4HFEA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant complexed to ethanol
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfeA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfeA01
2WNCA 3UU3A 5CFBA 2YN6A 2BYPA 5AFKA 5HEOA 5HEGA 3RQUA 2XQ9A 2YOEA 4LMJA 5L4EA 4ZK4A 3ZDHA 4B5DA 5BRXA 4TWFA 3PMZA 2X00D 3GUAA 5J0ZA 2VL0A 3UQ7A 2BYQA 2XYSA 4HFBA 5HEJA 5FJVA 5AFHA 1I9BA 5KZUA 4HFCA 4ZZBA 4Z90A 3TLUA 2XNVA 4HQPA 4A97A 4ILCA 3C79A 3WTHA 3WTNA 4XK9A 4UM3A 2XYTA 3PEOA 2Y58A 3EI0A 4TWDA 4TWHA 5HCJA 2XQ5A 2XQ8A 5L47A 4ILAA 4QH1A 2Y54A 4TNVA 4HFDA 5BW2A 2LM2A 4NZBA 3P50A 4AFGA 5BP0A 1UW6A 2BYRA 3UU8A 2BJ0A 2YMDA 5AFLA 4LMLA 2XNUA 3IGQA 4QABA 2PH9A 2C9TA 2UZ6A 4HFEA 3RIFA 1OEDE 5KE4A 4ILBA 3C84A 2XZ5A 4BFQA 5TVCA 3U8NA 5HCMA 4HFHA 4NPPA 1UV6A 2ZJUA 4Z91A 3UQ4A 4LMKA 2LKGA 5J5GA 1UX2A 2BR8A 2W8GA 5HEUA 2YKSA 3EHZA 4ZZCA 2W8FA 4XHEA 3WTOA 5HEHA 3T4MA 4AFHA 4QH4A 2XZ6A 5J5IA 5SYOA 2XQ6A 5LXBA 3SQ6A 3UU5A 3P4WA 4IREA 4UM3S 2XNTA 5JMEA 3ZDGA 2XQAA 2X00A 3U8LA 4TNWA 3TLVA 5AFJA 4QH5A 4FRRA 4WV9A 3U8JA 4X5TA 2XQ3A 5LG3A 5IUXA 3RHWA 2WN9A 4UM1A 2ZJVA 4COFA 3UUBA 2Y56A 3SQ9A 2BG9C 3WTJA 2WNJA 3U8KA 3RIAA 5CO5A 3U8MA 4ALXA 3TLSA 4UM3P 2BYSA 3WIPA 1OEDA 4QAAA 4AFTA 2M6BA 3UU6A 3WTLA 4ZK1A 4BQTA 2XQ7A 3ZKRA 4ZRUA 3JAEA 4IL9A 4IL4A 4HFIA 3WTMA 3JAFA 4ZJSA 4EZ1A 1OEDC 4UXUA 3WTIA 5AFMA 5J5HA 3UU4A 2BG9B 2BG9A 5L4HA 3RQWA 3TLTA 4D01A 4ZJTA 2LLYA 2MAWA 2BR7A 4UY2A 4QACA 2PGZA 3WTKA 2XQ4A 4ZR6A 2WZYA 3JADA 2QC1B 4F8HA 2Y57A 1OEDB 2YMEA 3LSVA 5J5FA 5AFNA 2BYNA 3SIOA 4DBMA 2BG9E 3EAMA 3SH1A 2M6IA 2WNLA 5AINA 4PIRA 4A98A 2LKHA 2Y7YA 2KSRA 3RI5A 3TLWA 5AFMB
chains in the Genus database with same CATH superfamily
2WNCA 2K5BB 1FEWA 5HEOA 3K3NA 1HNWT 2MPKA 2VL0A 4QXCB 4ZEYA 3ONXA 3KVBA 4TV9E 3KBUA 2V7JA 3EUHA 2XQ5A 4QWNB 3ONJA 5BW2A 4U2ZA 2CE7A 3ZMVB 4ANJA 4YTNA 4AISA 3QB5A 4ILUA 4DV3T 3ZYKA 3QK6A 3F57A 5AFUL 3U8NA 1X9BA 5A1LA 4G63A 2BKPA 5F5WA 3EHZA 1IAPA 5LHHB 4HE8A 2CWOA 2CEAA 2QYWA 2YDSA 1LVKA 4ZI3C 4WZXA 3CWZB 3F2EA 1J5WA 2XAHB 4JEHB 2PTFA 3MXZA 5F8PA 4DO0A 2NW9A 3CQGB 3H3MA 3NBXX 1OEDA 2UXXB 4AFTA 2Y6XA 3HKDE 2IDOB 2X0LB 5HXEA 5AQMB 3C4WA 3N2OA 1MMAA 2D9DA 2W2UA 4U74A 4AKLA 4ZHQE 3B5MA 2KT9A 2LHRA 2XQYA 3AECA 2LLYA 3HA4A 4QACA 3WTKA 4ZR6A 1FJGT 4YT0A 2XAQB 2Y57A 4CI1B 3UUMA 3N9PA 1HNXT 2IAKA 4AQGA 3QB5K 1BR1A 2LE8A 4JUYA 3UU3A 3MZKB 3AAAB 3KV9A 4KBMB 4MALA 3ZN1B 3I1AA 5L3CB 5LP6E 5AFHA 2J47A 3VKGA 2IIUA 3UT5E 4DR3T 3D0TA 3N9OA 3ETUA 2C5KT 4JBWF 2LEHA 4AIUA 5JDFA 1WLXA 2JJ9A 1YQ4A 4DR4T 3AE5A 1J5ET 4B6XA 4DBQA 4ZZCA 2W8FA 4L0RA 2JMHA 2WDVA 3ZDGA 1YKHB 4ZXLA 4BA9A 1N36T 5F3JA 5AQVB 1SHZC 4DR7T 3U8MA 2Q9QA 4GIWA 3ZMUB 4KX6A 3AXJB 2NTXA 4ZJSA 1IBKT 2BBHA 2Z6EA 3T8OA 5J5HA 4X65T 3VRAA 2BR7A 4O4IE 3IHRA 4M1PA 4HWHA 4JI5T 3LBXA 1VCSA 5AQNB 5EZYE 4WBOA 2YMEA 2BYNA 3SIOA 2V7MA 2BG9E 2UU9T 2BS3A 3BQIA 4BJMA 3C51A 5AFKA 4H9QC 2YOEA 4ZK4A 1H7CA 2CXFA 4ZI2C 3RRWA 5FJVA 3E0ZA 4EGWA 5FL1A 2E9XD 4TZ4C 3OBVE 4I55E 2XUEA 1IJ5A 4O8SA 3ZT5A 2XJ7A 3P50A 5JDNA 2C0SA 1UW6A 3OTOT 1L0VA 3NRYA 2UXNB 3AB3B 3RIUC 3O9XA 3T4MA 4DMWA 3PJAJ 4IGUA 1NENA 2FJBA 4QKNA 3VKHA 1S94A 2L8KA 5J2TE 3EDVA 2XSBA 1MIWA 3VR9A 2XQ3A 3IA3A 3N5LA 2WQYA 2UXDT 2ZM0A 4COFA 4KUMB 2UUBT 3UU6A 4HKAA 5TAOA 3JAEA 3P4SA 2DL1A 4UXUA 3ZYLA 3X1DA 2X9HA 4P0AA 3RQWA 5FXZA 4UY2A 4JYAT 2IMLA 3I0OA 3RKGA 3TKLB 1SA0E 4JI8T 4DV4T 4LF5T 3GN5A 4CN1A 4A56A 1FMWA 3I0QA 2CXDA 2KSRA 4QHOA 2X51A 3U3IA 2BYPA 3HI2A 1HX1B 5FVKA 4H9RC 4NXMT 2IC9A 2XAJB 4AKGA 5KZUA 3RLFF 4DR2T 5LOVE 3PEOA 1D1AA 5AQJB 2BVMA 1UGOA 3VU7H 5AQOB 4IHJE 4NZBA 4AFGA 5H6QB 2W61A 5JRCB 2XNUA 4PFOA 5KDMC 3UUXB 3FBZA 2W00A 3FZFB 3PUSA 5JDLA 2N9DA 2I6HA 3LK3B 4L9IA 2A9UA 1M7KA 4AKIA 2VKJA 4ISTA 5FMNA 1KNPA 1UCUA 2YU1A 1UURA 1XMOT 3ESLA 5LGTB 3RHWA 2FJEA 4UVCB 2RPAA 3AEGA 5EK4A 3AE4A 4CXYA 4KHPT 2BYSA 4H9SE 4OYJA 3LBXB 4JLEA 3AVSA 1W9RA 1D1BA 5FNVE 3CX7B 1VOMA 2ODUA 4JEUB 2BG9A 2CWYA 3U78A 4CQIA 3UUNA 3L3PA 5LGUB 4DV5T 4H9NC 2AE9A 2CHOA 1CUNA 2WDQA 5FY0A 2WY2A 3NZQA 4LMJA 3QNUA 2YDQA 3GUAA 2V6YA 4HFBA 3OVUA 1MIVA 2X0HA 5DJQC 4X20E 2IHR1 2BYRA 4H63H 5LMUT 5AFLA 2YMDA 2KNDA 3HR0A 2YEVC 4ILBA 2DWKA 4HFHA 4NPPA 1YKEB 5CJ5A 4LMKA 2LKGA 4Z8XA 4I0UA 2VKDA 2FUPA 4DV6T 5HEHA 4QH4A 2H89A 3P4WA 2XNTA 1HTJF 2ZM8A 3IF8B 3BQLA 2JRKA 2JIWA 4X1IE 3RIUA 1XMQT 5M4YA 2H7OA 2DCFA 3L39A 4EYUA 2DWGA 3SQ9A 4UEMA 1HG5A 1ZHCA 1IJ6A 2K9AA 3PE0A 1HF8A 2XAGB 2XZEA 2L9QA 3CVRA 3GN5B 2BVLA 5LG4A 1J1JA 1ZOYA 1KNZA 3AE9A 5AQTB 4IE6A 2IC6A 3ZC0A 3K8PC 4X66T 1GQEA 3CX8B 2WNLA 5AINA 4B3TT 4FJOA 2OLTA 3IEEA 3ZC1A 5LGNB 5LB7B 1N33T 2N2NA 5JDGA 1HX8A 5JDMA 2ZM6T 3AXJA 5LBQB 3TLUA 1G73A 4A97A 1HNZT 3WTHA 5AQHB 3EVYA 2RP4A 2EHOC 1V9DA 4HFDA 3P8CD 4OHFA 3UU8A 3AE6A 1W09A 2NP9A 4LFCT 3PDYA 3ZCJA 5BMVE 5J5GA 2B1EA 5C2TA 4TX5A 5AQKB 1BR4A 2QVAA 4KMCA 4UXNB 5L3BB 4IDQA 4QX8B 2WSSV 3W15B 3PUGA 4PFPA 3AA7B 1SE7A 4GK5E 4UF0B 2ZJVA 2XPKA 4CN4A 4AQYT 1VCTA 2WDRA 3TLSA 4UM3P 2WM9A 3Q5XA 3K1SA 3UFGA 2XAFB 3VRBA 2XHEB 5J1GA 4PJMA 3LJCA 4AKRB 1OEDC 3VR8A 3L09A 3RGLA 3AEFA 3C64A 3SOLA 3PJAA 2MAWA 1FIOA 3ZJ2A 4G2AA 4F6RC 4HWIB 2AXDS 4YY3T 3FHNA 2SPCA 3AE2A 4PIRA 2CBIA 2CRBA 3KBTA 2X9XA 2JQ9A 1ZP0A 4JI6T 4YHJA 4N78D 2BYQA 2CLYC 2KMFA 2J62A 3NWIA 2YK0A 3ANWA 3ABVA 3WTNA 3PUVF 2WCAA 3C50A 4TWHA 4NXNT 3OYZA 4DR6T 1Z0PA 1MNEA 5IYZE 2YINA 5FXVA 2UZ6A 4GYSA 5HCMA 2VQET 2K24A 4L5GA 4XHEA 5FXWA 4I43B 2JPFA 2MYSA 2H88A 5DQWA 3ZPOA 2XQAA 2VL8A 2A72A 5JREA 2B76A 4FRRA 5BR8T 2X0YA 3U8JA 2BS2A 4AXPA 3KV4A 4WW0A 1WYCA 2G0UA 2H7VC 2D0TA 4ERRA 3O1IA 1HR0T 4JI1T 1I6ZA 5HXHA 2JQHA 4KI0F 3J7Yq 3ETVA 5FY7A 4X1KE 3TLTA 5ABFB 3E08A 5KMGP 2PGZA 2WU2A 5HXSA 2WZYA 2NOXA 4F8HA 2W0GA 1D0YA 5J5FA 3RPUA 1Y01A 2K3WA 1D0ZA 4A98A 4IDNA 2Y7YA 3JC6C 3KV6A 4X64T 2FBWA 4TWFA 2X00D 4IE4A 5KXJA 2E8IA 1B7TA 2V5CA 4UV8B 2XQ8A 4QH1A 2L3LA 2BDEA 2N1GA 2ACXA 3SWHA 4IE0A 4NUVA 3M65A 3PUXF 4HFEA 4EOZB 5EK2A 3NKZA 4Q25A 2W8GA 2CBJA 4U2YA 3O4XE 4OK0A 4AFHA 5SYOA 3WAJA 3RRCA 1T98A 4UM3S 4J2CA 4I50E 4UM1A 3MK7C 4ZI3D 4CI2B 5CO5A 1MMNA 2FJDA 2CXLA 4QXBB 3WTLA 4IL9A 4OX9T 4AKHA 4U7IA 3ZMSB 2WZHA 3FB2A 3FZHB 4DV1T 2D2SA 4PJNA 5L4HA 3AAEB 1WCRA 3AE8A 2ZM2A 2YDRA 4C90A 4DNDA 2LRKA 2D5UA 2ES0A 4DUZT 4EZ4A 4EEBA 2CPTA 3CMLA 1BR0A 5ABFA 4WNKA 2E2AA 4YTMA 5AQQB 3PMZA 5BRXA 5J0ZA 4ZI7E 3CQCB 4HFCA 5LYJE 2XNVA 2V8SV 4GKKT 5JTGA 4XK9A 4AQFA 2QRXA 3AEBA 3N9LA 4ILAA 5AQFB 4LMLA 5L3GB 5FP3A 5JDQA 2XZ5A 5H6RB 4PK5A 2J1DG 4KP3C 3GA8A 2YKSA 1WRDA 3OJAA 5FKYA 5JMEA 2PG8A 4B3MT 4DR1T 3U8LA 5LMNT 2KZ7B 3ZLIA 2EHOA 3LK2B 1FMVA 2DI4A 4ZS2A 4DMVA 2V5DA 5LG3A 2DNXA 4XZCA 3SFEA 4E7ZA 4EYYR 1XNQT 1O3XA 4OFZA 2M6BA 2WWUA 3AE3A 4JI3T 2WMOA 4TUYE 4GK0E 4TV8E 1HFAA 4JV5T 1LKXA 4BAYB 3R84B 4LF6T 2Q9QB 2VASA 3JADA 4DR5T 2WMNA 3H37A 2BZBA 3EAMA 5ETWA 2LJLA 5LCYA 4YJ3E 3A8YC 4EZ1A 3RYFE 2OV9A 3QOFA 5HEJA 3MA9A 4EEDA 4ZZBA 4Z90A 3AAIA 4GYRA 4UM3A 2CMRA 3FZLB 5JR9B 4JI0T 3SS1A 4TNVA 2LT3A 2ZLYA 3LG7A 3EABA 3RYIE 1HG2A 1OEDE 5KE4A 3V5UA 5TVCA 3T1YT 3HL6A 3UQ4A 2BR8A 5FVLA 5FL0A 4CZZB 2XQ6A 5LXBA 1KF6A 2V7KA 2X00A 4QH5A 1UK5A 3CKDA 2V1DB 4IIJE 5GONE 3LK42 5CGMA 2VVNA 4E7SA 3RIAA 5AQRB 2UXCT 3ZT6A 4YJ2E 4BQTA 2WAUA 3AEEA 3LFMA 3WTMA 5AQUB 2A2FX 3FZKB 5AFMA 2LSGA 1E7PA 4HWCA 5C3JA 1HCIA 3UULA 4HN9A 4ZS3A 2W67A 1XDOA 2X67A 4PK6A 5AFNA 3EDUA 4UVAB 4K0KT 1IBMT 3AA6B 4HEAA 2ACZA 5AFMB 1KK7A 5IWAT 1W0BA 5HYAA 3H3AA 2JQKA 5L4EA 4B5DA 2XM2A 4YSZA 1VRBA 3B57A 1T8BA 4DBRA 3HKEE 2IW5B 5JQGE 5LJMA 2VKOA 3PU3A 2KINB 4EAHA 3CQXC 3RKOA 5BP0A 4OYKA 3ZN0B 4YLHA 1D1CA 5LNKA 5JRCA 3WI3A 2KWIB 2C9TA 4P0BA 2VVSA 1HS7A 2WBLA 2EHOB 2QA7A 3NVOA 5HEUA 5J5IA 4EZHA 4IREA 2I59A 2A3DA 5FYMA 3MKDA 4MBQA 3AE7A 2UUCT 4DIDB 2LM9A 4HWFA 5LJNA 4ASKA 2XSAA 2BG9C 3WTJA 3NZPA 3ZT7A 2BKOA 4P1NA 5AQSB 3AE1A 2XM1A 3RYHE 2X68A 4CXWA 4HFIA 1KFYA 3PUQA 3UTKA 4IT4A 4ZJTA 4UIGA 1SUMB 2V26A 3CX6B 3F31A 1U5PA 4QX7B 3N2KE 4GKJT 4DBMA 4IE5A 2HPLA 4O2BE 4YXDA 5LHGB 4H63V 3MACA 4U31A 3Q5WA 2W4XA 2HHHT 1UX5A 2E9XC 3KINB 4DVDA 5DABA 2XQ9A 2PJQA 5E0OA 1MIYA 5C8YE 3R6NA 5J2UE 1I9BA 4HFVA 5AQGB 3C79A 2LOPA 4IDOA 3SRZA 2CLYB 1JNZA 4B3RT 3Q2MA 1WFDA 3OPCA 3IGQA 3RF1A 3NRXA 3CPZA 3C84A 1LVFA 3KVAA 3PUAA 4PK4A 5HXRA 5LA6E 1M62A 3Q5DA 1XWMA 2E9XA 2KWHA 3DP7A 3RYCE 3FXEB 4TNWA 5IHYA 4EIWA 1N34T 4WV9A 1UX4A 2BBJA 2F4VT 3I9WA 4X62T 2Y48B 4YSYA 2Y56A 3UUBA 2WNJA 3U8KA 2X9YA 3A7MA 3P4RA 4MLKA 4IDZA 1E1HB 3ZKRA 4LF4T 2C5IT 1LRZA 1YD8G 4WBNE 2C5JA 3MJXA 1BR2A 3UU4A 3O1JA 4YFSA 3ZCIA 4IDPA 3RC3A 3CIRA 1W0AA 3RX6A 5FY1A 5CFBA 1MMGA 3BK9A 3CK6A 5AQPB 5HEGA 1T7SA 4H9OC 2LSIA 4LFAT 5ABEA 3DJBA 2PBIA 3ZYMA 5LXTE 4WYVA 5FXXA 2BKNA 3EI0A 3PUWF 4ZI2D 3K3QC 2IUBA 3Q9DA 2LHNA 4PJJA 3N2GE 2PH9A 5HXCA 4LF8T 1KNRA 4U33A 5KX5E 4DV2T 2WZIA 2RA1A 4X1YE 2M67A 4BJNA 3SQ6A 5HAXA 4PAGA 4YHHT 4TN7B 2VB6A 1IZNB 1T72A 1XDPA 4GOUA 4XBFB 4EB6E 5HWYA 4YSXA 2E5VA 5IUXA 1UUSA 2UUAT 2WN9A 5HWXA 1OXZA 3WIPA 1YW0A 1ZKEA 4ZRUA 3JAFA 1XZYA 2VWAA 4CI3B 1NAFA 5ADXL 1CHUA 4NIQA 2NW7A 2DLRA 4KHZF 3O1HA 4U7YA 4D01A 3I9YA 5AQLB 2V6XA 4LF9T 2UXBT 2CM0A 4UF0A 2NW8A 3JCFA 4DV0T 1QUUA 2WS3A 3SH1A 4QXHB 3DTOA 2WU5A 4YTPA 3ZDHA 3RQUA 4O4HE 3VHLA 1KEYA 2JMKA 3GWHA 3ONLC 4DV7T 4HQPA 2XTLA 1WR6A 3KFWX 3AEAA 5HCJA 4UR9A 4I4TE 5JH7E 2CHNA 2XY8B 4UV9B 2BS4A 2BJ0A 3FZMB 3AA0B 4CN6A 1MNDA 3V5SA 1UX2A 4LFBT 3P4PA 2H3RA 3PTRB 4ADZA 2X9WA 1AJ3A 1E2AA 3OKQA 3TLVA 5AFJA 2WB5A 1JNRA 2W63A 4P09A 2OA5A 3ZEFB 1ZV4X 3HKCE 2V6YB 2WP9A 4JI7T 3E22E 3IBPA 3ZMTB 4MFRA 2XQ7A 4PW8A 1IBLT 4UELA 2LSYA 2E5LT 1ZEEA 3B13A 3N9QA 3QC9A 3L8RA 4O4LE 3K3OA 2LRLA 2MOZA 2XQ4A 4K0UA 2V7LA 3PURA 1N32T 2PFVA 4HWDA 5DQVA 2CCQA 4PNIA 2Q9QC 4LF7T 3RI5A 3TLWA 2NR4A 3BQKA 1NWMX 2YN6A 5JR9C 3AVRA 3UQ7A 4DUYT 2MBGA 4ILCA 2W62A 2XYTA 2Y58A 4NUUA 1QLBA 2Y54A 4PJLA 4IE7A 5ABHA 2VKHA 3S4UA 4QABA 2XASB 4BFQA 3A5XA 5AQIB 1US7B 2ZJUA 1R8IA 4O4JE 3C4XA 3WTOA 4FI5A 2KLQA 3ZSSA 4HGAA 3N9NA 1G8XA 2V7IA 1EZ3A 2X66A 4U3CA 2HH7A 5L3EB 4X5TA 2VQFT 2YU2A 3KDSE 2HPJA 5CA0E 5LBMA 1Y64B 2ODVA 2DHRA 4O2AE 3J9X1 4QAAA 3GMIA 3G06A 3QUJA 2LSKA 3PUZF 4B3ST 2P9BA 1U4QA 3UFEA 1Z8UA 1I94T 5ABGA 2VK9A 2Q9QD 4U72A 3RC8A 4MHCA 5L3FB 3M3ZB 2MTQA 2QC1B 3N9MA 2CA5A 1OEDB 1S35A 2GK9A 2QGSA 4ISSA 2R6GF 1NEKA 3WAKA 5JVDE 3C4ZA 1MMDA 2Y8DA 2VURA 1XNRT 2K48A 2ZMAA 3ZJ1A 4C91A 5JDHA 2E9XB 2XYSA 4ZOLE 1DU2A 3AA1B 5CA1E 3AEDA 1QSDA 4TWDA 4A5XA 5LHIB 5L47A 2LM2A 1OWAA 3FXDB 2J4GA 2EHOD 2HN2A 4AI6A 3RIFA 4H9PC 1UV6A 3P4QA 3RH3A 4Z91A 4JI4T 1X79A 2D0UA 3SFDA 2LSJA 2NWBA 3ZSTA 1YQ3A 2XZ6A 3LDQB 3OYXA 3UU5A 4AQFC 4CXXA 2HN1A 2WWVA 3Q5EA 2NTYA 4UVBB 3T1HT 3FBLA 1D0XA 2KXPB 4JI2T 3ANWB 5L2LA 3PUYF 5JR9A 2LOSA 4ALXA 2FJAA 3P7IA 4EXTA 4ZK1A 3PU8A 4IL4A 1WR0A 1YXRA 3WTIA 5EK3A 3KV5A 2JQQA 2BG9B 3ZMZB 4HTEA 2I0MA 4EV6A 3HKBE 3JC6D 3C98B 3PV0F 3LSVA 2M6IA 5CB4E 4V1Av 2LKHA 1WYBA 2W66A 4XAXB 5L3DB
chains in the Genus database with same CATH topology
2WNCA 3UU3A 5CFBA 2YN6A 2BYPA 5AFKA 5HEOA 5HEGA 3RQUA 2XQ9A 2YOEA 4LMJA 5L4EA 4ZK4A 3ZDHA 4B5DA 5BRXA 4TWFA 3PMZA 2X00D 3GUAA 5J0ZA 2VL0A 3UQ7A 2BYQA 2XYSA 4HFBA 5HEJA 5FJVA 5AFHA 1I9BA 5KZUA 4HFCA 4ZZBA 4Z90A 3TLUA 2XNVA 4HQPA 4A97A 4ILCA 3C79A 3WTHA 3WTNA 4XK9A 4UM3A 2XYTA 3PEOA 2Y58A 3EI0A 4TWDA 4TWHA 5HCJA 2XQ5A 2XQ8A 5L47A 4ILAA 4QH1A 2Y54A 4TNVA 4HFDA 5BW2A 2LM2A 4NZBA 3P50A 4AFGA 5BP0A 1UW6A 2BYRA 3UU8A 2BJ0A 2YMDA 5AFLA 4LMLA 2XNUA 3IGQA 4QABA 2PH9A 2C9TA 2UZ6A 4HFEA 3RIFA 1OEDE 5KE4A 4ILBA 3C84A 2XZ5A 4BFQA 5TVCA 3U8NA 5HCMA 4HFHA 4NPPA 1UV6A 2ZJUA 4Z91A 3UQ4A 4LMKA 2LKGA 5J5GA 1UX2A 2BR8A 2W8GA 5HEUA 2YKSA 3EHZA 4ZZCA 2W8FA 4XHEA 3WTOA 5HEHA 3T4MA 4AFHA 4QH4A 2XZ6A 5J5IA 5SYOA 2XQ6A 5LXBA 3SQ6A 3UU5A 3P4WA 4IREA 4UM3S 2XNTA 5JMEA 3ZDGA 2XQAA 2X00A 3U8LA 4TNWA 3TLVA 5AFJA 4QH5A 4FRRA 4WV9A 3U8JA 4X5TA 2XQ3A 5LG3A 5IUXA 3RHWA 2WN9A 4UM1A 2ZJVA 4COFA 3UUBA 2Y56A 3SQ9A 2BG9C 3WTJA 2WNJA 3U8KA 3RIAA 5CO5A 3U8MA 4ALXA 3TLSA 4UM3P 2BYSA 3WIPA 1OEDA 4QAAA 4AFTA 2M6BA 3UU6A 3WTLA 4ZK1A 4BQTA 2XQ7A 3ZKRA 4ZRUA 3JAEA 4IL9A 4IL4A 4HFIA 3WTMA 3JAFA 4ZJSA 4EZ1A 1OEDC 4UXUA 3WTIA 5AFMA 5J5HA 3UU4A 2BG9B 2BG9A 5L4HA 3RQWA 3TLTA 4D01A 4ZJTA 2LLYA 2MAWA 2BR7A 4UY2A 4QACA 2PGZA 3WTKA 2XQ4A 4ZR6A 2WZYA 3JADA 2QC1B 4F8HA 2Y57A 1OEDB 2YMEA 3LSVA 5J5FA 5AFNA 2BYNA 3SIOA 4DBMA 2BG9E 3EAMA 3SH1A 2M6IA 2WNLA 5AINA 4PIRA 4A98A 2LKHA 2Y7YA 2KSRA 3RI5A 3TLWA 5AFMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNC A;  3UU3 A;  5CFB A;  2YN6 A;  2BYP A;  5AFK A;  5HEO A;  5HEG A;  3RQU A;  2XQ9 A;  2YOE A;  4LMJ A;  5L4E A;  4ZK4 A;  3ZDH A;  4B5D A;  5BRX A;  4TWF A;  3PMZ A;  2X00 D;  3GUA A;  5J0Z A;  2VL0 A;  3UQ7 A;  2BYQ A;  2XYS A;  4HFB A;  5HEJ A;  5FJV A;  5AFH A;  1I9B A;  5KZU A;  4HFC A;  4ZZB A;  4Z90 A;  3TLU A;  2XNV A;  4HQP A;  4A97 A;  4ILC A;  3C79 A;  3WTH A;  3WTN A;  4XK9 A;  4UM3 A;  2XYT A;  3PEO A;  2Y58 A;  3EI0 A;  4TWD A;  4TWH A;  5HCJ A;  2XQ5 A;  2XQ8 A;  5L47 A;  4ILA A;  4QH1 A;  2Y54 A;  4TNV A;  4HFD A;  5BW2 A;  2LM2 A;  4NZB A;  3P50 A;  4AFG A;  5BP0 A;  1UW6 A;  2BYR A;  3UU8 A;  2BJ0 A;  2YMD A;  5AFL A;  4LML A;  2XNU A;  3IGQ A;  4QAB A;  2PH9 A;  2C9T A;  2UZ6 A;  4HFE A;  3RIF A;  1OED E;  5KE4 A;  4ILB A;  3C84 A;  2XZ5 A;  4BFQ A;  5TVC A;  3U8N A;  5HCM A;  4HFH A;  4NPP A;  1UV6 A;  2ZJU A;  4Z91 A;  3UQ4 A;  4LMK A;  2LKG A;  5J5G A;  1UX2 A;  2BR8 A;  2W8G A;  5HEU A;  2YKS A;  3EHZ A;  4ZZC A;  2W8F A;  4XHE A;  3WTO A;  5HEH A;  3T4M A;  4AFH A;  4QH4 A;  2XZ6 A;  5J5I A;  5SYO A;  2XQ6 A;  5LXB A;  3SQ6 A;  3UU5 A;  3P4W A;  4IRE A;  4UM3 S;  2XNT A;  5JME A;  3ZDG A;  2XQA A;  2X00 A;  3U8L A;  4TNW A;  3TLV A;  5AFJ A;  4QH5 A;  4FRR A;  4WV9 A;  3U8J A;  4X5T A;  2XQ3 A;  5LG3 A;  5IUX A;  3RHW A;  2WN9 A;  4UM1 A;  2ZJV A;  4COF A;  3UUB A;  2Y56 A;  3SQ9 A;  2BG9 C;  3WTJ A;  2WNJ A;  3U8K A;  3RIA A;  5CO5 A;  3U8M A;  4ALX A;  3TLS A;  4UM3 P;  2BYS A;  3WIP A;  1OED A;  4QAA A;  4AFT A;  2M6B A;  3UU6 A;  3WTL A;  4ZK1 A;  4BQT A;  2XQ7 A;  3ZKR A;  4ZRU A;  3JAE A;  4IL9 A;  4IL4 A;  4HFI A;  3WTM A;  3JAF A;  4ZJS A;  4EZ1 A;  1OED C;  4UXU A;  3WTI A;  5AFM A;  5J5H A;  3UU4 A;  2BG9 B;  2BG9 A;  5L4H A;  3RQW A;  3TLT A;  4D01 A;  4ZJT A;  2LLY A;  2MAW A;  2BR7 A;  4UY2 A;  4QAC A;  2PGZ A;  3WTK A;  2XQ4 A;  4ZR6 A;  2WZY A;  3JAD A;  2QC1 B;  4F8H A;  2Y57 A;  1OED B;  2YME A;  3LSV A;  5J5F A;  5AFN A;  2BYN A;  3SIO A;  4DBM A;  2BG9 E;  3EAM A;  3SH1 A;  2M6I A;  2WNL A;  5AIN A;  4PIR A;  4A98 A;  2LKH A;  2Y7Y A;  2KSR A;  3RI5 A;  3TLW A;  5AFM B; 
#chains in the Genus database with same CATH topology
 2WNC A;  2K5B B;  1FEW A;  5HEO A;  3K3N A;  1HNW T;  2MPK A;  2VL0 A;  4QXC B;  4ZEY A;  3ONX A;  3KVB A;  4TV9 E;  3KBU A;  2V7J A;  3EUH A;  2XQ5 A;  4QWN B;  3ONJ A;  5BW2 A;  4U2Z A;  2CE7 A;  3ZMV B;  4ANJ A;  4YTN A;  4AIS A;  3QB5 A;  4ILU A;  4DV3 T;  3ZYK A;  3QK6 A;  3F57 A;  5AFU L;  3U8N A;  1X9B A;  5A1L A;  4G63 A;  2BKP A;  5F5W A;  3EHZ A;  1IAP A;  5LHH B;  4HE8 A;  2CWO A;  2CEA A;  2QYW A;  2YDS A;  1LVK A;  4ZI3 C;  4WZX A;  3CWZ B;  3F2E A;  1J5W A;  2XAH B;  4JEH B;  2PTF A;  3MXZ A;  5F8P A;  4DO0 A;  2NW9 A;  3CQG B;  3H3M A;  3NBX X;  1OED A;  2UXX B;  4AFT A;  2Y6X A;  3HKD E;  2IDO B;  2X0L B;  5HXE A;  5AQM B;  3C4W A;  3N2O A;  1MMA A;  2D9D A;  2W2U A;  4U74 A;  4AKL A;  4ZHQ E;  3B5M A;  2KT9 A;  2LHR A;  2XQY A;  3AEC A;  2LLY A;  3HA4 A;  4QAC A;  3WTK A;  4ZR6 A;  1FJG T;  4YT0 A;  2XAQ B;  2Y57 A;  4CI1 B;  3UUM A;  3N9P A;  1HNX T;  2IAK A;  4AQG A;  3QB5 K;  1BR1 A;  2LE8 A;  4JUY A;  3UU3 A;  3MZK B;  3AAA B;  3KV9 A;  4KBM B;  4MAL A;  3ZN1 B;  3I1A A;  5L3C B;  5LP6 E;  5AFH A;  2J47 A;  3VKG A;  2IIU A;  3UT5 E;  4DR3 T;  3D0T A;  3N9O A;  3ETU A;  2C5K T;  4JBW F;  2LEH A;  4AIU A;  5JDF A;  1WLX A;  2JJ9 A;  1YQ4 A;  4DR4 T;  3AE5 A;  1J5E T;  4B6X A;  4DBQ A;  4ZZC A;  2W8F A;  4L0R A;  2JMH A;  2WDV A;  3ZDG A;  1YKH B;  4ZXL A;  4BA9 A;  1N36 T;  5F3J A;  5AQV B;  1SHZ C;  4DR7 T;  3U8M A;  2Q9Q A;  4GIW A;  3ZMU B;  4KX6 A;  3AXJ B;  2NTX A;  4ZJS A;  1IBK T;  2BBH A;  2Z6E A;  3T8O A;  5J5H A;  4X65 T;  3VRA A;  2BR7 A;  4O4I E;  3IHR A;  4M1P A;  4HWH A;  4JI5 T;  3LBX A;  1VCS A;  5AQN B;  5EZY E;  4WBO A;  2YME A;  2BYN A;  3SIO A;  2V7M A;  2BG9 E;  2UU9 T;  2BS3 A;  3BQI A;  4BJM A;  3C51 A;  5AFK A;  4H9Q C;  2YOE A;  4ZK4 A;  1H7C A;  2CXF A;  4ZI2 C;  3RRW A;  5FJV A;  3E0Z A;  4EGW A;  5FL1 A;  2E9X D;  4TZ4 C;  3OBV E;  4I55 E;  2XUE A;  1IJ5 A;  4O8S A;  3ZT5 A;  2XJ7 A;  3P50 A;  5JDN A;  2C0S A;  1UW6 A;  3OTO T;  1L0V A;  3NRY A;  2UXN B;  3AB3 B;  3RIU C;  3O9X A;  3T4M A;  4DMW A;  3PJA J;  4IGU A;  1NEN A;  2FJB A;  4QKN A;  3VKH A;  1S94 A;  2L8K A;  5J2T E;  3EDV A;  2XSB A;  1MIW A;  3VR9 A;  2XQ3 A;  3IA3 A;  3N5L A;  2WQY A;  2UXD T;  2ZM0 A;  4COF A;  4KUM B;  2UUB T;  3UU6 A;  4HKA A;  5TAO A;  3JAE A;  3P4S A;  2DL1 A;  4UXU A;  3ZYL A;  3X1D A;  2X9H A;  4P0A A;  3RQW A;  5FXZ A;  4UY2 A;  4JYA T;  2IML A;  3I0O A;  3RKG A;  3TKL B;  1SA0 E;  4JI8 T;  4DV4 T;  4LF5 T;  3GN5 A;  4CN1 A;  4A56 A;  1FMW A;  3I0Q A;  2CXD A;  2KSR A;  4QHO A;  2X51 A;  3U3I A;  2BYP A;  3HI2 A;  1HX1 B;  5FVK A;  4H9R C;  4NXM T;  2IC9 A;  2XAJ B;  4AKG A;  5KZU A;  3RLF F;  4DR2 T;  5LOV E;  3PEO A;  1D1A A;  5AQJ B;  2BVM A;  1UGO A;  3VU7 H;  5AQO B;  4IHJ E;  4NZB A;  4AFG A;  5H6Q B;  2W61 A;  5JRC B;  2XNU A;  4PFO A;  5KDM C;  3UUX B;  3FBZ A;  2W00 A;  3FZF B;  3PUS A;  5JDL A;  2N9D A;  2I6H A;  3LK3 B;  4L9I A;  2A9U A;  1M7K A;  4AKI A;  2VKJ A;  4IST A;  5FMN A;  1KNP A;  1UCU A;  2YU1 A;  1UUR A;  1XMO T;  3ESL A;  5LGT B;  3RHW A;  2FJE A;  4UVC B;  2RPA A;  3AEG A;  5EK4 A;  3AE4 A;  4CXY A;  4KHP T;  2BYS A;  4H9S E;  4OYJ A;  3LBX B;  4JLE A;  3AVS A;  1W9R A;  1D1B A;  5FNV E;  3CX7 B;  1VOM A;  2ODU A;  4JEU B;  2BG9 A;  2CWY A;  3U78 A;  4CQI A;  3UUN A;  3L3P A;  5LGU B;  4DV5 T;  4H9N C;  2AE9 A;  2CHO A;  1CUN A;  2WDQ A;  5FY0 A;  2WY2 A;  3NZQ A;  4LMJ A;  3QNU A;  2YDQ A;  3GUA A;  2V6Y A;  4HFB A;  3OVU A;  1MIV A;  2X0H A;  5DJQ C;  4X20 E;  2IHR 1;  2BYR A;  4H63 H;  5LMU T;  5AFL A;  2YMD A;  2KND A;  3HR0 A;  2YEV C;  4ILB A;  2DWK A;  4HFH A;  4NPP A;  1YKE B;  5CJ5 A;  4LMK A;  2LKG A;  4Z8X A;  4I0U A;  2VKD A;  2FUP A;  4DV6 T;  5HEH A;  4QH4 A;  2H89 A;  3P4W A;  2XNT A;  1HTJ F;  2ZM8 A;  3IF8 B;  3BQL A;  2JRK A;  2JIW A;  4X1I E;  3RIU A;  1XMQ T;  5M4Y A;  2H7O A;  2DCF A;  3L39 A;  4EYU A;  2DWG A;  3SQ9 A;  4UEM A;  1HG5 A;  1ZHC A;  1IJ6 A;  2K9A A;  3PE0 A;  1HF8 A;  2XAG B;  2XZE A;  2L9Q A;  3CVR A;  3GN5 B;  2BVL A;  5LG4 A;  1J1J A;  1ZOY A;  1KNZ A;  3AE9 A;  5AQT B;  4IE6 A;  2IC6 A;  3ZC0 A;  3K8P C;  4X66 T;  1GQE A;  3CX8 B;  2WNL A;  5AIN A;  4B3T T;  4FJO A;  2OLT A;  3IEE A;  3ZC1 A;  5LGN B;  5LB7 B;  1N33 T;  2N2N A;  5JDG A;  1HX8 A;  5JDM A;  2ZM6 T;  3AXJ A;  5LBQ B;  3TLU A;  1G73 A;  4A97 A;  1HNZ T;  3WTH A;  5AQH B;  3EVY A;  2RP4 A;  2EHO C;  1V9D A;  4HFD A;  3P8C D;  4OHF A;  3UU8 A;  3AE6 A;  1W09 A;  2NP9 A;  4LFC T;  3PDY A;  3ZCJ A;  5BMV E;  5J5G A;  2B1E A;  5C2T A;  4TX5 A;  5AQK B;  1BR4 A;  2QVA A;  4KMC A;  4UXN B;  5L3B B;  4IDQ A;  4QX8 B;  2WSS V;  3W15 B;  3PUG A;  4PFP A;  3AA7 B;  1SE7 A;  4GK5 E;  4UF0 B;  2ZJV A;  2XPK A;  4CN4 A;  4AQY T;  1VCT A;  2WDR A;  3TLS A;  4UM3 P;  2WM9 A;  3Q5X A;  3K1S A;  3UFG A;  2XAF B;  3VRB A;  2XHE B;  5J1G A;  4PJM A;  3LJC A;  4AKR B;  1OED C;  3VR8 A;  3L09 A;  3RGL A;  3AEF A;  3C64 A;  3SOL A;  3PJA A;  2MAW A;  1FIO A;  3ZJ2 A;  4G2A A;  4F6R C;  4HWI B;  2AXD S;  4YY3 T;  3FHN A;  2SPC A;  3AE2 A;  4PIR A;  2CBI A;  2CRB A;  3KBT A;  2X9X A;  2JQ9 A;  1ZP0 A;  4JI6 T;  4YHJ A;  4N78 D;  2BYQ A;  2CLY C;  2KMF A;  2J62 A;  3NWI A;  2YK0 A;  3ANW A;  3ABV A;  3WTN A;  3PUV F;  2WCA A;  3C50 A;  4TWH A;  4NXN T;  3OYZ A;  4DR6 T;  1Z0P A;  1MNE A;  5IYZ E;  2YIN A;  5FXV A;  2UZ6 A;  4GYS A;  5HCM A;  2VQE T;  2K24 A;  4L5G A;  4XHE A;  5FXW A;  4I43 B;  2JPF A;  2MYS A;  2H88 A;  5DQW A;  3ZPO A;  2XQA A;  2VL8 A;  2A72 A;  5JRE A;  2B76 A;  4FRR A;  5BR8 T;  2X0Y A;  3U8J A;  2BS2 A;  4AXP A;  3KV4 A;  4WW0 A;  1WYC A;  2G0U A;  2H7V C;  2D0T A;  4ERR A;  3O1I A;  1HR0 T;  4JI1 T;  1I6Z A;  5HXH A;  2JQH A;  4KI0 F;  3J7Y q;  3ETV A;  5FY7 A;  4X1K E;  3TLT A;  5ABF B;  3E08 A;  5KMG P;  2PGZ A;  2WU2 A;  5HXS A;  2WZY A;  2NOX A;  4F8H A;  2W0G A;  1D0Y A;  5J5F A;  3RPU A;  1Y01 A;  2K3W A;  1D0Z A;  4A98 A;  4IDN A;  2Y7Y A;  3JC6 C;  3KV6 A;  4X64 T;  2FBW A;  4TWF A;  2X00 D;  4IE4 A;  5KXJ A;  2E8I A;  1B7T A;  2V5C A;  4UV8 B;  2XQ8 A;  4QH1 A;  2L3L A;  2BDE A;  2N1G A;  2ACX A;  3SWH A;  4IE0 A;  4NUV A;  3M65 A;  3PUX F;  4HFE A;  4EOZ B;  5EK2 A;  3NKZ A;  4Q25 A;  2W8G A;  2CBJ A;  4U2Y A;  3O4X E;  4OK0 A;  4AFH A;  5SYO A;  3WAJ A;  3RRC A;  1T98 A;  4UM3 S;  4J2C A;  4I50 E;  4UM1 A;  3MK7 C;  4ZI3 D;  4CI2 B;  5CO5 A;  1MMN A;  2FJD A;  2CXL A;  4QXB B;  3WTL A;  4IL9 A;  4OX9 T;  4AKH A;  4U7I A;  3ZMS B;  2WZH A;  3FB2 A;  3FZH B;  4DV1 T;  2D2S A;  4PJN A;  5L4H A;  3AAE B;  1WCR A;  3AE8 A;  2ZM2 A;  2YDR A;  4C90 A;  4DND A;  2LRK A;  2D5U A;  2ES0 A;  4DUZ T;  4EZ4 A;  4EEB A;  2CPT A;  3CML A;  1BR0 A;  5ABF A;  4WNK A;  2E2A A;  4YTM A;  5AQQ B;  3PMZ A;  5BRX A;  5J0Z A;  4ZI7 E;  3CQC B;  4HFC A;  5LYJ E;  2XNV A;  2V8S V;  4GKK T;  5JTG A;  4XK9 A;  4AQF A;  2QRX A;  3AEB A;  3N9L A;  4ILA A;  5AQF B;  4LML A;  5L3G B;  5FP3 A;  5JDQ A;  2XZ5 A;  5H6R B;  4PK5 A;  2J1D G;  4KP3 C;  3GA8 A;  2YKS A;  1WRD A;  3OJA A;  5FKY A;  5JME A;  2PG8 A;  4B3M T;  4DR1 T;  3U8L A;  5LMN T;  2KZ7 B;  3ZLI A;  2EHO A;  3LK2 B;  1FMV A;  2DI4 A;  4ZS2 A;  4DMV A;  2V5D A;  5LG3 A;  2DNX A;  4XZC A;  3SFE A;  4E7Z A;  4EYY R;  1XNQ T;  1O3X A;  4OFZ A;  2M6B A;  2WWU A;  3AE3 A;  4JI3 T;  2WMO A;  4TUY E;  4GK0 E;  4TV8 E;  1HFA A;  4JV5 T;  1LKX A;  4BAY B;  3R84 B;  4LF6 T;  2Q9Q B;  2VAS A;  3JAD A;  4DR5 T;  2WMN A;  3H37 A;  2BZB A;  3EAM A;  5ETW A;  2LJL A;  5LCY A;  4YJ3 E;  3A8Y C;  4EZ1 A;  3RYF E;  2OV9 A;  3QOF A;  5HEJ A;  3MA9 A;  4EED A;  4ZZB A;  4Z90 A;  3AAI A;  4GYR A;  4UM3 A;  2CMR A;  3FZL B;  5JR9 B;  4JI0 T;  3SS1 A;  4TNV A;  2LT3 A;  2ZLY A;  3LG7 A;  3EAB A;  3RYI E;  1HG2 A;  1OED E;  5KE4 A;  3V5U A;  5TVC A;  3T1Y T;  3HL6 A;  3UQ4 A;  2BR8 A;  5FVL A;  5FL0 A;  4CZZ B;  2XQ6 A;  5LXB A;  1KF6 A;  2V7K A;  2X00 A;  4QH5 A;  1UK5 A;  3CKD A;  2V1D B;  4IIJ E;  5GON E;  3LK4 2;  5CGM A;  2VVN A;  4E7S A;  3RIA A;  5AQR B;  2UXC T;  3ZT6 A;  4YJ2 E;  4BQT A;  2WAU A;  3AEE A;  3LFM A;  3WTM A;  5AQU B;  2A2F X;  3FZK B;  5AFM A;  2LSG A;  1E7P A;  4HWC A;  5C3J A;  1HCI A;  3UUL A;  4HN9 A;  4ZS3 A;  2W67 A;  1XDO A;  2X67 A;  4PK6 A;  5AFN A;  3EDU A;  4UVA B;  4K0K T;  1IBM T;  3AA6 B;  4HEA A;  2ACZ A;  5AFM B;  1KK7 A;  5IWA T;  1W0B A;  5HYA A;  3H3A A;  2JQK A;  5L4E A;  4B5D A;  2XM2 A;  4YSZ A;  1VRB A;  3B57 A;  1T8B A;  4DBR A;  3HKE E;  2IW5 B;  5JQG E;  5LJM A;  2VKO A;  3PU3 A;  2KIN B;  4EAH A;  3CQX C;  3RKO A;  5BP0 A;  4OYK A;  3ZN0 B;  4YLH A;  1D1C A;  5LNK A;  5JRC A;  3WI3 A;  2KWI B;  2C9T A;  4P0B A;  2VVS A;  1HS7 A;  2WBL A;  2EHO B;  2QA7 A;  3NVO A;  5HEU A;  5J5I A;  4EZH A;  4IRE A;  2I59 A;  2A3D A;  5FYM A;  3MKD A;  4MBQ A;  3AE7 A;  2UUC T;  4DID B;  2LM9 A;  4HWF A;  5LJN A;  4ASK A;  2XSA A;  2BG9 C;  3WTJ A;  3NZP A;  3ZT7 A;  2BKO A;  4P1N A;  5AQS B;  3AE1 A;  2XM1 A;  3RYH E;  2X68 A;  4CXW A;  4HFI A;  1KFY A;  3PUQ A;  3UTK A;  4IT4 A;  4ZJT A;  4UIG A;  1SUM B;  2V26 A;  3CX6 B;  3F31 A;  1U5P A;  4QX7 B;  3N2K E;  4GKJ T;  4DBM A;  4IE5 A;  2HPL A;  4O2B E;  4YXD A;  5LHG B;  4H63 V;  3MAC A;  4U31 A;  3Q5W A;  2W4X A;  2HHH T;  1UX5 A;  2E9X C;  3KIN B;  4DVD A;  5DAB A;  2XQ9 A;  2PJQ A;  5E0O A;  1MIY A;  5C8Y E;  3R6N A;  5J2U E;  1I9B A;  4HFV A;  5AQG B;  3C79 A;  2LOP A;  4IDO A;  3SRZ A;  2CLY B;  1JNZ A;  4B3R T;  3Q2M A;  1WFD A;  3OPC A;  3IGQ A;  3RF1 A;  3NRX A;  3CPZ A;  3C84 A;  1LVF A;  3KVA A;  3PUA A;  4PK4 A;  5HXR A;  5LA6 E;  1M62 A;  3Q5D A;  1XWM A;  2E9X A;  2KWH A;  3DP7 A;  3RYC E;  3FXE B;  4TNW A;  5IHY A;  4EIW A;  1N34 T;  4WV9 A;  1UX4 A;  2BBJ A;  2F4V T;  3I9W A;  4X62 T;  2Y48 B;  4YSY A;  2Y56 A;  3UUB A;  2WNJ A;  3U8K A;  2X9Y A;  3A7M A;  3P4R A;  4MLK A;  4IDZ A;  1E1H B;  3ZKR A;  4LF4 T;  2C5I T;  1LRZ A;  1YD8 G;  4WBN E;  2C5J A;  3MJX A;  1BR2 A;  3UU4 A;  3O1J A;  4YFS A;  3ZCI A;  4IDP A;  3RC3 A;  3CIR A;  1W0A A;  3RX6 A;  5FY1 A;  5CFB A;  1MMG A;  3BK9 A;  3CK6 A;  5AQP B;  5HEG A;  1T7S A;  4H9O C;  2LSI A;  4LFA T;  5ABE A;  3DJB A;  2PBI A;  3ZYM A;  5LXT E;  4WYV A;  5FXX A;  2BKN A;  3EI0 A;  3PUW F;  4ZI2 D;  3K3Q C;  2IUB A;  3Q9D A;  2LHN A;  4PJJ A;  3N2G E;  2PH9 A;  5HXC A;  4LF8 T;  1KNR A;  4U33 A;  5KX5 E;  4DV2 T;  2WZI A;  2RA1 A;  4X1Y E;  2M67 A;  4BJN A;  3SQ6 A;  5HAX A;  4PAG A;  4YHH T;  4TN7 B;  2VB6 A;  1IZN B;  1T72 A;  1XDP A;  4GOU A;  4XBF B;  4EB6 E;  5HWY A;  4YSX A;  2E5V A;  5IUX A;  1UUS A;  2UUA T;  2WN9 A;  5HWX A;  1OXZ A;  3WIP A;  1YW0 A;  1ZKE A;  4ZRU A;  3JAF A;  1XZY A;  2VWA A;  4CI3 B;  1NAF A;  5ADX L;  1CHU A;  4NIQ A;  2NW7 A;  2DLR A;  4KHZ F;  3O1H A;  4U7Y A;  4D01 A;  3I9Y A;  5AQL B;  2V6X A;  4LF9 T;  2UXB T;  2CM0 A;  4UF0 A;  2NW8 A;  3JCF A;  4DV0 T;  1QUU A;  2WS3 A;  3SH1 A;  4QXH B;  3DTO A;  2WU5 A;  4YTP A;  3ZDH A;  3RQU A;  4O4H E;  3VHL A;  1KEY A;  2JMK A;  3GWH A;  3ONL C;  4DV7 T;  4HQP A;  2XTL A;  1WR6 A;  3KFW X;  3AEA A;  5HCJ A;  4UR9 A;  4I4T E;  5JH7 E;  2CHN A;  2XY8 B;  4UV9 B;  2BS4 A;  2BJ0 A;  3FZM B;  3AA0 B;  4CN6 A;  1MND A;  3V5S A;  1UX2 A;  4LFB T;  3P4P A;  2H3R A;  3PTR B;  4ADZ A;  2X9W A;  1AJ3 A;  1E2A A;  3OKQ A;  3TLV A;  5AFJ A;  2WB5 A;  1JNR A;  2W63 A;  4P09 A;  2OA5 A;  3ZEF B;  1ZV4 X;  3HKC E;  2V6Y B;  2WP9 A;  4JI7 T;  3E22 E;  3IBP A;  3ZMT B;  4MFR A;  2XQ7 A;  4PW8 A;  1IBL T;  4UEL A;  2LSY A;  2E5L T;  1ZEE A;  3B13 A;  3N9Q A;  3QC9 A;  3L8R A;  4O4L E;  3K3O A;  2LRL A;  2MOZ A;  2XQ4 A;  4K0U A;  2V7L A;  3PUR A;  1N32 T;  2PFV A;  4HWD A;  5DQV A;  2CCQ A;  4PNI A;  2Q9Q C;  4LF7 T;  3RI5 A;  3TLW A;  2NR4 A;  3BQK A;  1NWM X;  2YN6 A;  5JR9 C;  3AVR A;  3UQ7 A;  4DUY T;  2MBG A;  4ILC A;  2W62 A;  2XYT A;  2Y58 A;  4NUU A;  1QLB A;  2Y54 A;  4PJL A;  4IE7 A;  5ABH A;  2VKH A;  3S4U A;  4QAB A;  2XAS B;  4BFQ A;  3A5X A;  5AQI B;  1US7 B;  2ZJU A;  1R8I A;  4O4J E;  3C4X A;  3WTO A;  4FI5 A;  2KLQ A;  3ZSS A;  4HGA A;  3N9N A;  1G8X A;  2V7I A;  1EZ3 A;  2X66 A;  4U3C A;  2HH7 A;  5L3E B;  4X5T A;  2VQF T;  2YU2 A;  3KDS E;  2HPJ A;  5CA0 E;  5LBM A;  1Y64 B;  2ODV A;  2DHR A;  4O2A E;  3J9X 1;  4QAA A;  3GMI A;  3G06 A;  3QUJ A;  2LSK A;  3PUZ F;  4B3S T;  2P9B A;  1U4Q A;  3UFE A;  1Z8U A;  1I94 T;  5ABG A;  2VK9 A;  2Q9Q D;  4U72 A;  3RC8 A;  4MHC A;  5L3F B;  3M3Z B;  2MTQ A;  2QC1 B;  3N9M A;  2CA5 A;  1OED B;  1S35 A;  2GK9 A;  2QGS A;  4ISS A;  2R6G F;  1NEK A;  3WAK A;  5JVD E;  3C4Z A;  1MMD A;  2Y8D A;  2VUR A;  1XNR T;  2K48 A;  2ZMA A;  3ZJ1 A;  4C91 A;  5JDH A;  2E9X B;  2XYS A;  4ZOL E;  1DU2 A;  3AA1 B;  5CA1 E;  3AED A;  1QSD A;  4TWD A;  4A5X A;  5LHI B;  5L47 A;  2LM2 A;  1OWA A;  3FXD B;  2J4G A;  2EHO D;  2HN2 A;  4AI6 A;  3RIF A;  4H9P C;  1UV6 A;  3P4Q A;  3RH3 A;  4Z91 A;  4JI4 T;  1X79 A;  2D0U A;  3SFD A;  2LSJ A;  2NWB A;  3ZST A;  1YQ3 A;  2XZ6 A;  3LDQ B;  3OYX A;  3UU5 A;  4AQF C;  4CXX A;  2HN1 A;  2WWV A;  3Q5E A;  2NTY A;  4UVB B;  3T1H T;  3FBL A;  1D0X A;  2KXP B;  4JI2 T;  3ANW B;  5L2L A;  3PUY F;  5JR9 A;  2LOS A;  4ALX A;  2FJA A;  3P7I A;  4EXT A;  4ZK1 A;  3PU8 A;  4IL4 A;  1WR0 A;  1YXR A;  3WTI A;  5EK3 A;  3KV5 A;  2JQQ A;  2BG9 B;  3ZMZ B;  4HTE A;  2I0M A;  4EV6 A;  3HKB E;  3JC6 D;  3C98 B;  3PV0 F;  3LSV A;  2M6I A;  5CB4 E;  4V1A v;  2LKH A;  1WYB A;  2W66 A;  4XAX B;  5L3D B; 
#chains in the Genus database with same CATH homology
 2WNC A;  3UU3 A;  5CFB A;  2YN6 A;  2BYP A;  5AFK A;  5HEO A;  5HEG A;  3RQU A;  2XQ9 A;  2YOE A;  4LMJ A;  5L4E A;  4ZK4 A;  3ZDH A;  4B5D A;  5BRX A;  4TWF A;  3PMZ A;  2X00 D;  3GUA A;  5J0Z A;  2VL0 A;  3UQ7 A;  2BYQ A;  2XYS A;  4HFB A;  5HEJ A;  5FJV A;  5AFH A;  1I9B A;  5KZU A;  4HFC A;  4ZZB A;  4Z90 A;  3TLU A;  2XNV A;  4HQP A;  4A97 A;  4ILC A;  3C79 A;  3WTH A;  3WTN A;  4XK9 A;  4UM3 A;  2XYT A;  3PEO A;  2Y58 A;  3EI0 A;  4TWD A;  4TWH A;  5HCJ A;  2XQ5 A;  2XQ8 A;  5L47 A;  4ILA A;  4QH1 A;  2Y54 A;  4TNV A;  4HFD A;  5BW2 A;  2LM2 A;  4NZB A;  3P50 A;  4AFG A;  5BP0 A;  1UW6 A;  2BYR A;  3UU8 A;  2BJ0 A;  2YMD A;  5AFL A;  4LML A;  2XNU A;  3IGQ A;  4QAB A;  2PH9 A;  2C9T A;  2UZ6 A;  4HFE A;  3RIF A;  1OED E;  5KE4 A;  4ILB A;  3C84 A;  2XZ5 A;  4BFQ A;  5TVC A;  3U8N A;  5HCM A;  4HFH A;  4NPP A;  1UV6 A;  2ZJU A;  4Z91 A;  3UQ4 A;  4LMK A;  2LKG A;  5J5G A;  1UX2 A;  2BR8 A;  2W8G A;  5HEU A;  2YKS A;  3EHZ A;  4ZZC A;  2W8F A;  4XHE A;  3WTO A;  5HEH A;  3T4M A;  4AFH A;  4QH4 A;  2XZ6 A;  5J5I A;  5SYO A;  2XQ6 A;  5LXB A;  3SQ6 A;  3UU5 A;  3P4W A;  4IRE A;  4UM3 S;  2XNT A;  5JME A;  3ZDG A;  2XQA A;  2X00 A;  3U8L A;  4TNW A;  3TLV A;  5AFJ A;  4QH5 A;  4FRR A;  4WV9 A;  3U8J A;  4X5T A;  2XQ3 A;  5LG3 A;  5IUX A;  3RHW A;  2WN9 A;  4UM1 A;  2ZJV A;  4COF A;  3UUB A;  2Y56 A;  3SQ9 A;  2BG9 C;  3WTJ A;  2WNJ A;  3U8K A;  3RIA A;  5CO5 A;  3U8M A;  4ALX A;  3TLS A;  4UM3 P;  2BYS A;  3WIP A;  1OED A;  4QAA A;  4AFT A;  2M6B A;  3UU6 A;  3WTL A;  4ZK1 A;  4BQT A;  2XQ7 A;  3ZKR A;  4ZRU A;  3JAE A;  4IL9 A;  4IL4 A;  4HFI A;  3WTM A;  3JAF A;  4ZJS A;  4EZ1 A;  1OED C;  4UXU A;  3WTI A;  5AFM A;  5J5H A;  3UU4 A;  2BG9 B;  2BG9 A;  5L4H A;  3RQW A;  3TLT A;  4D01 A;  4ZJT A;  2LLY A;  2MAW A;  2BR7 A;  4UY2 A;  4QAC A;  2PGZ A;  3WTK A;  2XQ4 A;  4ZR6 A;  2WZY A;  3JAD A;  2QC1 B;  4F8H A;  2Y57 A;  1OED B;  2YME A;  3LSV A;  5J5F A;  5AFN A;  2BYN A;  3SIO A;  4DBM A;  2BG9 E;  3EAM A;  3SH1 A;  2M6I A;  2WNL A;  5AIN A;  4PIR A;  4A98 A;  2LKH A;  2Y7Y A;  2KSR A;  3RI5 A;  3TLW A;  5AFM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...