQ5 A;  3P4P A;  2XQ8 A;  3E08 A;  4DUY T;  5JTG A;  3C51 A;  1J1J A;  3CX7 B;  1T98 A;  3FHN A;  1YQ3 A;  2QRX A;  1AJ3 A;  4YSX A;  4IE5 A;  1QSD A;  2XYT A;  3QC9 A;  3PEO A;  2V5C A;  1W9R A;  5AFM A;  1BR1 A;  2IML A;  5AFL A;  1M7K A;  3AA7 B;  4AXP A;  1ZOY A;  3ONL C;  4TWD A;  4EOZ B;  3PUX F;  4GK5 E;  3L39 A;  1S94 A;  2XHE B;  5L4H A;  4QH5 A;  3ZJ2 A;  4WV9 A;  2R6G F;  5AQK B;  3CQC B;  3PU3 A;  2JRK A;  3N2O A;  2CLY B;  5LXB A;  1UK5 A;  4TN7 B;  1HNW T;  2YME A;  4I50 E;  2XJ7 A;  1YW0 A;  3Q5E A;  3EDU A;  3ZCJ A;  4KBM B;  2WZI A;  2LHR A;  1HCI A;  4CI2 B;  5J5G A;  1LKX A;  4NPP A;  1UV6 A;  2BVL A;  5LHH B;  2X0H A;  4GYS A;  4ILB A;  4LF4 T;  5IWA T;  3EDV A;  2QVA A;  3K1S A;  4BQT A;  2BYP A;  3PV0 F;  5HEJ A;  5AQI B;  2WZY A;  3CKD A;  4U31 A;  3SQ6 A;  3RLF F;  3OVU A;  1MIY A;  1Z8U A;  3GN5 B;  4YJ3 E;  4HWH A;  4ASK A;  3O9X A;  2K48 A;  4H63 H;  1ZEE A;  1I6Z A;  3UQ7 A;  4F8H A;  2X9X A;  4IRE A;  1KNP A;  2B76 A;  2XAG B;  1QLB A;  3UT5 E;  2NTX A;  2H89 A;  4PJL A;  1T7S A;  4CXX A;  3BQL A;  2WMN A;  5DQV A;  2A9U A;  4XK9 A;  4PJN A;  2B1E A;  2WZH A;  3AE2 A;  4DV7 T;  5FNV E;  2M6B A;  3ZYL A;  3C84 A;  3DJB A;  3AA6 B;  2WNL A;  3VRA A;  4YTN A;  3QOF A;  2BR8 A;  5ADX L;  4ILA A;  2X9W A;  5H6Q B;  4XZC A;  4QH1 A;  3RYC E;  3AVS A;  3WTJ A;  4A56 A;  2X9Y A;  5LMN T;  3WTL A;  4A5X A;  1XMO T;  2MYS A;  3UUB A;  1US7 B;  5IUX A;  4O2A E;  1WCR A;  3UFG A;  2OA5 A;  4YJ2 E;  2H3R A;  4ZI2 D;  5HXH A;  2LM2 A;  5J0Z A;  2RP4 A;  3P4Q A;  4IDN A;  4DMV A;  1GQE A;  1BR2 A;  2D0T A;  3PJA J;  4UM1 A;  3ZMZ B;  3C50 A;  4HEA A;  4JI4 T;  4COF A;  2IHR 1;  2WS3 A;  4H9Q C;  4O4I E;  1KEY A;  4HFI A;  1V9D A;  5BW2 A;  1MMG A;  3CWZ B;  5AFU L;  3PUQ A;  5CB4 E;  2W4X A;  2XY8 B;  5J5I A;  3TKL B;  5JH7 E;  4O4H E;  2WAU A;  4MAL A;  4Q25 A;  2NWB A;  2BYR A;  2CA5 A;  5AQQ B;  4PJM A;  5CGM A;  3LK3 B;  2Q9Q A;  3AE7 A;  3CIR A;  3ZMV B;  2LHN A;  2A72 A;  2XQ6 A;  2QA7 A;  4IIJ E;  2LSJ A;  2LSI A;  3RF1 A;  2CWO A;  5HCJ A;  1VRB A;  3RQW A;  4BAY B;  3PU8 A;  2ACZ A;  3FZH B;  4G2A A;  3UU4 A;  3FZF B;  4EXT A;  4IDO A;  5F3J A;  2CCQ A;  2J47 A;  2XQA A;  3KBU A;  3CQX C;  3Q5W A;  2WNJ A;  2YU1 A;  4X66 T;  4HFC A;  3TLT A;  2W2U A;  2CHN A;  2WWU A;  4LFC T;  1OED E;  1HF8 A;  2RA1 A;  4KUM B;  1N33 T;  2X0L B;  4ANJ A;  4JYA T;  2XQY A;  4IDQ A;  2YMD A;  5AFK A;  3U8L A;  3FBZ A;  4X20 E;  1D0Z A;  4ZI3 D;  2WB5 A;  4AI6 A;  1MMD A;  2NW9 A;  4LMK A;  4NUV A;  2Y56 A;  1UUR A;  3QUJ A;  3K3N A;  3C98 B;  3ONJ A;  4Z90 A;  3PMZ A;  2E2A A;  4HKA A;  3LBX B;  5C8Y E;  1IZN B;  3UU8 A;  2CBI A;  2Y7Y A;  2VB6 A;  3RX6 A;  3M65 A;  2VL8 A;  4FJO A;  3PUZ F;  2E9X A;  3LK4 2;  5JDL A;  5AQF B;  5IYZ E;  4AQF C;  4ALX A;  2DI4 A;  2XQ4 A;  3IF8 B;  3HL6 A;  4CXW A;  5HXE A;  1E2A A;  4NZB A;  4AKR B;  5JRC B;  4DR1 T;  4B5D A;  1UUS A;  4DO0 A;  5BRX A;  3KV6 A;  4U2Z A;  2E5L T;  1FMV A;  3BQI A;  4L5G A;  2WWV A;  4DV5 T;  3WTO A;  3GMI A;  1LVK A;  2FJD A;  2LOS A;  4ZI2 C;  5LGU B;  5LGT B;  3QK6 A;  2BS4 A;  4EED A;  3E0Z A;  4IE7 A;  4ZS2 A;  4UF0 B;  4E7Z A;  4EV6 A;  1Y64 B;  3RC3 A;  4QX8 B;  4AQY T;  4P09 A;  1DU2 A;  4E7S A;  5J5F A;  4EB6 E;  3PJA A;  2LSG A;  3KV9 A;  5AQL B;  3PUS A;  2V7J A;  4JLE A;  2A2F X;  2JQK A;  2Y8D A;  2UXB T;  1MMN A;  3AEA A;  2NOX A;  2V7L A;  2MTQ A;  1NAF A;  2LM9 A;  3ZYM A;  2E5V A;  4GOU A;  2J1D G;  2KSR A;  2XSB A;  3C4X A;  4AFT A;  3CML A;  1WYC A;  4ISS A;  5C3J A;  3VHL A;  4IDP A;  3J7Y q;  3BK9 A;  3NVO A;  5FJV A;  1KK7 A;  1CUN A;  4UV8 B;  2BR7 A;  3HR0 A;  5LP6 E;  4DR5 T;  4EZ1 A;  4H9N C;  4HFH A;  1BR0 A;  2X9H A;  3N9Q A;  2JQH A;  2CXD A;  2WM9 A;  3RI5 A;  1UW6 A;  5DQW A;  2VVS A;  4BFQ A;  4UY2 A;  5AQO B;  2ACX A;  2WDR A;  2V6Y B;  4GKK T;  2WU5 A;  4CXY A;  5FXX A;  4B3T T;  4DV6 T;  1Z0P A;  2KWH A;  4HFB A;  4EZ4 A;  5HXC A;  5KX5 E;  2C9T A;  1E7P A;  2VKO A;  4HQP A;  1L0V A;  5LXT E;  3HI2 A;  2HHH T;  2MPK A;  4MBQ A;  4ZI3 C;  4ZJT A;  4DR2 T;  4PAG A;  3GN5 A;  2Y48 B;  2BG9 C;  4K0K T;  3Q5X A;  2W67 A;  3RKO A;  4AFG A;  2Y57 A;  3SH1 A;  3RH3 A;  4H9S E;  3RIU C;  5L4E A;  3SFD A;  5FYM A;  4AKH A;  3T1Y T;  4ERR A;  1KNR A;  2WP9 A;  2V7I A;  3N5L A;  1YXR A;  2LEH A;  2XZ6 A;  5AQM B;  4QAB A;  5AFN A;  3JCF A;  5JDM A;  4DBQ A;  1KNZ A;  4IE0 A;  4ZRU A;  4H9O C;  5LGN B;  5EZY E;  2CXF A;  3ZPO A;  2VAS A;  3RKG A;  2QYW A;  2UXD T;  5HWX A;  3K3O A;  4ZI7 E;  1ZHC A;  3PUY F;  2XQ7 A;  2IC9 A;  3RPU A;  4UR9 A;  2K3W A;  3UUX B;  3P8C D;  4QAC A;  4YFS A;  4U7Y A;  3AEE A;  5BP0 A;  3ZMT B;  3SS1 A;  2ZM6 T;  5TAO A;  2JIW A;  3LK2 B;  3UUN A;  2RPA A;  1WR0 A;  4DVD A;  5LBQ B;  2XPK A;  3N9P A;  3ZMS B;  4P1N A;  2BG9 B;  4JI3 T;  4YTM A;  4PW8 A;  2XUE A;  3OJA A;  4JI2 T;  4CN4 A;  1MND A;  2CHO A;  4ZXL A;  2UUC T;  2LKH A;  2LKG A;  1WYB A;  4JBW F;  3WTK A;  2FJA A;  5EK4 A;  2ZM0 A;  5AQR B;  2W8F A;  5HXR A;  2BBH A;  2PH9 A;  4I0U A;  4WYV A;  3UU5 A;  3AE5 A;  3I9Y A;  4YSY A;  4QWN B;  5JR9 C;  5LHI B;  3ZDH A;  3CPZ A;  3PE0 A;  2CE7 A;  3WAJ A;  3MXZ A;  3JAE A;  1VCT A;  5FY1 A;  2DCF A;  1D1B A;  4HWF A;  4WBN E;  2X68 A;  3B13 A;  1XZY A;  1IBL T;  2VQE T;  1R8I A;  1SE7 A;  3ZYK A;  2X00 D;  2CMR A;  2CXL A;  3F57 A;  5L3C B;  4HWD A;  2XZ5 A;  2P9B A;  3WTH A;  4ZEY A;  4IE4 A;  5HXS A;  4JV5 T;  2WDQ A;  4YSZ A;  1MIW A;  3SFE A;  1LVF A;  1MIV A;  1YKH B;  3ZN1 B;  2WN9 A;  4OX9 T;  3TLW A;  3ABV A;  2HH7 A;  3H37 A;  5JDQ A;  4EGW A;  2Y58 A;  4JI5 T;  4BJN A;  2MBG A;  3QB5 A;  2DLR A;  3EI0 A;  5LJN A;  4LF6 T;  4YT0 A;  1UX4 A;  3MJX A;  2A3D A;  3C4W A;  3ANW A;  5JR9 B;  3VRB A;  4HFE A;  5E0O A;  3LBX A;  4IDZ A;  2VKH A;  4DR4 T;  1XNR T;  4ZJS A;  5AQN B;  3OYZ A;  2QC1 B;  1H7C A;  4AKI A;  4HWC A;  1Y01 A;  2OV9 A;  1HX8 A;  3U8K A;  3AAE B;  4DR7 T;  1D0Y A;  1BR4 A;  2CPT A;  5JRC A;  4CI1 B;  3RYI E;  4X64 T;  3PUA A;  4JI1 T;  4DR6 T;  4M1P A;  4UEL A;  4K0U A;  2UXC T;  3MKD A;  3V5S A;  2JQ9 A;  4OYK A;  3UU3 A;  2V7M A;  3NKZ A;  1IJ5 A;  4XHE A;  3O1J A;  4MFR A;  1WR6 A;  4U74 A;  1XDO A;  3AE3 A;  5LG4 A;  4UF0 A;  3ZN0 B;  4CQI A;  2YN6 A;  2VQF T;  2L3L A;  5LCY A;  1VOM A;  4GKJ T;  2DL1 A;  3NZQ A;  3HKE E;  4P0A A;  5L47 A;  3ZMU B;  3A5X A;  5FY7 A;  1HS7 A;  2EHO D;  5BR8 T;  2VUR A;  5FXV A;  4GYR A;  3CVR A;  5HEH A;  2NW7 A;  5AIN A;  3AED A;  4BA9 A;  5LBM A;  3RIA A;  2JPF A;  3O1H A;  4CZZ B;  2V6X A;  2XAF B;  4DV3 T;  2AE9 A;  5AFJ A;  2W8G A;  2C5K T;  3FZK B;  2HPL A;  4WBO A;  4PFO A;  2HPJ A;  3VR9 A;  3ZCI A;  1XNQ T;  4NUU A;  3U8N A;  3MAC A;  4TUY E;  1ZP0 A;  1E1H B;  3LFM A;  2BS2 A;  4YY3 T;  4QH4 A;  5JRE A;  3ZSS A;  3AE9 A;  3N9O A;  2C5I T;  2V6Y A;  1NEK A;  3ONX A;  5J2T E;  3RIF A;  4EEB A;  4UM3 S;  3MZK B;  4TX5 A;  4AIS A;  3ZJ1 A;  2CM0 A;  4JUY A;  3PUG A;  2XAH B;  3U3I A;  2Z6E A;  2H88 A;  3C64 A;  5GON E;  5JDG A;  4LFB T;  3RQU A;  4DBM A;  4DUZ T;  3AB3 B;  1OED A;  2D0U A;  4EYY R;  4P0B A;  3P7I A;  5AQU B;  3AEC A;  5LNK A;  3AEG A;  4U7I A;  3ESL A;  3T1H T;  2X51 A;  4UXN B;  1D1A A;  1X79 A;  3RRW A;  1FMW A;  1EZ3 A;  3ZLI A;  3AAI A;  4O2B E;  4HE8 A;  5ABH A;  3O1I A;  1HX1 B;  2BG9 E;  4CI3 B;  3QNU A;  3EHZ A;  3U8M A;  3CX8 B;  1W0A A;  4DV1 T;  3B57 A;  5AQH B;  4OK0 A;  3S4U A;  3I9W A;  4LF9 T;  2VKJ A;  3ZDG A;  1G73 A;  4X1I E;  4ZOL E;  4B3S T;  4ZHQ E;  4ADZ A;  2Y54 A;  2IAK A;  2V7K A;  5CJ5 A;  1NWM X;  1N32 T;  4YXD A;  4OYJ A;  5TVC A;  2GK9 A;  4HGA A;  4WNK A;  2I59 A;  3KDS E;  4UV9 B;  5HEG A;  3VR8 A;  2BBJ A;  2I6H A;  3ZST A;  2NR4 A;  2XNV A;  4IHJ E;  1ZV4 X;  3EVY A;  4CN1 A;  2ZM8 A;  5IHY A;  1MMA A;  3RIU A;  3AXJ B;  3K8P C;  5ABF B;  2K5B B;  2VK9 A;  2UXX B;  2EHO C;  2WMO A;  4PK6 A;  3FXE B;  3KV5 A;  5M4Y A;  4LF5 T;  2BYQ A;  3SIO A;  3A7M A;  2W0G A;  3AE1 A;  5AQP B;  3L09 A;  3KVB A;  3O4X E;  2E9X C;  5JDN A;  2VKD A;  4HFV A;  2XZE A;  3CK6 A;  5HCM A;  5L3E B;  4H9R C;  1YKE B;  2WBL A;  4DND A;  1J5W A;  4EYU A;  5ABG A;  5A1L A;  5LG3 A;  5FP3 A;  3NRY A;  5KDM C;  2XYS A;  5FY0 A;  3A8Y C;  3GA8 A;  4X62 T;  4TV8 E;  3SWH A;  4TNV A;  2WY2 A;  3EAB A;  4KX6 A;  2XSA A;  4DV2 T;  4PFP A;  4X1K E;  2BDE A;  2F4V T;  4DID B;  4X65 T;  4AIU A;  2V5D A;  3SQ9 A;  5KMG P;  4NIQ A;  2JQQ A;  2UXN B;  3RC8 A;  4IST A;  4L0R A;  5J2U E;  4FRR A;  5AQV B;  3FZL B;  3VKH A;  3IBP A;  2YDQ A;  2EHO B;  2WU2 A;  2C0S A;  5C2T A;  1U4Q A;  4OFZ A;  3H3M A;  2MOZ A;  3FZM B;  2DHR A;  2LSY A;  5L3D B;  2IIU A;  3WI3 A;  5JR9 A;  4ZS3 A;  4JEH B;  2UZ6 A;  2UU9 T;  4QX7 B;  2WNC A;  4X1Y E;  3ZT5 A;  1XWM A;  5HYA A;  3WAK A;  3KVA A;  3M3Z B;  1QUU A;  4B3M T;  2M67 A;  5L3F B;  2YEV C;  2IC6 A;  5LJM A;  2LSK A;  3N2G E;  5AFH A;  4MHC A;  1JNZ A;  3OTO T;  2YKS A;  4Z8X A;  2BJ0 A;  2YK0 A;  2LRK A;  4QXC B;  2BVM A;  1SUM B;  4LF7 T;  2AXD S;  3AE8 A;  2BYN A;  1SHZ C;  4I4T E;  2W00 A;  4IE6 A;  3ZKR A;  1HTJ F;  4DBR A;  2WDV A;  3N9N A;  2PBI A;  4ZK1 A;  2PJQ A;  2CEA A;  5AQG B;  4KHZ F;  3RGL A;  2VWA A;  5HEO A;  1WRD A;  1N36 T;  4B3R T;  4QKN A;  3ETV A;  3EUH A;  2LOP A;  1T72 A;  5JME A;  2WSS V;  1UCU A;  4U2Y A;  4UEM A;  4G63 A;  4TZ4 C;  5FMN A;  3HKB E;  2ZM2 A;  3J9X 1;  3N2K E;  5LA6 E;  3PTR B;  5CA0 E;  5EK2 A;  5LMU T;  2CBJ A;  3VKG A;  5AQT B;  4MLK A;  2DWG A;  2LE8 A;  3VU7 H;  1UX5 A;  2ODV A;  5KXJ A;  4DV0 T;  2X0Y A;  1G8X A;  4TV9 E;  2UUB T;  4WZX A;  2FBW A;  5CO5 A;  2DNX A;  3HKC E;  3F2E A;  3JC6 C;  1NEN A;  4JEU B;  3OYX A;  1I9B A;  5KE4 A;  3WIP A;  4GIW A;  2FJE A;  2W61 A;  1IBM T;  5LB7 B;  3E22 E;  3MK7 C;  4A98 A;  1U5P A;  1W0B A;  4OHF A;  3AA1 B;  2ZMA A;  3G06 A;  2YDS A;  2KT9 A;  4B6X A;  2MAW A;  2V8S V;  2Q9Q D;  3V5U A;  4ZZB A;  4ILU A;  2ODU A;  2VL0 A;  3FBL A;  3ZC1 A;  2BKP A;  1O3X A;  3C4Z A;  4U72 A;  2K24 A;  4N78 D;  3TLS A;  4ZR6 A;  4JI8 T;  4KHP T;  1HG5 A;  2G0U A;  3LJC A;  3WTN A;  3PDY A;  4TWH A;  5J1G A;  4UXU A;  3L8R A;  5HAX A;  2N2N A;  1UGO A;  3C79 A;  4UM3 P;  3T4M A;  4O4L E;  3U8J A;  2E8I A;  5HWY A;  4HFD A;  4NXN T;  3B5M A;  5DAB A;  1I94 T;  3GUA A;  2BYS A;  4QXB B;  2ZJU A;  2X00 A;  3NZP A;  3DP7 A;  3N9L A;  1VCS A;  4KMC A;  4CN6 A;  2JMK A;  1N34 T;  3ZEF B;  1WFD A;  3AEB A;  4LML A;  4PNI A;  5BMV E;  3CX6 B;  3LG7 A;  3UFE A;  2L8K A;  1D1C A;  2W63 A;  4A97 A;  2BKN A;  1HNX T;  2XQ9 A;  5LYJ E;  1HR0 T;  1M62 A;  5FVK A;  5FVL A;  2W66 A;  3X1D A;  4ZZC A;  2IUB A;  2N1G A;  3WTI A;  3HKD E;  3PUW F;  5AFM B;  3IGQ A;  4TNW A;  2FJB A;  3I0Q A;  2FUP A;  1LRZ A;  4QAA A;  1FIO A;  1XDP A;  2XM1 A;  3AAA B;  2NTY A;  2XAQ B;  2XM2 A;  4PIR A;  4U33 A;  2XNU A;  4PK4 A;  1IJ6 A;  4UIG A;  3DTO A;  4AQF A;  2E9X D;  3QB5 K;  5AQS B;  3AXJ A;  5ABE A;  5ABF A;  1IBK T;  3FXD B;  3TLV A;  4UVC B;  3ZT6 A;  5LHG B;  5L2L A;  5AQJ B;  4GK0 E;  2J4G A;  3JAD A;  2NP9 A;  4YHJ A;  5EK3 A;  3BQK A;  3JAF A;  5JVD E;  2KXP B;  4H63 V;  5FL1 A;  1JNR A;  5JQG E;  3NWI A;  5L3G B;  4I55 E;  2X67 A;  2H7V C;  4J2C A;  2PG8 A;  4D01 A;  3KIN B;  4PK5 A;  2KND A;  3Q5D A;  2J62 A;  1SA0 E;  4O4J E;  2D2S A;  4U3C A;  3UU6 A;  3UUL A;  2LT3 A;  2K9A A;  2C5J A;  4DR3 T;  2I0M A;  4EAH A;  3AE6 A;  4JI0 T;  4LMJ A;  4AKL A;  4F6R C;  4LF8 T;  3R84 B;  3W15 B;  1HFA A;  2KWI B;  3IA3 A;  2BS3 A;  1B7T A;  4YLH A;  4PJJ A;  2WQY A;  1J5E T;  5KZU A;  4IGU A;  1FEW A;  3KBT A;  3AA0 B;  2L9Q A;  4QXH B;  2VVN A;  2YU2 A;  2BZB A;  1T8B A;  3UUM A;  2ES0 A;  3ANW B;  2Q9Q C;  3LSV A;  4KI0 F;  4IT4 A;  5ETW A;  1YD8 G;  2EHO A;  4V1A v;  3UQ4 A;  3RHW A;  3Q9D A;  4UM3 A;  2NW8 A;  3P50 A;  5L3B B;  4NXM T;  2QGS A;  4HTE A;  3CQG B;  2W62 A;  2HN2 A;  3GWH A;  3KFW X;  4BJM A;  2DWK A;  2V1D B;  5JDH A;  1CHU A;  3IHR A;  2IW5 B;  3F31 A;  4DV4 T;  3RRC A;  3OPC A;  3HA4 A;  3R6N A;  2LLY A;  2YDR A;  3H3A A;  1YQ4 A;  4AQG A;  5CA1 E;  4TWF A;  3P4R A;  3T8O A;  1ZKE A;  4JI6 T;  5F8P A;  3ZT7 A;  3I1A A;  3NRX A;  3OKQ A;  3RYH E;  3MA9 A;  4UVB B;  1IAP A;  2YIN A;  4H9P C;  3NBX X;  2PFV A;  2X66 A;  2JJ9 A;  4JI7 T;  5HEU A;  4AFH A;  1FJG T;  4XBF B;  2PGZ A;  1S35 A;  5FKY A;  2BG9 A;  3LDQ B;  2Q9Q B;  2KZ7 B;  2OLT A;  2XTL A;  2V26 A;  3UTK A;  4HN9 A;  4XAX B;  3PUV F;  3U78 A;  2UUA T;  1KF6 A;  4LFA T;  4WW0 A;  1W09 A;  3FB2 A;  1WLX A;  3PUR A;  3AVR A;  4Z91 A;  4ZK4 A;  1OED C;  5FL0 A;  4O8S A;  4EIW A;  5SYO A;  2HN1 A;  2LRL A;  3K3Q C;  4I43 B;  1UX2 A;  2PTF A;  3P4S A;  5FXZ A;  2KIN B;  4AKG A;  4KP3 C;  4YTP A;  5F5W A;  3JC6 D;  2D5U A;  4UVA B;  3RYF E;  4IL4 A;  5CFB A;  4YHH T;  4C90 A;  3I0O A;  3AE4 A;  4QHO A;  2CWY A;  2CRB A;  2M6I A;  2N9D A;  2XNT A;  5J5H A;  3EAM A;  3TLU A;  4FI5 A;  1XMQ T;  2BKO A;  2IDO B;  3P4W A;  5DJQ C;  2H7O A;  3ETU A;  3N9M A;  1HG2 A;  5LOV E;  2XAJ B;  3SRZ A;  3AEF A;  2JMH A;  2D9D A;  1KFY A;  5FXW A;  1HNZ T;  4X5T A;  2XAS B;  3KV4 A;  1OED B;  2ZJV A;  2SPC A;  4L9I A;  1OWA A;  3IEE A;  2E9X B;  4ILC A;  4DMW A;  1MNE A;  5JDF A;  2Y6X A;  4C91 A; 
#chains in the Genus database with same CATH homology
 5AFM B;  3UUB A;  3IGQ A;  1OED E;  4Z91 A;  4TNW A;  5IUX A;  4HFE A;  2LKH A;  3TLT A;  3WTM A;  4ZJT A;  2LKG A;  4ZK4 A;  5LG3 A;  2BG9 E;  4QAA A;  1OED C;  3WTK A;  2LM2 A;  3LSV A;  3RIA A;  3EHZ A;  2XYS A;  2BYN A;  5J5G A;  4A98 A;  4NPP A;  3U8M A;  4IL9 A;  2YMD A;  2W8F A;  5AFK A;  5J0Z A;  4ZJS A;  3U8L A;  2PH9 A;  5SYO A;  3ZKR A;  2BG9 C;  5AFJ A;  1UV6 A;  3UQ4 A;  3RHW A;  2W8G A;  3UU5 A;  4TNV A;  4ILB A;  2QC1 B;  4PIR A;  2XNU A;  2YOE A;  4AFG A;  2Y57 A;  2MAW A;  4UM1 A;  2BYP A;  3SH1 A;  3ZDG A;  5HEJ A;  3ZDH A;  4BQT A;  1UX2 A;  4ZK1 A;  5J5F A;  4ZZB A;  4UM3 A;  5L4E A;  4COF A;  2XQ3 A;  3U8K A;  3P50 A;  2VL0 A;  4LMK A;  5HEO A;  2Y56 A;  2WZY A;  2Y54 A;  3U8N A;  3JAE A;  4HFI A;  3SQ9 A;  4Z90 A;  5BW2 A;  3SQ6 A;  3TLV A;  5J5I A;  4QH4 A;  3PMZ A;  2XZ6 A;  2XQ5 A;  4QAB A;  3TLS A;  4IL4 A;  2XQ8 A;  3JAD A;  4ZR6 A;  5CFB A;  5TVC A;  5AFN A;  5JME A;  2BYR A;  2KSR A;  4AFT A;  4FRR A;  2X00 D;  3UQ7 A;  3JAF A;  3UU8 A;  4F8H A;  3RIF A;  2Y7Y A;  4ZRU A;  3WTN A;  4TWH A;  4IRE A;  4UXU A;  3UU3 A;  2XZ5 A;  2M6I A;  4UM3 S;  3WTH A;  4XHE A;  2LLY A;  2XNT A;  3C79 A;  3EAM A;  4UM3 P;  5J5H A;  5HEG A;  3TLU A;  5FJV A;  3T4M A;  3U8J A;  4TWF A;  4HFD A;  4D01 A;  2BR7 A;  2XNV A;  2XYT A;  4XK9 A;  4ALX A;  2XQ6 A;  3PEO A;  3P4W A;  4EZ1 A;  5AFM A;  2XQ4 A;  2XQ7 A;  2UZ6 A;  5AFL A;  3GUA A;  4HFH A;  2BYS A;  4NZB A;  2WN9 A;  2YN6 A;  3RQU A;  2WNC A;  4QAC A;  4TWD A;  5HCJ A;  2ZJU A;  5BP0 A;  4DBM A;  4B5D A;  2X00 A;  3UU6 A;  5HEU A;  3RI5 A;  1OED A;  3RQW A;  1UW6 A;  2M6B A;  3TLW A;  4AFH A;  5BRX A;  3C84 A;  4BFQ A;  4UY2 A;  2PGZ A;  5L4H A;  4X5T A;  4QH5 A;  2WNL A;  4WV9 A;  5KE4 A;  4LML A;  2BYQ A;  3SIO A;  2BG9 A;  3UU4 A;  5L47 A;  4A97 A;  1OED B;  2Y58 A;  4LMJ A;  2ZJV A;  5CO5 A;  2BR8 A;  2XQ9 A;  3WTO A;  4HFB A;  4ILA A;  2XQA A;  3EI0 A;  2BG9 B;  5LXB A;  2YME A;  4QH1 A;  4ILC A;  4ZZC A;  2C9T A;  2WNJ A;  3WTJ A;  5AFH A;  4HQP A;  3WTL A;  3WTI A;  5HEH A;  2YKS A;  1I9B A;  5HCM A;  4HFC A;  5AIN A;  2BJ0 A;  5KZU A;  3WIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...