4HFEA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to ethanol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfeA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfeA01
3WTIA 4A98A 3EI0A 3WIPA 5J5IA 2Y7YA 3U8NA 2XQ6A 3C79A 3GUAA 3JAFA 4TWFA 5L4EA 5FJVA 2XYTA 3JAEA 4Z90A 2M6BA 4QACA 2XQ8A 5HEGA 4UXUA 3ZKRA 4ZZCA 4B5DA 3C84A 4UM3P 3P4WA 3TLTA 4COFA 3TLSA 2LM2A 2VL0A 5AFMB 5LXBA 3UQ7A 3EHZA 4QAAA 3SQ6A 3WTJA 2XQ7A 2X00A 5HEUA 3P50A 1UV6A 3UU3A 3WTKA 2XNTA 4ZJSA 4BFQA 2BYRA 5J5GA 1UW6A 3JADA 4HFHA 2BG9C 1OEDC 4FRRA 2ZJUA 3WTHA 2M6IA 4AFTA 2LLYA 4HFDA 4UM3S 4UM1A 5HEHA 1UX2A 2QC1B 4IL9A 2WNCA 4A97A 5KE4A 4TNWA 3WTMA 2ZJVA 3IGQA 4ILAA 3EAMA 4ZK1A 3LSVA 2PGZA 4XK9A 4ZZBA 2BR7A 3TLUA 5AFKA 2XNVA 4HFCA 2XQAA 4ZJTA 4LMLA 5IUXA 4ZK4A 2XZ5A 4ZR6A 5AFNA 2X00D 3RHWA 3RI5A 4ILBA 4UM3A 3U8LA 5AFMA 2Y57A 3TLWA 2YN6A 3WTOA 5AINA 4LMKA 2WNJA 4QABA 4Z91A 2YOEA 1I9BA 3U8MA 2YMEA 4DBMA 2XQ3A 4ZRUA 4X5TA 2XNUA 2XQ9A 4NPPA 4EZ1A 2W8FA 3ZDGA 4BQTA 5KZUA 2BYSA 2Y54A 3PMZA 3WTNA 1OEDB 2YMDA 4UY2A 4HQPA 2LKHA 5BP0A 4QH5A 5L4HA 5HEJA 2XZ6A 3SH1A 3ZDHA 5L47A 5BW2A 5TVCA 2LKGA 4TWHA 4ALXA 2WZYA 5HCMA 3RQWA 3T4MA 5LG3A 3RIFA 2BJ0A 3U8JA 2Y58A 5SYOA 2UZ6A 2PH9A 3UU5A 5AFJA 4LMJA 2C9TA 5J5HA 3TLVA 2XQ4A 4IREA 2WNLA 2W8GA 2BG9E 1OEDE 2Y56A 2YKSA 4WV9A 5HEOA 4AFGA 2BYPA 3RQUA 2BG9B 4HFIA 4IL4A 4F8HA 2BR8A 4TNVA 2BYNA 4NZBA 4PIRA 4HFBA 2KSRA 5CFBA 3UU8A 2BG9A 3SIOA 1OEDA 3U8KA 3UU4A 3WTLA 4AFHA 4TWDA 5HCJA 3SQ9A 5J5FA 3UU6A 2WN9A 4XHEA 5CO5A 4QH1A 2XQ5A 3UUBA 5AFHA 2XYSA 3UQ4A 5BRXA 3RIAA 2MAWA 4HFEA 3PEOA 4D01A 5AFLA 5JMEA 2BYQA 5J0ZA 4QH4A 4ILCA
chains in the Genus database with same CATH superfamily
2OA5A 5LXTE 2W4XA 5JDHA 2XQ6A 5AQIB 4UF0A 1D0XA 3ANWB 4DVDA 4PAGA 3PUSA 2PFVA 5F8PA 1HFAA 3TLTA 2YDRA 1BR4A 4YSYA 3LBXA 1M62A 4QX7B 2VQET 4AFTA 2ZJVA 3HKCE 3EAMA 2PJQA 2WAUA 2IAKA 4DUZT 4HFCA 2XQAA 5A1LA 4LFBT 3C64A 3TKLB 2ES0A 2QYWA 5IWAT 4OK0A 3F2EA 2W8FA 3AEDA 4DV2T 5AQSB 1OEDB 2MBGA 3Q5EA 1QLBA 1I94T 2LKHA 5HXHA 4KP3C 4LF9T 4PNIA 3CQXC 5LG4A 3DP7A 4LF4T 2WDRA 1HF8A 3CX6B 2P9BA 2WNLA 3KDSE 4ADZA 2EHOC 5L3DB 4IL4A 4TNVA 2BYNA 3I0OA 4JI3T 5CA0E 4A56A 1FJGT 2J62A 5AQQB 5CO5A 4EGWA 1Z8UA 2MAWA 2CRBA 4O4LE 4MLKA 4DMWA 1B7TA 1MMNA 3C79A 2V6XA 2L8KA 4HN9A 5LP6E 4YTNA 2XSAA 2CBJA 4E7SA 3E08A 4DV4T 1MIYA 2LOPA 5AQKB 3CX8B 2X9HA 1SE7A 5LXBA 4QAAA 3KV9A 2X68A 1SHZC 3WTKA 4BFQA 2KLQA 4ZI7E 3PUGA 1YKHB 4H9NC 3MZKB 1XNRT 2DNXA 3KV5A 2IC9A 2BKNA 2B76A 2NP9A 2MTQA 2PGZA 2VASA 3CWZB 2K5BB 2XZEA 4QXCB 5AQVB 5IUXA 3UFEA 5AQFB 3U8LA 2X67A 3FZKB 4IDPA 3HKEE 3FBLA 3CQGB 5JR9A 3PUVF 5HXSA 4ZRUA 2XNUA 4BQTA 3F57A 1L0VA 5H6RB 1N36T 5AQPB 4OX9T 4O8SA 3Q2MA 1W0AA 4TWHA 3RRCA 4CXWA 5FNVE 3N5LA 4AKRB 5SYOA 4HTEA 4DR6T 2UZ6A 4UF0B 2H89A 2XQ4A 2HPLA 3AEBA 2WY2A 3H3MA 2WB5A 4QWNB 1CHUA 3AAIA 2B1EA 4JUYA 3A7MA 2KSRA 4WW0A 3SIOA 3LJCA 5HCJA 3SQ9A 2WS3A 2XAQB 3SWHA 3AE4A 4AXPA 4IDOA 2XYSA 2WMNA 3RIAA 2BZBA 3LBXB 1KNZA 4KI0F 2LM9A 1GQEA 4X1KE 4GIWA 2LSGA 4EB6E 2HN1A 3JAEA 3N2KE 4ZOLE 4EV6A 4U3CA 2VL0A 1WLXA 3RYHE 3EHZA 4DR1T 1U5PA 3CIRA 3EUHA 4UELA 1LVKA 4HGAA 1XDOA 1WCRA 3IBPA 1OEDC 4C91A 1VRBA 3OJAA 2E2AA 5L2LA 4YLHA 3QNUA 4ZK4A 3AA6B 4HFVA 2IDOB 4HWDA 3RHWA 2LHNA 2WBLA 2V7KA 1O3XA 3PTRB 4AKGA 2VB6A 3H3AA 2DL1A 1VOMA 1R8IA 1N32T 4P0BA 5L47A 5C8YE 3RC8A 5FY7A 3P4SA 5ABGA 4AI6A 2ZM0A 5HCMA 3KFWX 4ZEYA 3GMIA 2KINB 2YKSA 4YTMA 4TV9E 3RQUA 4HKAA 4P09A 2WDVA 4LF7T 2Q9QD 4NZBA 4I0UA 1NWMX 5L3BB 3UU4A 2WN9A 4YHJA 4H9QC 4L0RA 4PK5A 4JBWF 3UQ4A 5L3EB 2JPFA 4HFEA 2CA5A 3BQLA 2HHHT 2N1GA 4I55E 1HR0T 5ABEA 3AAEB 1KFYA 2IUBA 4N78D 4I43B 3K8PC 1DU2A 1IAPA 1D1BA 2DI4A 5KDMC 5J1GA 4V1Av 4HWFA 5JDLA 5FXVA 4PJLA 1E1HB 4ISTA 4ANJA 3AB3B 3HI2A 2LLYA 3B5MA 5JVDE 5LGUB 4UVBB 4K0UA 5DJQC 2CBIA 3PUWF 4K0KT 3MA9A 4LMLA 2YINA 1MMDA 2YK0A 1HS7A 4JYAT 4U31A 4NPPA 2BYSA 4PK6A 1WYCA 1Y01A 3RLFF 5L4HA 3ZMVB 4DV1T 2LKGA 3D0TA 4U2ZA 1MMAA 2CXLA 3CVRA 1NENA 3BQIA 2I6HA 3AEAA 2UXCT 4U2YA 2PH9A 2JRKA 3K3OA 1OEDE 1X9BA 2N2NA 4HFBA 2W62A 3ZEFB 5LGNB 1ZHCA 2H88A 4PFPA 4BA9A 2ODVA 3NKZA 4KHPT 5J0ZA 2KXPB 2D0TA 4IDNA 4NUUA 5AFUL 4TWFA 5L4EA 4IDZA 3ZN1B 3DTOA 3RRWA 4Z8XA 2FJEA 3HL6A 4JEUB 4BJMA 3AA7B 4X62T 4YSXA 2XQ7A 5LYJE 1G8XA 4AIUA 2AXDS 2SPCA 1NEKA 1ZV4X 1OXZA 2W61A 4G2AA 2GK9A 1UGOA 3L8RA 3O1HA 2BR7A 5ABFB 3L09A 3K3NA 3N9LA 4B3RT 5JDMA 5JRCA 2DLRA 4UVAB 2WNJA 5AQRB 2VKJA 3RX6A 5FL0A 2Y54A 2XHEB 3NBXX 2IW5B 3KVBA 4B3TT 2W67A 3ZMUB 3MJXA 4TZ4C 3J7Yq 2C9TA 4UR9A 4IREA 3HA4A 2W8GA 3LFMA 5LB7B 1X79A 1HG5A 4AFHA 3WAKA 4M1PA 5FKYA 4QH1A 2BBJA 4PJNA 1MIWA 5JR9C 4LFCT 4QH4A 1FIOA 4DV3T 4Q25A 2NW8A 2C0SA 5FJVA 5CA1E 3MACA 4Z90A 4GKKT 3RGLA 3OVUA 3ONLC 2VKDA 3Q9DA 4EXTA 2IHR1 5JDQA 3H37A 5LA6E 4DUYT 3N9QA 1KNRA 4J2CA 3ESLA 2BVMA 1HTJF 3P50A 4ZI3D 4WZXA 3G06A 4CN1A 2XPKA 2LOSA 2VKOA 4JI7T 2M6IA 3ZC1A 1HG2A 3QUJA 3X1DA 3OYXA 1BR1A 3LK2B 2Y6XA 3NWIA 4WYVA 2X9WA 2YDQA 2MPKA 2Y57A 5AINA 1CUNA 4XZCA 4CN6A 5KZUA 1D0YA 3WTNA 2YMDA 4AISA 2YDSA 3ZYMA 2WSSV 2D0UA 1XMOT 4ILUA 2W66A 4YY3T 3U78A 2X66A 3CX7B 3TLVA 4ZXLA 2Q9QC 3RPUA 4HFIA 4JI8T 1YW0A 3ZYKA 4NUVA 4PK4A 2IMLA 2Z6EA 3MKDA 4CI2B 2V6YA 3QC9A 4DR3T 4UEMA 2WM9A 3R6NA 3EI0A 2Y7YA 1WRDA 3PDYA 2K3WA 3E22E 2XYTA 3AECA 3ZKRA 3I0QA 4AKIA 2JQKA 4UXNB 2A2FX 3AE2A 3HR0A 2XASB 3AE6A 4DR2T 1ZEEA 3SQ6A 3C50A 4ZJSA 2VKHA 3A8YC 1W0BA 2ACXA 2E9XD 3VHLA 2YU2A 4CN4A 4JI2T 5HEHA 2DWKA 2WZIA 4H9RC 3WTMA 2RP4A 3V5UA 3BK9A 3KV6A 2X00D 3RKGA 3GA8A 2YOEA 1KK7A 5LBQB 2VQFT 3ZDGA 1LVFA 3PMZA 2UUBT 3P4RA 3CMLA 2OV9A 3J9X1 4HQPA 2I59A 5BP0A 2V5CA 3ZDHA 5TVCA 1KEYA 5FYMA 4DO0A 2VL8A 2XM2A 4ZI2D 2CE7A 5AFJA 5L3FB 4L9IA 2ACZA 3AE5A 3PJAJ 5JREA 4XHEA 3N9NA 4F6RC 2XQ5A 4ILCA 4A5XA 4IIJE 4PJJA 2X9XA 4YHHT 2UXDT 5CJ5A 4G63A 2J47A 3JCFA 1IJ5A 3ZT7A 4JI4T 4XBFB 3RF1A 5J2UE 2LT3A 2UXXB 3IA3A 4EAHA 3ZMTB 2J1DG 2WU5A 2WU2A 2W00A 4DIDB 5JDGA 4YFSA 2PBIA 2ZJUA 3WTHA 1XNQT 4HFDA 4IHJE 3UT5E 2V7LA 4ZK1A 3CKDA 4ERRA 4X1IE 1V9DA 3OYZA 4UM3A 2XM1A 3WTOA 3DJBA 4ZHQE 3OPCA 3ZSSA 2BBHA 1T8BA 2NOXA 2UXBT 4IGUA 1H7CA 3ZMZB 3FHNA 4O2BE 3LK3B 5HEJA 2Q9QA 3ZCJA 4DR5T 2CXDA 1SA0E 3PE0A 4CZZB 2CXFA 3AXJA 4JLEA 1I6ZA 4CI3B 5LG3A 2L3LA 3RIFA 1WYBA 4LFAT 4EYYR 1U4QA 3AA0B 5DABA 5JH7E 2YU1A 2V1DB 3P4PA 1MIVA 4ALXA 5M4YA 5AQJB 5AQOB 3RH3A 3VU7H 3NZPA 1T72A 2QGSA 5IHYA 2A3DA 4JEHB 2QVAA 5LHIB 2XSBA 3N2OA 4OYKA 4YT0A 4H63V 5FVLA 4YXDA 2FBWA 3C4WA 3T1YT 5H6QB 2ZLYA 3ETUA 4IE5A 2ZM6T 4DR7T 4ZI3C 2RA1A 1QSDA 5HEUA 1Z0PA 2KNDA 3UU3A 3RC3A 4GK0E 2BYRA 5J5GA 1UW6A 2C5KT 1US7B 2JIWA 4A97A 3PJAA 3TLUA 1UK5A 2LEHA 1Y64B 5AFNA 1YD8G 3ETVA 2PG8A 1LRZA 3TLWA 4TUYE 5JR9B 1IJ6A 2XUEA 4KUMB 4DBMA 2XQ9A 4CXYA 4JI6T 1MNEA 3FZFB 3PUZF 3PUYF 1IBLT 2EHOD 2CWYA 5AQHB 2KZ7B 4QXBB 2XQYA 4CI1B 3RQWA 4QKNA 5FVKA 2R6GF 4XAXB 3JC6D 5JTGA 1VCTA 3VRAA 4U74A 3Q5WA 3AAAB 3I1AA 4I4TE 2BG9A 3WTLA 5TAOA 2XJ7A 5AFLA 4LF6T 3WTIA 2LRLA 2RPAA 4IE0A 4AQGA 4FJOA 5HEGA 4NXNT 3QB5A 3ANWA 4U33A 3P4WA 2XAHB 1UUSA 2LM2A 3UQ7A 3EDUA 2E9XC 4DV7T 3SFEA 1FMWA 3UUMA 2Q9QB 3O1JA 4UM3S 2W2UA 1UX5A 2WNCA 2VVSA 4DBRA 2A72A 1E2AA 3AXJB 5LJNA 2HPJA 1JNRA 1MMGA 3VRBA 3MK7C 2YN6A 1ZKEA 4ASKA 4Z91A 4X5TA 4EZ1A 2V7MA 2W63A 1WFDA 2BKPA 2X0HA 4QH5A 2XZ6A 5EK2A 4QXHB 3ZJ2A 4U72A 4DBQA 3RYCE 2ZMAA 3QB5K 4IE7A 3M3ZB 4LF8T 4LMJA 5L3GB 4JV5T 2A9UA 2Y56A 3KINB 4AFGA 2BR8A 4PIRA 2JQQA 2DHRA 4H9PC 5J5FA 4NIQA 4X64T 2CMRA 3FZLB 3WIPA 5EK3A 4QACA 2LE8A 3RIUC 2FJAA 4LF5T 3TLSA 2JMHA 3PURA 3GN5A 5HXRA 3ZC0A 5AQNB 4GKJT 4E7ZA 3O1IA 4MBQA 3P8CD 4DNDA 4P1NA 2KWHA 5LHGB 1IBMT 2Y48B 4ZR6A 1FEWA 2X0YA 3V5SA 5C3JA 3WAJA 4I50E 3CQCB 4LMKA 4GK5E 3U8MA 4C90A 2ODUA 2XAJB 3PU8A 4JI0T 2FUPA 4EEBA 4ZS3A 3FXEB 1UX4A 2BJ0A 3KV4A 2BVLA 4HWCA 4GYSA 3F31A 2N9DA 1AJ3A 2BYPA 3K3QC 1XDPA 4CQIA 4DMVA 3O4XE 2LSKA 2BS2A 2JMKA 3SS1A 4D01A 3UTKA 5C2TA 4KBMB 1IZNB 5FXXA 5J5IA 3QK6A 4KMCA 2UUAT 5HWXA 3P4QA 3GUAA 2CM0A 3ZCIA 4BAYB 2E9XA 3N9PA 2XQ8A 4JI5T 4ZZCA 4UM3P 4HEAA 3FB2A 2E5VA 5LHHB 3SOLA 2X00A 2QRXA 4EIWA 2LHRA 5HXEA 2XNTA 4HE8A 3B57A 3S4UA 5HYAA 3AE8A 3UUXB 2QC1B 1HNZT 1HX8A 3IGQA 4XK9A 5EZYE 2FJDA 4U7IA 4O4HE 2WP9A 2BS3A 5JRCB 2XZ5A 1UCUA 4ILBA 4PW8A 3C51A 1KF6A 4X1YE 2WWUA 2K48A 3PUXF 4HWHA 4QABA 2MOZA 5FXZA 3VR8A 1JNZA 4HWIB 1BR2A 1T7SA 3C4XA 2M67A 3AE9A 5BMVE 5BW2A 3AEGA 2VK9A 2WMOA 4NXMT 4EOZB 3ONXA 2JQ9A 3JC6C 4U7YA 2NW7A 1M7KA 5DQWA 2V7IA 1G73A 4WV9A 5HEOA 1OWAA 3HKBE 2ZM8A 2CEAA 2L9QA 3U8KA 2G0UA 1YKEB 4OYJA 2D2SA 2UXNB 3UUBA 2MYSA 5AQMB 3PEOA 4H9OC 3GN5B 4O2AE 3RIUA 2JQHA 4A98A 3PUAA 3VKHA 3P7IA 4KHZF 3QOFA 3CK6A 2JJ9A 2WCAA 4B3ST 5FP3A 2W0GA 1YQ4A 1W9RA 5ABHA 5LJMA 2IIUA 4FI5A 3UUNA 2C5JA 4PFOA 5KX5E 4DR4T 5AQLB 3FZHB 2BG9C 4FRRA 3FBZA 2V26A 5F3JA 5KE4A 2CLYC 2J4GA 4IE4A 4P0AA 4ILAA 3LSVA 3E0ZA 4ZZBA 1BR0A 2XNVA 4AQFA 3NRYA 5L3CB 5JDNA 5AFMA 5LNKA 1J5WA 1VCSA 3W15B 3ZT5A 4IT4A 2OLTA 4WBOA 2VWAA 4AKHA 5LCYA 5KMGP 1HNXT 3ZLIA 3ZN0B 3VKGA 2XTLA 3T4MA 3PU3A 1LKXA 5FY0A 1WR6A 3T8OA 3ZSTA 3AE7A 4QHOA 2E9XB 3PUQA 3AE3A 1D0ZA 4IE6A 3ZYLA 4X66T 4B3MT 3IEEA 2V6YB 4OHFA 3UU6A 4EEDA 2HN2A 4MFRA 4CXXA 5HXCA 2BYQA 2LSJA 3N2GE 2WDQA 5FXWA 1FMVA 2E5LT 5LMUT 3IF8B 3JAFA 4DV0T 4ZS2A 2XY8B 4UXUA 5IYZE 4B5DA 2X51A 1ZOYA 5BR8T 1YXRA 1UURA 5F5WA 4MHCA 3O9XA 4IDQA 1N34T 4ISSA 2DWGA 3KBUA 3NZQA 4UV9B 3PV0F 1QUUA 1MNDA 3SFDA 3WI3A 1YQ3A 3EVYA 2K9AA 3M65A 5LGTB 3T1HT 1EZ3A 3FXDB 2LRKA 2EHOA 2CHNA 5HWYA 3IHRA 4B6XA 5ABFA 5LMNT 4JI1T 2H7VC 3C4ZA 1I9BA 2YMEA 2XQ3A 1S94A 2V8SV 2V5DA 3OKQA 5CGMA 3SH1A 5ADXL 1J5ET 2CCQA 4YJ2E 1ZP0A 4UVCB 4EZ4A 3OTOT 5ETWA 4UV8B 1N33T 5FY1A 1WR0A 2D5UA 3LG7A 2BG9E 4O4IE 2BDEA 2NWBA 3ZJ1A 1IBKT 5EK4A 5KXJA 4YSZA 4AKLA 2KWIB 5CB4E 4EYUA 3LK42 1HCIA 3UU8A 5CFBA 3U3IA 2HH7A 2X0LB 4BJNA 3KVAA 4YTPA 2UU9T 2AE9A 5JMEA 4GOUA 2XAGB 4TX5A 3U8NA 3N9OA 2LJLA 4O4JE 2D9DA 5DQVA 2BKOA 3AVRA 4X65T 2NW9A 3I9WA 2IC6A 5AQTB 4COFA 5AFMB 3K1SA 3KBTA 1D1AA 2Y8DA 2V7JA 5E0OA 2FJBA 3RKOA 3JADA 4HFHA 2PTFA 2WWVA 4UM1A 4TNWA 3Q5DA 2KMFA 4TV8E 5AFKA 4ZJTA 4OFZA 4QX8B 2H3RA 3Q5XA 3L39A 3AE1A 1S35A 5GONE 3AA1B 4DV6T 2ZM2A 4PJMA 4EZHA 3FZMB 1W09A 3AEFA 4WBNE 2CWOA 3ZT6A 2BS4A 4YJ3E 3RYIE 4KX6A 2WZYA 2QA7A 1E7PA 3ONJA 1HNWT 2Y58A 3UU5A 5LBMA 1T98A 1D1CA 2CPTA 3CPZA 4WNKA 4MALA 4GYRA 4F8HA 3C98B 2CHOA 1OEDA 4ZI2C 3N9MA 5AFHA 3R84B 5BRXA 1KNPA 2NTYA 5J2TE 5HAXA 3UULA 2DCFA 3ZPOA 3B13A 2M6BA 2EHOB 2YEVC 5FL1A 3C84A 3HKDE 3EABA 3SRZA 2H7OA 5JDFA 2WQYA 2E8IA 3WTJA 4H9SE 3AEEA 4TN7B 1UV6A 3UFGA 3ABVA 4H63H 2NR4A 5LOVE 4AQYT 3NRXA 3VR9A 1UX2A 4IL9A 3ZMSB 3EDVA 2K24A 2NTXA 3BQKA 2XAFB 1XWMA 3RI5A 2VURA 3NVOA 4X20E 4L5GA 2VVNA 3I9YA 2UUCT 3AVSA 5FMNA 4UY2A 2LSIA 2F4VT 3GWHA 1NAFA 2WZHA 3LDQB 3MXZA 1XMQT 1SUMB 3U8JA 1HX1B 5J5HA 4DV5T 4UIGA 3L3PA 5AQUB 3A5XA 2BG9B 2KT9A 3RYFE 5AQGB 4AQFC 1XZYA 1J1JA 4TWDA 2CLYB 3OBVE 5JQGE 2C5IT 2LSYA 2X9YA 2I0MA
chains in the Genus database with same CATH topology
3WTIA 4A98A 3EI0A 3WIPA 5J5IA 2Y7YA 3U8NA 2XQ6A 3C79A 3GUAA 3JAFA 4TWFA 5L4EA 5FJVA 2XYTA 3JAEA 4Z90A 2M6BA 4QACA 2XQ8A 5HEGA 4UXUA 3ZKRA 4ZZCA 4B5DA 3C84A 4UM3P 3P4WA 3TLTA 4COFA 3TLSA 2LM2A 2VL0A 5AFMB 5LXBA 3UQ7A 3EHZA 4QAAA 3SQ6A 3WTJA 2XQ7A 2X00A 5HEUA 3P50A 1UV6A 3UU3A 3WTKA 2XNTA 4ZJSA 4BFQA 2BYRA 5J5GA 1UW6A 3JADA 4HFHA 2BG9C 1OEDC 4FRRA 2ZJUA 3WTHA 2M6IA 4AFTA 2LLYA 4HFDA 4UM3S 4UM1A 5HEHA 1UX2A 2QC1B 4IL9A 2WNCA 4A97A 5KE4A 4TNWA 3WTMA 2ZJVA 3IGQA 4ILAA 3EAMA 4ZK1A 3LSVA 2PGZA 4XK9A 4ZZBA 2BR7A 3TLUA 5AFKA 2XNVA 4HFCA 2XQAA 4ZJTA 4LMLA 5IUXA 4ZK4A 2XZ5A 4ZR6A 5AFNA 2X00D 3RHWA 3RI5A 4ILBA 4UM3A 3U8LA 5AFMA 2Y57A 3TLWA 2YN6A 3WTOA 5AINA 4LMKA 2WNJA 4QABA 4Z91A 2YOEA 1I9BA 3U8MA 2YMEA 4DBMA 2XQ3A 4ZRUA 4X5TA 2XNUA 2XQ9A 4NPPA 4EZ1A 2W8FA 3ZDGA 4BQTA 5KZUA 2BYSA 2Y54A 3PMZA 3WTNA 1OEDB 2YMDA 4UY2A 4HQPA 2LKHA 5BP0A 4QH5A 5L4HA 5HEJA 2XZ6A 3SH1A 3ZDHA 5L47A 5BW2A 5TVCA 2LKGA 4TWHA 4ALXA 2WZYA 5HCMA 3RQWA 3T4MA 5LG3A 3RIFA 2BJ0A 3U8JA 2Y58A 5SYOA 2UZ6A 2PH9A 3UU5A 5AFJA 4LMJA 2C9TA 5J5HA 3TLVA 2XQ4A 4IREA 2WNLA 2W8GA 2BG9E 1OEDE 2Y56A 2YKSA 4WV9A 5HEOA 4AFGA 2BYPA 3RQUA 2BG9B 4HFIA 4IL4A 4F8HA 2BR8A 4TNVA 2BYNA 4NZBA 4PIRA 4HFBA 2KSRA 5CFBA 3UU8A 2BG9A 3SIOA 1OEDA 3U8KA 3UU4A 3WTLA 4AFHA 4TWDA 5HCJA 3SQ9A 5J5FA 3UU6A 2WN9A 4XHEA 5CO5A 4QH1A 2XQ5A 3UUBA 5AFHA 2XYSA 3UQ4A 5BRXA 3RIAA 2MAWA 4HFEA 3PEOA 4D01A 5AFLA 5JMEA 2BYQA 5J0ZA 4QH4A 4ILCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTI A;  4A98 A;  3EI0 A;  3WIP A;  5J5I A;  2Y7Y A;  3U8N A;  2XQ6 A;  3C79 A;  3GUA A;  3JAF A;  4TWF A;  5L4E A;  5FJV A;  2XYT A;  3JAE A;  4Z90 A;  2M6B A;  4QAC A;  2XQ8 A;  5HEG A;  4UXU A;  3ZKR A;  4ZZC A;  4B5D A;  3C84 A;  4UM3 P;  3P4W A;  3TLT A;  4COF A;  3TLS A;  2LM2 A;  2VL0 A;  5AFM B;  5LXB A;  3UQ7 A;  3EHZ A;  4QAA A;  3SQ6 A;  3WTJ A;  2XQ7 A;  2X00 A;  5HEU A;  3P50 A;  1UV6 A;  3UU3 A;  3WTK A;  2XNT A;  4ZJS A;  4BFQ A;  2BYR A;  5J5G A;  1UW6 A;  3JAD A;  4HFH A;  2BG9 C;  1OED C;  4FRR A;  2ZJU A;  3WTH A;  2M6I A;  4AFT A;  2LLY A;  4HFD A;  4UM3 S;  4UM1 A;  5HEH A;  1UX2 A;  2QC1 B;  4IL9 A;  2WNC A;  4A97 A;  5KE4 A;  4TNW A;  3WTM A;  2ZJV A;  3IGQ A;  4ILA A;  3EAM A;  4ZK1 A;  3LSV A;  2PGZ A;  4XK9 A;  4ZZB A;  2BR7 A;  3TLU A;  5AFK A;  2XNV A;  4HFC A;  2XQA A;  4ZJT A;  4LML A;  5IUX A;  4ZK4 A;  2XZ5 A;  4ZR6 A;  5AFN A;  2X00 D;  3RHW A;  3RI5 A;  4ILB A;  4UM3 A;  3U8L A;  5AFM A;  2Y57 A;  3TLW A;  2YN6 A;  3WTO A;  5AIN A;  4LMK A;  2WNJ A;  4QAB A;  4Z91 A;  2YOE A;  1I9B A;  3U8M A;  2YME A;  4DBM A;  2XQ3 A;  4ZRU A;  4X5T A;  2XNU A;  2XQ9 A;  4NPP A;  4EZ1 A;  2W8F A;  3ZDG A;  4BQT A;  5KZU A;  2BYS A;  2Y54 A;  3PMZ A;  3WTN A;  1OED B;  2YMD A;  4UY2 A;  4HQP A;  2LKH A;  5BP0 A;  4QH5 A;  5L4H A;  5HEJ A;  2XZ6 A;  3SH1 A;  3ZDH A;  5L47 A;  5BW2 A;  5TVC A;  2LKG A;  4TWH A;  4ALX A;  2WZY A;  5HCM A;  3RQW A;  3T4M A;  5LG3 A;  3RIF A;  2BJ0 A;  3U8J A;  2Y58 A;  5SYO A;  2UZ6 A;  2PH9 A;  3UU5 A;  5AFJ A;  4LMJ A;  2C9T A;  5J5H A;  3TLV A;  2XQ4 A;  4IRE A;  2WNL A;  2W8G A;  2BG9 E;  1OED E;  2Y56 A;  2YKS A;  4WV9 A;  5HEO A;  4AFG A;  2BYP A;  3RQU A;  2BG9 B;  4HFI A;  4IL4 A;  4F8H A;  2BR8 A;  4TNV A;  2BYN A;  4NZB A;  4PIR A;  4HFB A;  2KSR A;  5CFB A;  3UU8 A;  2BG9 A;  3SIO A;  1OED A;  3U8K A;  3UU4 A;  3WTL A;  4AFH A;  4TWD A;  5HCJ A;  3SQ9 A;  5J5F A;  3UU6 A;  2WN9 A;  4XHE A;  5CO5 A;  4QH1 A;  2XQ5 A;  3UUB A;  5AFH A;  2XYS A;  3UQ4 A;  5BRX A;  3RIA A;  2MAW A;  4HFE A;  3PEO A;  4D01 A;  5AFL A;  5JME A;  2BYQ A;  5J0Z A;  4QH4 A;  4ILC A; 
#chains in the Genus database with same CATH topology
 2OA5 A;  5LXT E;  2W4X A;  5JDH A;  2XQ6 A;  5AQI B;  4UF0 A;  1D0X A;  3ANW B;  4DVD A;  4PAG A;  3PUS A;  2PFV A;  5F8P A;  1HFA A;  3TLT A;  2YDR A;  1BR4 A;  4YSY A;  3LBX A;  1M62 A;  4QX7 B;  2VQE T;  4AFT A;  2ZJV A;  3HKC E;  3EAM A;  2PJQ A;  2WAU A;  2IAK A;  4DUZ T;  4HFC A;  2XQA A;  5A1L A;  4LFB T;  3C64 A;  3TKL B;  2ES0 A;  2QYW A;  5IWA T;  4OK0 A;  3F2E A;  2W8F A;  3AED A;  4DV2 T;  5AQS B;  1OED B;  2MBG A;  3Q5E A;  1QLB A;  1I94 T;  2LKH A;  5HXH A;  4KP3 C;  4LF9 T;  4PNI A;  3CQX C;  5LG4 A;  3DP7 A;  4LF4 T;  2WDR A;  1HF8 A;  3CX6 B;  2P9B A;  2WNL A;  3KDS E;  4ADZ A;  2EHO C;  5L3D B;  4IL4 A;  4TNV A;  2BYN A;  3I0O A;  4JI3 T;  5CA0 E;  4A56 A;  1FJG T;  2J62 A;  5AQQ B;  5CO5 A;  4EGW A;  1Z8U A;  2MAW A;  2CRB A;  4O4L E;  4MLK A;  4DMW A;  1B7T A;  1MMN A;  3C79 A;  2V6X A;  2L8K A;  4HN9 A;  5LP6 E;  4YTN A;  2XSA A;  2CBJ A;  4E7S A;  3E08 A;  4DV4 T;  1MIY A;  2LOP A;  5AQK B;  3CX8 B;  2X9H A;  1SE7 A;  5LXB A;  4QAA A;  3KV9 A;  2X68 A;  1SHZ C;  3WTK A;  4BFQ A;  2KLQ A;  4ZI7 E;  3PUG A;  1YKH B;  4H9N C;  3MZK B;  1XNR T;  2DNX A;  3KV5 A;  2IC9 A;  2BKN A;  2B76 A;  2NP9 A;  2MTQ A;  2PGZ A;  2VAS A;  3CWZ B;  2K5B B;  2XZE A;  4QXC B;  5AQV B;  5IUX A;  3UFE A;  5AQF B;  3U8L A;  2X67 A;  3FZK B;  4IDP A;  3HKE E;  3FBL A;  3CQG B;  5JR9 A;  3PUV F;  5HXS A;  4ZRU A;  2XNU A;  4BQT A;  3F57 A;  1L0V A;  5H6R B;  1N36 T;  5AQP B;  4OX9 T;  4O8S A;  3Q2M A;  1W0A A;  4TWH A;  3RRC A;  4CXW A;  5FNV E;  3N5L A;  4AKR B;  5SYO A;  4HTE A;  4DR6 T;  2UZ6 A;  4UF0 B;  2H89 A;  2XQ4 A;  2HPL A;  3AEB A;  2WY2 A;  3H3M A;  2WB5 A;  4QWN B;  1CHU A;  3AAI A;  2B1E A;  4JUY A;  3A7M A;  2KSR A;  4WW0 A;  3SIO A;  3LJC A;  5HCJ A;  3SQ9 A;  2WS3 A;  2XAQ B;  3SWH A;  3AE4 A;  4AXP A;  4IDO A;  2XYS A;  2WMN A;  3RIA A;  2BZB A;  3LBX B;  1KNZ A;  4KI0 F;  2LM9 A;  1GQE A;  4X1K E;  4GIW A;  2LSG A;  4EB6 E;  2HN1 A;  3JAE A;  3N2K E;  4ZOL E;  4EV6 A;  4U3C A;  2VL0 A;  1WLX A;  3RYH E;  3EHZ A;  4DR1 T;  1U5P A;  3CIR A;  3EUH A;  4UEL A;  1LVK A;  4HGA A;  1XDO A;  1WCR A;  3IBP A;  1OED C;  4C91 A;  1VRB A;  3OJA A;  2E2A A;  5L2L A;  4YLH A;  3QNU A;  4ZK4 A;  3AA6 B;  4HFV A;  2IDO B;  4HWD A;  3RHW A;  2LHN A;  2WBL A;  2V7K A;  1O3X A;  3PTR B;  4AKG A;  2VB6 A;  3H3A A;  2DL1 A;  1VOM A;  1R8I A;  1N32 T;  4P0B A;  5L47 A;  5C8Y E;  3RC8 A;  5FY7 A;  3P4S A;  5ABG A;  4AI6 A;  2ZM0 A;  5HCM A;  3KFW X;  4ZEY A;  3GMI A;  2KIN B;  2YKS A;  4YTM A;  4TV9 E;  3RQU A;  4HKA A;  4P09 A;  2WDV A;  4LF7 T;  2Q9Q D;  4NZB A;  4I0U A;  1NWM X;  5L3B B;  3UU4 A;  2WN9 A;  4YHJ A;  4H9Q C;  4L0R A;  4PK5 A;  4JBW F;  3UQ4 A;  5L3E B;  2JPF A;  4HFE A;  2CA5 A;  3BQL A;  2HHH T;  2N1G A;  4I55 E;  1HR0 T;  5ABE A;  3AAE B;  1KFY A;  2IUB A;  4N78 D;  4I43 B;  3K8P C;  1DU2 A;  1IAP A;  1D1B A;  2DI4 A;  5KDM C;  5J1G A;  4V1A v;  4HWF A;  5JDL A;  5FXV A;  4PJL A;  1E1H B;  4IST A;  4ANJ A;  3AB3 B;  3HI2 A;  2LLY A;  3B5M A;  5JVD E;  5LGU B;  4UVB B;  4K0U A;  5DJQ C;  2CBI A;  3PUW F;  4K0K T;  3MA9 A;  4LML A;  2YIN A;  1MMD A;  2YK0 A;  1HS7 A;  4JYA T;  4U31 A;  4NPP A;  2BYS A;  4PK6 A;  1WYC A;  1Y01 A;  3RLF F;  5L4H A;  3ZMV B;  4DV1 T;  2LKG A;  3D0T A;  4U2Z A;  1MMA A;  2CXL A;  3CVR A;  1NEN A;  3BQI A;  2I6H A;  3AEA A;  2UXC T;  4U2Y A;  2PH9 A;  2JRK A;  3K3O A;  1OED E;  1X9B A;  2N2N A;  4HFB A;  2W62 A;  3ZEF B;  5LGN B;  1ZHC A;  2H88 A;  4PFP A;  4BA9 A;  2ODV A;  3NKZ A;  4KHP T;  5J0Z A;  2KXP B;  2D0T A;  4IDN A;  4NUU A;  5AFU L;  4TWF A;  5L4E A;  4IDZ A;  3ZN1 B;  3DTO A;  3RRW A;  4Z8X A;  2FJE A;  3HL6 A;  4JEU B;  4BJM A;  3AA7 B;  4X62 T;  4YSX A;  2XQ7 A;  5LYJ E;  1G8X A;  4AIU A;  2AXD S;  2SPC A;  1NEK A;  1ZV4 X;  1OXZ A;  2W61 A;  4G2A A;  2GK9 A;  1UGO A;  3L8R A;  3O1H A;  2BR7 A;  5ABF B;  3L09 A;  3K3N A;  3N9L A;  4B3R T;  5JDM A;  5JRC A;  2DLR A;  4UVA B;  2WNJ A;  5AQR B;  2VKJ A;  3RX6 A;  5FL0 A;  2Y54 A;  2XHE B;  3NBX X;  2IW5 B;  3KVB A;  4B3T T;  2W67 A;  3ZMU B;  3MJX A;  4TZ4 C;  3J7Y q;  2C9T A;  4UR9 A;  4IRE A;  3HA4 A;  2W8G A;  3LFM A;  5LB7 B;  1X79 A;  1HG5 A;  4AFH A;  3WAK A;  4M1P A;  5FKY A;  4QH1 A;  2BBJ A;  4PJN A;  1MIW A;  5JR9 C;  4LFC T;  4QH4 A;  1FIO A;  4DV3 T;  4Q25 A;  2NW8 A;  2C0S A;  5FJV A;  5CA1 E;  3MAC A;  4Z90 A;  4GKK T;  3RGL A;  3OVU A;  3ONL C;  2VKD A;  3Q9D A;  4EXT A;  2IHR 1;  5JDQ A;  3H37 A;  5LA6 E;  4DUY T;  3N9Q A;  1KNR A;  4J2C A;  3ESL A;  2BVM A;  1HTJ F;  3P50 A;  4ZI3 D;  4WZX A;  3G06 A;  4CN1 A;  2XPK A;  2LOS A;  2VKO A;  4JI7 T;  2M6I A;  3ZC1 A;  1HG2 A;  3QUJ A;  3X1D A;  3OYX A;  1BR1 A;  3LK2 B;  2Y6X A;  3NWI A;  4WYV A;  2X9W A;  2YDQ A;  2MPK A;  2Y57 A;  5AIN A;  1CUN A;  4XZC A;  4CN6 A;  5KZU A;  1D0Y A;  3WTN A;  2YMD A;  4AIS A;  2YDS A;  3ZYM A;  2WSS V;  2D0U A;  1XMO T;  4ILU A;  2W66 A;  4YY3 T;  3U78 A;  2X66 A;  3CX7 B;  3TLV A;  4ZXL A;  2Q9Q C;  3RPU A;  4HFI A;  4JI8 T;  1YW0 A;  3ZYK A;  4NUV A;  4PK4 A;  2IML A;  2Z6E A;  3MKD A;  4CI2 B;  2V6Y A;  3QC9 A;  4DR3 T;  4UEM A;  2WM9 A;  3R6N A;  3EI0 A;  2Y7Y A;  1WRD A;  3PDY A;  2K3W A;  3E22 E;  2XYT A;  3AEC A;  3ZKR A;  3I0Q A;  4AKI A;  2JQK A;  4UXN B;  2A2F X;  3AE2 A;  3HR0 A;  2XAS B;  3AE6 A;  4DR2 T;  1ZEE A;  3SQ6 A;  3C50 A;  4ZJS A;  2VKH A;  3A8Y C;  1W0B A;  2ACX A;  2E9X D;  3VHL A;  2YU2 A;  4CN4 A;  4JI2 T;  5HEH A;  2DWK A;  2WZI A;  4H9R C;  3WTM A;  2RP4 A;  3V5U A;  3BK9 A;  3KV6 A;  2X00 D;  3RKG A;  3GA8 A;  2YOE A;  1KK7 A;  5LBQ B;  2VQF T;  3ZDG A;  1LVF A;  3PMZ A;  2UUB T;  3P4R A;  3CML A;  2OV9 A;  3J9X 1;  4HQP A;  2I59 A;  5BP0 A;  2V5C A;  3ZDH A;  5TVC A;  1KEY A;  5FYM A;  4DO0 A;  2VL8 A;  2XM2 A;  4ZI2 D;  2CE7 A;  5AFJ A;  5L3F B;  4L9I A;  2ACZ A;  3AE5 A;  3PJA J;  5JRE A;  4XHE A;  3N9N A;  4F6R C;  2XQ5 A;  4ILC A;  4A5X A;  4IIJ E;  4PJJ A;  2X9X A;  4YHH T;  2UXD T;  5CJ5 A;  4G63 A;  2J47 A;  3JCF A;  1IJ5 A;  3ZT7 A;  4JI4 T;  4XBF B;  3RF1 A;  5J2U E;  2LT3 A;  2UXX B;  3IA3 A;  4EAH A;  3ZMT B;  2J1D G;  2WU5 A;  2WU2 A;  2W00 A;  4DID B;  5JDG A;  4YFS A;  2PBI A;  2ZJU A;  3WTH A;  1XNQ T;  4HFD A;  4IHJ E;  3UT5 E;  2V7L A;  4ZK1 A;  3CKD A;  4ERR A;  4X1I E;  1V9D A;  3OYZ A;  4UM3 A;  2XM1 A;  3WTO A;  3DJB A;  4ZHQ E;  3OPC A;  3ZSS A;  2BBH A;  1T8B A;  2NOX A;  2UXB T;  4IGU A;  1H7C A;  3ZMZ B;  3FHN A;  4O2B E;  3LK3 B;  5HEJ A;  2Q9Q A;  3ZCJ A;  4DR5 T;  2CXD A;  1SA0 E;  3PE0 A;  4CZZ B;  2CXF A;  3AXJ A;  4JLE A;  1I6Z A;  4CI3 B;  5LG3 A;  2L3L A;  3RIF A;  1WYB A;  4LFA T;  4EYY R;  1U4Q A;  3AA0 B;  5DAB A;  5JH7 E;  2YU1 A;  2V1D B;  3P4P A;  1MIV A;  4ALX A;  5M4Y A;  5AQJ B;  5AQO B;  3RH3 A;  3VU7 H;  3NZP A;  1T72 A;  2QGS A;  5IHY A;  2A3D A;  4JEH B;  2QVA A;  5LHI B;  2XSB A;  3N2O A;  4OYK A;  4YT0 A;  4H63 V;  5FVL A;  4YXD A;  2FBW A;  3C4W A;  3T1Y T;  5H6Q B;  2ZLY A;  3ETU A;  4IE5 A;  2ZM6 T;  4DR7 T;  4ZI3 C;  2RA1 A;  1QSD A;  5HEU A;  1Z0P A;  2KND A;  3UU3 A;  3RC3 A;  4GK0 E;  2BYR A;  5J5G A;  1UW6 A;  2C5K T;  1US7 B;  2JIW A;  4A97 A;  3PJA A;  3TLU A;  1UK5 A;  2LEH A;  1Y64 B;  5AFN A;  1YD8 G;  3ETV A;  2PG8 A;  1LRZ A;  3TLW A;  4TUY E;  5JR9 B;  1IJ6 A;  2XUE A;  4KUM B;  4DBM A;  2XQ9 A;  4CXY A;  4JI6 T;  1MNE A;  3FZF B;  3PUZ F;  3PUY F;  1IBL T;  2EHO D;  2CWY A;  5AQH B;  2KZ7 B;  4QXB B;  2XQY A;  4CI1 B;  3RQW A;  4QKN A;  5FVK A;  2R6G F;  4XAX B;  3JC6 D;  5JTG A;  1VCT A;  3VRA A;  4U74 A;  3Q5W A;  3AAA B;  3I1A A;  4I4T E;  2BG9 A;  3WTL A;  5TAO A;  2XJ7 A;  5AFL A;  4LF6 T;  3WTI A;  2LRL A;  2RPA A;  4IE0 A;  4AQG A;  4FJO A;  5HEG A;  4NXN T;  3QB5 A;  3ANW A;  4U33 A;  3P4W A;  2XAH B;  1UUS A;  2LM2 A;  3UQ7 A;  3EDU A;  2E9X C;  4DV7 T;  3SFE A;  1FMW A;  3UUM A;  2Q9Q B;  3O1J A;  4UM3 S;  2W2U A;  1UX5 A;  2WNC A;  2VVS A;  4DBR A;  2A72 A;  1E2A A;  3AXJ B;  5LJN A;  2HPJ A;  1JNR A;  1MMG A;  3VRB A;  3MK7 C;  2YN6 A;  1ZKE A;  4ASK A;  4Z91 A;  4X5T A;  4EZ1 A;  2V7M A;  2W63 A;  1WFD A;  2BKP A;  2X0H A;  4QH5 A;  2XZ6 A;  5EK2 A;  4QXH B;  3ZJ2 A;  4U72 A;  4DBQ A;  3RYC E;  2ZMA A;  3QB5 K;  4IE7 A;  3M3Z B;  4LF8 T;  4LMJ A;  5L3G B;  4JV5 T;  2A9U A;  2Y56 A;  3KIN B;  4AFG A;  2BR8 A;  4PIR A;  2JQQ A;  2DHR A;  4H9P C;  5J5F A;  4NIQ A;  4X64 T;  2CMR A;  3FZL B;  3WIP A;  5EK3 A;  4QAC A;  2LE8 A;  3RIU C;  2FJA A;  4LF5 T;  3TLS A;  2JMH A;  3PUR A;  3GN5 A;  5HXR A;  3ZC0 A;  5AQN B;  4GKJ T;  4E7Z A;  3O1I A;  4MBQ A;  3P8C D;  4DND A;  4P1N A;  2KWH A;  5LHG B;  1IBM T;  2Y48 B;  4ZR6 A;  1FEW A;  2X0Y A;  3V5S A;  5C3J A;  3WAJ A;  4I50 E;  3CQC B;  4LMK A;  4GK5 E;  3U8M A;  4C90 A;  2ODU A;  2XAJ B;  3PU8 A;  4JI0 T;  2FUP A;  4EEB A;  4ZS3 A;  3FXE B;  1UX4 A;  2BJ0 A;  3KV4 A;  2BVL A;  4HWC A;  4GYS A;  3F31 A;  2N9D A;  1AJ3 A;  2BYP A;  3K3Q C;  1XDP A;  4CQI A;  4DMV A;  3O4X E;  2LSK A;  2BS2 A;  2JMK A;  3SS1 A;  4D01 A;  3UTK A;  5C2T A;  4KBM B;  1IZN B;  5FXX A;  5J5I A;  3QK6 A;  4KMC A;  2UUA T;  5HWX A;  3P4Q A;  3GUA A;  2CM0 A;  3ZCI A;  4BAY B;  2E9X A;  3N9P A;  2XQ8 A;  4JI5 T;  4ZZC A;  4UM3 P;  4HEA A;  3FB2 A;  2E5V A;  5LHH B;  3SOL A;  2X00 A;  2QRX A;  4EIW A;  2LHR A;  5HXE A;  2XNT A;  4HE8 A;  3B57 A;  3S4U A;  5HYA A;  3AE8 A;  3UUX B;  2QC1 B;  1HNZ T;  1HX8 A;  3IGQ A;  4XK9 A;  5EZY E;  2FJD A;  4U7I A;  4O4H E;  2WP9 A;  2BS3 A;  5JRC B;  2XZ5 A;  1UCU A;  4ILB A;  4PW8 A;  3C51 A;  1KF6 A;  4X1Y E;  2WWU A;  2K48 A;  3PUX F;  4HWH A;  4QAB A;  2MOZ A;  5FXZ A;  3VR8 A;  1JNZ A;  4HWI B;  1BR2 A;  1T7S A;  3C4X A;  2M67 A;  3AE9 A;  5BMV E;  5BW2 A;  3AEG A;  2VK9 A;  2WMO A;  4NXM T;  4EOZ B;  3ONX A;  2JQ9 A;  3JC6 C;  4U7Y A;  2NW7 A;  1M7K A;  5DQW A;  2V7I A;  1G73 A;  4WV9 A;  5HEO A;  1OWA A;  3HKB E;  2ZM8 A;  2CEA A;  2L9Q A;  3U8K A;  2G0U A;  1YKE B;  4OYJ A;  2D2S A;  2UXN B;  3UUB A;  2MYS A;  5AQM B;  3PEO A;  4H9O C;  3GN5 B;  4O2A E;  3RIU A;  2JQH A;  4A98 A;  3PUA A;  3VKH A;  3P7I A;  4KHZ F;  3QOF A;  3CK6 A;  2JJ9 A;  2WCA A;  4B3S T;  5FP3 A;  2W0G A;  1YQ4 A;  1W9R A;  5ABH A;  5LJM A;  2IIU A;  4FI5 A;  3UUN A;  2C5J A;  4PFO A;  5KX5 E;  4DR4 T;  5AQL B;  3FZH B;  2BG9 C;  4FRR A;  3FBZ A;  2V26 A;  5F3J A;  5KE4 A;  2CLY C;  2J4G A;  4IE4 A;  4P0A A;  4ILA A;  3LSV A;  3E0Z A;  4ZZB A;  1BR0 A;  2XNV A;  4AQF A;  3NRY A;  5L3C B;  5JDN A;  5AFM A;  5LNK A;  1J5W A;  1VCS A;  3W15 B;  3ZT5 A;  4IT4 A;  2OLT A;  4WBO A;  2VWA A;  4AKH A;  5LCY A;  5KMG P;  1HNX T;  3ZLI A;  3ZN0 B;  3VKG A;  2XTL A;  3T4M A;  3PU3 A;  1LKX A;  5FY0 A;  1WR6 A;  3T8O A;  3ZST A;  3AE7 A;  4QHO A;  2E9X B;  3PUQ A;  3AE3 A;  1D0Z A;  4IE6 A;  3ZYL A;  4X66 T;  4B3M T;  3IEE A;  2V6Y B;  4OHF A;  3UU6 A;  4EED A;  2HN2 A;  4MFR A;  4CXX A;  5HXC A;  2BYQ A;  2LSJ A;  3N2G E;  2WDQ A;  5FXW A;  1FMV A;  2E5L T;  5LMU T;  3IF8 B;  3JAF A;  4DV0 T;  4ZS2 A;  2XY8 B;  4UXU A;  5IYZ E;  4B5D A;  2X51 A;  1ZOY A;  5BR8 T;  1YXR A;  1UUR A;  5F5W A;  4MHC A;  3O9X A;  4IDQ A;  1N34 T;  4ISS A;  2DWG A;  3KBU A;  3NZQ A;  4UV9 B;  3PV0 F;  1QUU A;  1MND A;  3SFD A;  3WI3 A;  1YQ3 A;  3EVY A;  2K9A A;  3M65 A;  5LGT B;  3T1H T;  1EZ3 A;  3FXD B;  2LRK A;  2EHO A;  2CHN A;  5HWY A;  3IHR A;  4B6X A;  5ABF A;  5LMN T;  4JI1 T;  2H7V C;  3C4Z A;  1I9B A;  2YME A;  2XQ3 A;  1S94 A;  2V8S V;  2V5D A;  3OKQ A;  5CGM A;  3SH1 A;  5ADX L;  1J5E T;  2CCQ A;  4YJ2 E;  1ZP0 A;  4UVC B;  4EZ4 A;  3OTO T;  5ETW A;  4UV8 B;  1N33 T;  5FY1 A;  1WR0 A;  2D5U A;  3LG7 A;  2BG9 E;  4O4I E;  2BDE A;  2NWB A;  3ZJ1 A;  1IBK T;  5EK4 A;  5KXJ A;  4YSZ A;  4AKL A;  2KWI B;  5CB4 E;  4EYU A;  3LK4 2;  1HCI A;  3UU8 A;  5CFB A;  3U3I A;  2HH7 A;  2X0L B;  4BJN A;  3KVA A;  4YTP A;  2UU9 T;  2AE9 A;  5JME A;  4GOU A;  2XAG B;  4TX5 A;  3U8N A;  3N9O A;  2LJL A;  4O4J E;  2D9D A;  5DQV A;  2BKO A;  3AVR A;  4X65 T;  2NW9 A;  3I9W A;  2IC6 A;  5AQT B;  4COF A;  5AFM B;  3K1S A;  3KBT A;  1D1A A;  2Y8D A;  2V7J A;  5E0O A;  2FJB A;  3RKO A;  3JAD A;  4HFH A;  2PTF A;  2WWV A;  4UM1 A;  4TNW A;  3Q5D A;  2KMF A;  4TV8 E;  5AFK A;  4ZJT A;  4OFZ A;  4QX8 B;  2H3R A;  3Q5X A;  3L39 A;  3AE1 A;  1S35 A;  5GON E;  3AA1 B;  4DV6 T;  2ZM2 A;  4PJM A;  4EZH A;  3FZM B;  1W09 A;  3AEF A;  4WBN E;  2CWO A;  3ZT6 A;  2BS4 A;  4YJ3 E;  3RYI E;  4KX6 A;  2WZY A;  2QA7 A;  1E7P A;  3ONJ A;  1HNW T;  2Y58 A;  3UU5 A;  5LBM A;  1T98 A;  1D1C A;  2CPT A;  3CPZ A;  4WNK A;  4MAL A;  4GYR A;  4F8H A;  3C98 B;  2CHO A;  1OED A;  4ZI2 C;  3N9M A;  5AFH A;  3R84 B;  5BRX A;  1KNP A;  2NTY A;  5J2T E;  5HAX A;  3UUL A;  2DCF A;  3ZPO A;  3B13 A;  2M6B A;  2EHO B;  2YEV C;  5FL1 A;  3C84 A;  3HKD E;  3EAB A;  3SRZ A;  2H7O A;  5JDF A;  2WQY A;  2E8I A;  3WTJ A;  4H9S E;  3AEE A;  4TN7 B;  1UV6 A;  3UFG A;  3ABV A;  4H63 H;  2NR4 A;  5LOV E;  4AQY T;  3NRX A;  3VR9 A;  1UX2 A;  4IL9 A;  3ZMS B;  3EDV A;  2K24 A;  2NTX A;  3BQK A;  2XAF B;  1XWM A;  3RI5 A;  2VUR A;  3NVO A;  4X20 E;  4L5G A;  2VVN A;  3I9Y A;  2UUC T;  3AVS A;  5FMN A;  4UY2 A;  2LSI A;  2F4V T;  3GWH A;  1NAF A;  2WZH A;  3LDQ B;  3MXZ A;  1XMQ T;  1SUM B;  3U8J A;  1HX1 B;  5J5H A;  4DV5 T;  4UIG A;  3L3P A;  5AQU B;  3A5X A;  2BG9 B;  2KT9 A;  3RYF E;  5AQG B;  4AQF C;  1XZY A;  1J1J A;  4TWD A;  2CLY B;  3OBV E;  5JQG E;  2C5I T;  2LSY A;  2X9Y A;  2I0M A; 
#chains in the Genus database with same CATH homology
 3WTI A;  4A98 A;  3EI0 A;  3WIP A;  5J5I A;  2Y7Y A;  3U8N A;  2XQ6 A;  3C79 A;  3GUA A;  3JAF A;  4TWF A;  5L4E A;  5FJV A;  2XYT A;  3JAE A;  4Z90 A;  2M6B A;  4QAC A;  2XQ8 A;  5HEG A;  4UXU A;  3ZKR A;  4ZZC A;  4B5D A;  3C84 A;  4UM3 P;  3P4W A;  3TLT A;  4COF A;  3TLS A;  2LM2 A;  2VL0 A;  5AFM B;  5LXB A;  3UQ7 A;  3EHZ A;  4QAA A;  3SQ6 A;  3WTJ A;  2XQ7 A;  2X00 A;  5HEU A;  3P50 A;  1UV6 A;  3UU3 A;  3WTK A;  2XNT A;  4ZJS A;  4BFQ A;  2BYR A;  5J5G A;  1UW6 A;  3JAD A;  4HFH A;  2BG9 C;  1OED C;  4FRR A;  2ZJU A;  3WTH A;  2M6I A;  4AFT A;  2LLY A;  4HFD A;  4UM3 S;  4UM1 A;  5HEH A;  1UX2 A;  2QC1 B;  4IL9 A;  2WNC A;  4A97 A;  5KE4 A;  4TNW A;  3WTM A;  2ZJV A;  3IGQ A;  4ILA A;  3EAM A;  4ZK1 A;  3LSV A;  2PGZ A;  4XK9 A;  4ZZB A;  2BR7 A;  3TLU A;  5AFK A;  2XNV A;  4HFC A;  2XQA A;  4ZJT A;  4LML A;  5IUX A;  4ZK4 A;  2XZ5 A;  4ZR6 A;  5AFN A;  2X00 D;  3RHW A;  3RI5 A;  4ILB A;  4UM3 A;  3U8L A;  5AFM A;  2Y57 A;  3TLW A;  2YN6 A;  3WTO A;  5AIN A;  4LMK A;  2WNJ A;  4QAB A;  4Z91 A;  2YOE A;  1I9B A;  3U8M A;  2YME A;  4DBM A;  2XQ3 A;  4ZRU A;  4X5T A;  2XNU A;  2XQ9 A;  4NPP A;  4EZ1 A;  2W8F A;  3ZDG A;  4BQT A;  5KZU A;  2BYS A;  2Y54 A;  3PMZ A;  3WTN A;  1OED B;  2YMD A;  4UY2 A;  4HQP A;  2LKH A;  5BP0 A;  4QH5 A;  5L4H A;  5HEJ A;  2XZ6 A;  3SH1 A;  3ZDH A;  5L47 A;  5BW2 A;  5TVC A;  2LKG A;  4TWH A;  4ALX A;  2WZY A;  5HCM A;  3RQW A;  3T4M A;  5LG3 A;  3RIF A;  2BJ0 A;  3U8J A;  2Y58 A;  5SYO A;  2UZ6 A;  2PH9 A;  3UU5 A;  5AFJ A;  4LMJ A;  2C9T A;  5J5H A;  3TLV A;  2XQ4 A;  4IRE A;  2WNL A;  2W8G A;  2BG9 E;  1OED E;  2Y56 A;  2YKS A;  4WV9 A;  5HEO A;  4AFG A;  2BYP A;  3RQU A;  2BG9 B;  4HFI A;  4IL4 A;  4F8H A;  2BR8 A;  4TNV A;  2BYN A;  4NZB A;  4PIR A;  4HFB A;  2KSR A;  5CFB A;  3UU8 A;  2BG9 A;  3SIO A;  1OED A;  3U8K A;  3UU4 A;  3WTL A;  4AFH A;  4TWD A;  5HCJ A;  3SQ9 A;  5J5F A;  3UU6 A;  2WN9 A;  4XHE A;  5CO5 A;  4QH1 A;  2XQ5 A;  3UUB A;  5AFH A;  2XYS A;  3UQ4 A;  5BRX A;  3RIA A;  2MAW A;  4HFE A;  3PEO A;  4D01 A;  5AFL A;  5JME A;  2BYQ A;  5J0Z A;  4QH4 A;  4ILC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...