2BR8A

Crystal structure of acetylcholine-binding protein (achbp) from aplysia californica in complex with an alpha-conotoxin pnia variant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor/inhibitor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Crystal Structure of Nicotinic Acetylcholine Receptor Homolog Achbp in Complex with an Alpha-Conotoxin Pnia Variant
pubmed doi rcsb
source organism Aplysia californica
total genus 45
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2br8A00
2WNCA 4HFHA 4DBMA 2YKSA 3RIFA 2XNVA 3U8NA 3WTHA 2YMDA 2YMEA 3UU8A 2BG9B 3TLUA 4HQPA 5HCMA 4ILAA 5HEOA 3RHWA 1I9BA 3UQ4A 4ZJTA 5AFMB 4ZK1A 3SIOA 3EAMA 2BYSA 4ZK4A 3T4MA 2BR8A 3UQ7A 4IREA 4UM3A 2XQ6A 3WTLA 4QAAA 4TNWA 5CO5A 2BYRA 2XQ7A 2PGZA 2BJ0A 4QH5A 2X00A 2XZ6A 3SQ9A 5AFJA 2BG9C 4HFEA 2XYSA 4HFDA 3C79A 2XQ3A 4XK9A 3RQWA 3WIPA 4LMJA 3WTKA 5BRXA 4AFTA 4ALXA 2YN6A 2YOEA 3EHZA 4WV9A 4COFA 3U8KA 5HEHA 4ZZCA 2BYQA 3TLTA 3GUAA 1UV6A 4TWFA 5AFHA 4NPPA 3EI0A 2C9TA 3SQ6A 2Y56A 3TLWA 4ILCA 1UX2A 2QC1B 3TLSA 4UXUA 5AFNA 4B5DA 4A97A 3UU3A 2W8GA 5TVCA 5HEJA 2BG9A 4IL4A 4ZRUA 4HFBA 3WTOA 4UM1A 4UM3S 3WTNA 5AFMA 2WZYA 3P4WA 4IL9A 2W8FA 4NZBA 5SYOA 2PH9A 2XQAA 2Y54A 4QACA 4UY2A 5IUXA 4LMLA 5J5GA 2ZJUA 2X00D 3UU4A 3RI5A 2ZJVA 5BP0A 2BG9E 4FRRA 3WTMA 3PMZA 2Y58A 2BYNA 4ILBA 4HFCA 3LSVA 4QABA 3RIAA 5HCJA 3TLVA 2XQ4A 5J5HA 5AINA 5CFBA 4Z90A 4BQTA 4F8HA 5HEUA 2VL0A 5FJVA 3UUBA 2BYPA 3PEOA 4XHEA 5LG3A 3JAFA 2XQ5A 4Z91A 4AFHA 4EZ1A 5KZUA 4TWHA 4UM3P 4ZZBA 3JADA 3ZDHA 2XQ9A 2WNLA 2XNTA 5KE4A 4PIRA 4QH4A 2Y57A 2UZ6A 4X5TA 4TWDA 3RQUA 2WN9A 3IGQA 3WTJA 5AFKA 5L4EA 2XNUA 5J0ZA 4ZJSA 3U8JA 3UU6A 3U8LA 3JAEA 5JMEA 5L4HA 3ZDGA 4BFQA 5J5FA 5L47A 3ZKRA 4TNVA 4HFIA 4A98A 3P50A 5J5IA 2Y7YA 1UW6A 2WNJA 3WTIA 2BR7A 4AFGA 2XZ5A 4ZR6A 5HEGA 5BW2A 2XYTA 2XQ8A 4QH1A 3U8MA 4D01A 5LXBA 3C84A 5AFLA 3UU5A 4LMKA 3SH1A
chains in the Genus database with same CATH superfamily
2WNCA 4HFHA 4DBMA 2YKSA 3RIFA 2XNVA 3U8NA 3WTHA 2YMDA 2YMEA 3UU8A 2BG9B 3TLUA 4HQPA 5HCMA 4ILAA 5HEOA 3RHWA 1I9BA 3UQ4A 4ZJTA 5AFMB 4ZK1A 3SIOA 3EAMA 2BYSA 4ZK4A 3T4MA 2BR8A 3UQ7A 4IREA 4UM3A 2XQ6A 3WTLA 4QAAA 4TNWA 5CO5A 2BYRA 2XQ7A 2PGZA 2BJ0A 4QH5A 2X00A 2XZ6A 3SQ9A 5AFJA 2BG9C 4HFEA 2XYSA 4HFDA 3C79A 2XQ3A 4XK9A 3RQWA 3WIPA 4LMJA 3WTKA 5BRXA 4AFTA 4ALXA 2YN6A 2YOEA 3EHZA 4WV9A 4COFA 3U8KA 5HEHA 4ZZCA 2BYQA 3TLTA 3GUAA 1UV6A 4TWFA 5AFHA 4NPPA 3EI0A 2C9TA 3SQ6A 2Y56A 3TLWA 4ILCA 1UX2A 2QC1B 3TLSA 4UXUA 5AFNA 4B5DA 4A97A 3UU3A 2W8GA 5TVCA 5HEJA 2BG9A 4IL4A 4ZRUA 4HFBA 3WTOA 4UM1A 4UM3S 3WTNA 5AFMA 2WZYA 3P4WA 4IL9A 2W8FA 4NZBA 5SYOA 2PH9A 2XQAA 2Y54A 4QACA 4UY2A 5IUXA 4LMLA 5J5GA 2ZJUA 2X00D 3UU4A 3RI5A 2ZJVA 5BP0A 2BG9E 4FRRA 3WTMA 3PMZA 2Y58A 2BYNA 4ILBA 4HFCA 3LSVA 4QABA 3RIAA 5HCJA 3TLVA 2XQ4A 5J5HA 5AINA 5CFBA 4Z90A 4BQTA 4F8HA 5HEUA 2VL0A 5FJVA 3UUBA 2BYPA 3PEOA 4XHEA 5LG3A 3JAFA 2XQ5A 4Z91A 4AFHA 4EZ1A 5KZUA 4TWHA 4UM3P 4ZZBA 3JADA 3ZDHA 2XQ9A 2WNLA 2XNTA 5KE4A 4PIRA 4QH4A 2Y57A 2UZ6A 4X5TA 4TWDA 3RQUA 2WN9A 3IGQA 3WTJA 5AFKA 5L4EA 2XNUA 5J0ZA 4ZJSA 3U8JA 3UU6A 3U8LA 3JAEA 5JMEA 5L4HA 3ZDGA 4BFQA 5J5FA 5L47A 3ZKRA 4TNVA 4HFIA 4A98A 3P50A 5J5IA 2Y7YA 1UW6A 2WNJA 3WTIA 2BR7A 4AFGA 2XZ5A 4ZR6A 5HEGA 5BW2A 2XYTA 2XQ8A 4QH1A 3U8MA 4D01A 5LXBA 3C84A 5AFLA 3UU5A 4LMKA 3SH1A
chains in the Genus database with same CATH topology
2WNCA 4HFHA 4DBMA 2YKSA 3RIFA 2XNVA 3U8NA 3WTHA 2YMDA 2YMEA 3UU8A 2BG9B 3TLUA 4HQPA 5HCMA 4ILAA 5HEOA 3RHWA 1I9BA 3UQ4A 4ZJTA 5AFMB 4ZK1A 3SIOA 3EAMA 2BYSA 4ZK4A 3T4MA 2BR8A 3UQ7A 4IREA 4UM3A 2XQ6A 3WTLA 4QAAA 4TNWA 5CO5A 2BYRA 2XQ7A 2PGZA 2BJ0A 4QH5A 2X00A 2XZ6A 3SQ9A 5AFJA 2BG9C 4HFEA 2XYSA 4HFDA 3C79A 2XQ3A 4XK9A 3RQWA 3WIPA 4LMJA 3WTKA 5BRXA 4AFTA 4ALXA 2YN6A 2YOEA 3EHZA 4WV9A 4COFA 3U8KA 5HEHA 4ZZCA 2BYQA 3TLTA 3GUAA 1UV6A 4TWFA 5AFHA 4NPPA 3EI0A 2C9TA 3SQ6A 2Y56A 3TLWA 4ILCA 1UX2A 2QC1B 3TLSA 4UXUA 5AFNA 4B5DA 4A97A 3UU3A 2W8GA 5TVCA 5HEJA 2BG9A 4IL4A 4ZRUA 4HFBA 3WTOA 4UM1A 4UM3S 3WTNA 5AFMA 2WZYA 3P4WA 4IL9A 2W8FA 4NZBA 5SYOA 2PH9A 2XQAA 2Y54A 4QACA 4UY2A 5IUXA 4LMLA 5J5GA 2ZJUA 2X00D 3UU4A 3RI5A 2ZJVA 5BP0A 2BG9E 4FRRA 3WTMA 3PMZA 2Y58A 2BYNA 4ILBA 4HFCA 3LSVA 4QABA 3RIAA 5HCJA 3TLVA 2XQ4A 5J5HA 5AINA 5CFBA 4Z90A 4BQTA 4F8HA 5HEUA 2VL0A 5FJVA 3UUBA 2BYPA 3PEOA 4XHEA 5LG3A 3JAFA 2XQ5A 4Z91A 4AFHA 4EZ1A 5KZUA 4TWHA 4UM3P 4ZZBA 3JADA 3ZDHA 2XQ9A 2WNLA 2XNTA 5KE4A 4PIRA 4QH4A 2Y57A 2UZ6A 4X5TA 4TWDA 3RQUA 2WN9A 3IGQA 3WTJA 5AFKA 5L4EA 2XNUA 5J0ZA 4ZJSA 3U8JA 3UU6A 3U8LA 3JAEA 5JMEA 5L4HA 3ZDGA 4BFQA 5J5FA 5L47A 3ZKRA 4TNVA 4HFIA 4A98A 3P50A 5J5IA 2Y7YA 1UW6A 2WNJA 3WTIA 2BR7A 4AFGA 2XZ5A 4ZR6A 5HEGA 5BW2A 2XYTA 2XQ8A 4QH1A 3U8MA 4D01A 5LXBA 3C84A 5AFLA 3UU5A 4LMKA 3SH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNC A;  4HFH A;  4DBM A;  2YKS A;  3RIF A;  2XNV A;  3U8N A;  3WTH A;  2YMD A;  2YME A;  3UU8 A;  2BG9 B;  3TLU A;  4HQP A;  5HCM A;  4ILA A;  5HEO A;  3RHW A;  1I9B A;  3UQ4 A;  4ZJT A;  5AFM B;  4ZK1 A;  3SIO A;  3EAM A;  2BYS A;  4ZK4 A;  3T4M A;  2BR8 A;  3UQ7 A;  4IRE A;  4UM3 A;  2XQ6 A;  3WTL A;  4QAA A;  4TNW A;  5CO5 A;  2BYR A;  2XQ7 A;  2PGZ A;  2BJ0 A;  4QH5 A;  2X00 A;  2XZ6 A;  3SQ9 A;  5AFJ A;  2BG9 C;  4HFE A;  2XYS A;  4HFD A;  3C79 A;  2XQ3 A;  4XK9 A;  3RQW A;  3WIP A;  4LMJ A;  3WTK A;  5BRX A;  4AFT A;  4ALX A;  2YN6 A;  2YOE A;  3EHZ A;  4WV9 A;  4COF A;  3U8K A;  5HEH A;  4ZZC A;  2BYQ A;  3TLT A;  3GUA A;  1UV6 A;  4TWF A;  5AFH A;  4NPP A;  3EI0 A;  2C9T A;  3SQ6 A;  2Y56 A;  3TLW A;  4ILC A;  1UX2 A;  2QC1 B;  3TLS A;  4UXU A;  5AFN A;  4B5D A;  4A97 A;  3UU3 A;  2W8G A;  5TVC A;  5HEJ A;  2BG9 A;  4IL4 A;  4ZRU A;  4HFB A;  3WTO A;  4UM1 A;  4UM3 S;  3WTN A;  5AFM A;  2WZY A;  3P4W A;  4IL9 A;  2W8F A;  4NZB A;  5SYO A;  2PH9 A;  2XQA A;  2Y54 A;  4QAC A;  4UY2 A;  5IUX A;  4LML A;  5J5G A;  2ZJU A;  2X00 D;  3UU4 A;  3RI5 A;  2ZJV A;  5BP0 A;  2BG9 E;  4FRR A;  3WTM A;  3PMZ A;  2Y58 A;  2BYN A;  4ILB A;  4HFC A;  3LSV A;  4QAB A;  3RIA A;  5HCJ A;  3TLV A;  2XQ4 A;  5J5H A;  5AIN A;  5CFB A;  4Z90 A;  4BQT A;  4F8H A;  5HEU A;  2VL0 A;  5FJV A;  3UUB A;  2BYP A;  3PEO A;  4XHE A;  5LG3 A;  3JAF A;  2XQ5 A;  4Z91 A;  4AFH A;  4EZ1 A;  5KZU A;  4TWH A;  4UM3 P;  4ZZB A;  3JAD A;  3ZDH A;  2XQ9 A;  2WNL A;  2XNT A;  5KE4 A;  4PIR A;  4QH4 A;  2Y57 A;  2UZ6 A;  4X5T A;  4TWD A;  3RQU A;  2WN9 A;  3IGQ A;  3WTJ A;  5AFK A;  5L4E A;  2XNU A;  5J0Z A;  4ZJS A;  3U8J A;  3UU6 A;  3U8L A;  3JAE A;  5JME A;  5L4H A;  3ZDG A;  4BFQ A;  5J5F A;  5L47 A;  3ZKR A;  4TNV A;  4HFI A;  4A98 A;  3P50 A;  5J5I A;  2Y7Y A;  1UW6 A;  2WNJ A;  3WTI A;  2BR7 A;  4AFG A;  2XZ5 A;  4ZR6 A;  5HEG A;  5BW2 A;  2XYT A;  2XQ8 A;  4QH1 A;  3U8M A;  4D01 A;  5LXB A;  3C84 A;  5AFL A;  3UU5 A;  4LMK A;  3SH1 A; 
#chains in the Genus database with same CATH topology
 2WNC A;  4HFH A;  4DBM A;  2YKS A;  3RIF A;  2XNV A;  3U8N A;  3WTH A;  2YMD A;  2YME A;  3UU8 A;  2BG9 B;  3TLU A;  4HQP A;  5HCM A;  4ILA A;  5HEO A;  3RHW A;  1I9B A;  3UQ4 A;  4ZJT A;  5AFM B;  4ZK1 A;  3SIO A;  3EAM A;  2BYS A;  4ZK4 A;  3T4M A;  2BR8 A;  3UQ7 A;  4IRE A;  4UM3 A;  2XQ6 A;  3WTL A;  4QAA A;  4TNW A;  5CO5 A;  2BYR A;  2XQ7 A;  2PGZ A;  2BJ0 A;  4QH5 A;  2X00 A;  2XZ6 A;  3SQ9 A;  5AFJ A;  2BG9 C;  4HFE A;  2XYS A;  4HFD A;  3C79 A;  2XQ3 A;  4XK9 A;  3RQW A;  3WIP A;  4LMJ A;  3WTK A;  5BRX A;  4AFT A;  4ALX A;  2YN6 A;  2YOE A;  3EHZ A;  4WV9 A;  4COF A;  3U8K A;  5HEH A;  4ZZC A;  2BYQ A;  3TLT A;  3GUA A;  1UV6 A;  4TWF A;  5AFH A;  4NPP A;  3EI0 A;  2C9T A;  3SQ6 A;  2Y56 A;  3TLW A;  4ILC A;  1UX2 A;  2QC1 B;  3TLS A;  4UXU A;  5AFN A;  4B5D A;  4A97 A;  3UU3 A;  2W8G A;  5TVC A;  5HEJ A;  2BG9 A;  4IL4 A;  4ZRU A;  4HFB A;  3WTO A;  4UM1 A;  4UM3 S;  3WTN A;  5AFM A;  2WZY A;  3P4W A;  4IL9 A;  2W8F A;  4NZB A;  5SYO A;  2PH9 A;  2XQA A;  2Y54 A;  4QAC A;  4UY2 A;  5IUX A;  4LML A;  5J5G A;  2ZJU A;  2X00 D;  3UU4 A;  3RI5 A;  2ZJV A;  5BP0 A;  2BG9 E;  4FRR A;  3WTM A;  3PMZ A;  2Y58 A;  2BYN A;  4ILB A;  4HFC A;  3LSV A;  4QAB A;  3RIA A;  5HCJ A;  3TLV A;  2XQ4 A;  5J5H A;  5AIN A;  5CFB A;  4Z90 A;  4BQT A;  4F8H A;  5HEU A;  2VL0 A;  5FJV A;  3UUB A;  2BYP A;  3PEO A;  4XHE A;  5LG3 A;  3JAF A;  2XQ5 A;  4Z91 A;  4AFH A;  4EZ1 A;  5KZU A;  4TWH A;  4UM3 P;  4ZZB A;  3JAD A;  3ZDH A;  2XQ9 A;  2WNL A;  2XNT A;  5KE4 A;  4PIR A;  4QH4 A;  2Y57 A;  2UZ6 A;  4X5T A;  4TWD A;  3RQU A;  2WN9 A;  3IGQ A;  3WTJ A;  5AFK A;  5L4E A;  2XNU A;  5J0Z A;  4ZJS A;  3U8J A;  3UU6 A;  3U8L A;  3JAE A;  5JME A;  5L4H A;  3ZDG A;  4BFQ A;  5J5F A;  5L47 A;  3ZKR A;  4TNV A;  4HFI A;  4A98 A;  3P50 A;  5J5I A;  2Y7Y A;  1UW6 A;  2WNJ A;  3WTI A;  2BR7 A;  4AFG A;  2XZ5 A;  4ZR6 A;  5HEG A;  5BW2 A;  2XYT A;  2XQ8 A;  4QH1 A;  3U8M A;  4D01 A;  5LXB A;  3C84 A;  5AFL A;  3UU5 A;  4LMK A;  3SH1 A; 
#chains in the Genus database with same CATH homology
 2WNC A;  4HFH A;  4DBM A;  2YKS A;  3RIF A;  2XNV A;  3U8N A;  3WTH A;  2YMD A;  2YME A;  3UU8 A;  2BG9 B;  3TLU A;  4HQP A;  5HCM A;  4ILA A;  5HEO A;  3RHW A;  1I9B A;  3UQ4 A;  4ZJT A;  5AFM B;  4ZK1 A;  3SIO A;  3EAM A;  2BYS A;  4ZK4 A;  3T4M A;  2BR8 A;  3UQ7 A;  4IRE A;  4UM3 A;  2XQ6 A;  3WTL A;  4QAA A;  4TNW A;  5CO5 A;  2BYR A;  2XQ7 A;  2PGZ A;  2BJ0 A;  4QH5 A;  2X00 A;  2XZ6 A;  3SQ9 A;  5AFJ A;  2BG9 C;  4HFE A;  2XYS A;  4HFD A;  3C79 A;  2XQ3 A;  4XK9 A;  3RQW A;  3WIP A;  4LMJ A;  3WTK A;  5BRX A;  4AFT A;  4ALX A;  2YN6 A;  2YOE A;  3EHZ A;  4WV9 A;  4COF A;  3U8K A;  5HEH A;  4ZZC A;  2BYQ A;  3TLT A;  3GUA A;  1UV6 A;  4TWF A;  5AFH A;  4NPP A;  3EI0 A;  2C9T A;  3SQ6 A;  2Y56 A;  3TLW A;  4ILC A;  1UX2 A;  2QC1 B;  3TLS A;  4UXU A;  5AFN A;  4B5D A;  4A97 A;  3UU3 A;  2W8G A;  5TVC A;  5HEJ A;  2BG9 A;  4IL4 A;  4ZRU A;  4HFB A;  3WTO A;  4UM1 A;  4UM3 S;  3WTN A;  5AFM A;  2WZY A;  3P4W A;  4IL9 A;  2W8F A;  4NZB A;  5SYO A;  2PH9 A;  2XQA A;  2Y54 A;  4QAC A;  4UY2 A;  5IUX A;  4LML A;  5J5G A;  2ZJU A;  2X00 D;  3UU4 A;  3RI5 A;  2ZJV A;  5BP0 A;  2BG9 E;  4FRR A;  3WTM A;  3PMZ A;  2Y58 A;  2BYN A;  4ILB A;  4HFC A;  3LSV A;  4QAB A;  3RIA A;  5HCJ A;  3TLV A;  2XQ4 A;  5J5H A;  5AIN A;  5CFB A;  4Z90 A;  4BQT A;  4F8H A;  5HEU A;  2VL0 A;  5FJV A;  3UUB A;  2BYP A;  3PEO A;  4XHE A;  5LG3 A;  3JAF A;  2XQ5 A;  4Z91 A;  4AFH A;  4EZ1 A;  5KZU A;  4TWH A;  4UM3 P;  4ZZB A;  3JAD A;  3ZDH A;  2XQ9 A;  2WNL A;  2XNT A;  5KE4 A;  4PIR A;  4QH4 A;  2Y57 A;  2UZ6 A;  4X5T A;  4TWD A;  3RQU A;  2WN9 A;  3IGQ A;  3WTJ A;  5AFK A;  5L4E A;  2XNU A;  5J0Z A;  4ZJS A;  3U8J A;  3UU6 A;  3U8L A;  3JAE A;  5JME A;  5L4H A;  3ZDG A;  4BFQ A;  5J5F A;  5L47 A;  3ZKR A;  4TNV A;  4HFI A;  4A98 A;  3P50 A;  5J5I A;  2Y7Y A;  1UW6 A;  2WNJ A;  3WTI A;  2BR7 A;  4AFG A;  2XZ5 A;  4ZR6 A;  5HEG A;  5BW2 A;  2XYT A;  2XQ8 A;  4QH1 A;  3U8M A;  4D01 A;  5LXB A;  3C84 A;  5AFL A;  3UU5 A;  4LMK A;  3SH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...