2BR8A

Crystal structure of acetylcholine-binding protein (achbp) from aplysia californica in complex with an alpha-conotoxin pnia variant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Crystal Structure of Nicotinic Acetylcholine Receptor Homolog Achbp in Complex with an Alpha-Conotoxin Pnia Variant
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor/inhibitor
total genus 45
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2br8A00
3UU4A 3T4MA 5J5FA 3WTKA 2YOEA 3WTIA 3SQ9A 3ZKRA 2X00D 3U8MA 5AFKA 2YN6A 3WTNA 4HFCA 4BQTA 3UU3A 4AFHA 4D01A 3JAFA 3P50A 4PIRA 4TNVA 5JMEA 2XQ6A 3ZDGA 5J5HA 4UM3S 5CFBA 2XQAA 2BJ0A 4ZJTA 2VL0A 4TNWA 4TWDA 2XYTA 3UUBA 2C9TA 5HEUA 3RIAA 3TLWA 4XK9A 2BG9B 3UU6A 4UM1A 4ZK1A 4ILBA 4ZK4A 2BYNA 2YMDA 2ZJVA 3WTJA 5AINA 2BG9A 5AFMA 3P4WA 3UQ4A 4LMKA 5LXBA 4UXUA 3U8NA 3LSVA 5AFNA 2XQ4A 3IGQA 2X00A 5AFHA 2YKSA 4ZZCA 2PH9A 5HEJA 4F8HA 4ZRUA 4TWFA 3JADA 4DBMA 4HFIA 4QABA 2BYPA 2BYRA 2BYQA 5AFLA 5KE4A 2XZ5A 4HFEA 3SIOA 1UX2A 4IL4A 3TLVA 4A98A 4LMLA 4ZZBA 5J5IA 3JAEA 4HFDA 2ZJUA 3RHWA 4A97A 5AFMB 2XQ3A 5AFJA 3SH1A 3WTLA 5KZUA 5L4HA 1UW6A 5L47A 3U8JA 2XYSA 4TWHA 3PEOA 2XNUA 2Y54A 2XQ8A 5HEHA 2W8GA 2Y56A 3EI0A 1I9BA 3TLTA 2XQ7A 3WIPA 4HQPA 5HEGA 2QC1B 4IREA 5HCMA 3C84A 4QAAA 5HEOA 4EZ1A 2BR7A 2WNJA 5L4EA 4BFQA 3RQUA 4FRRA 4AFGA 5BP0A 3ZDHA 3RIFA 1UV6A 3PMZA 4ALXA 4X5TA 2XQ5A 5J0ZA 5TVCA 3TLUA 2BYSA 4QH5A 5BRXA 2YMEA 5SYOA 5FJVA 2W8FA 5IUXA 4B5DA 2XZ6A 4ILAA 4XHEA 3WTHA 4AFTA 4UM3P 3C79A 3GUAA 2PGZA 4ZR6A 3UQ7A 4UY2A 4WV9A 4Z90A 2WZYA 2WNCA 2Y57A 2WN9A 2XNVA 3UU8A 5LG3A 4QACA 3WTMA 3WTOA 2Y7YA 4HFHA 4Z91A 3UU5A 2BR8A 4HFBA 4COFA 2UZ6A 4NZBA 4ZJSA 2BG9C 2BG9E 2Y58A 4UM3A 3SQ6A 4IL9A 2XQ9A 4ILCA 3U8KA 5BW2A 3EAMA 4QH4A 3RI5A 2WNLA 3EHZA 5HCJA 3TLSA 3U8LA 3RQWA 2XNTA 5CO5A 4NPPA 5J5GA 4LMJA 4QH1A
chains in the Genus database with same CATH superfamily
3UU4A 3T4MA 5J5FA 3WTKA 2YOEA 3WTIA 3SQ9A 3ZKRA 2X00D 3U8MA 5AFKA 2YN6A 3WTNA 4HFCA 4BQTA 3UU3A 4AFHA 4D01A 3JAFA 3P50A 4PIRA 4TNVA 5JMEA 2XQ6A 3ZDGA 5J5HA 4UM3S 5CFBA 2XQAA 2BJ0A 4ZJTA 2VL0A 4TNWA 4TWDA 2XYTA 3UUBA 2C9TA 5HEUA 3RIAA 3TLWA 4XK9A 2BG9B 3UU6A 4UM1A 4ZK1A 4ILBA 4ZK4A 2BYNA 2YMDA 2ZJVA 3WTJA 5AINA 2BG9A 5AFMA 3P4WA 3UQ4A 4LMKA 5LXBA 4UXUA 3U8NA 3LSVA 5AFNA 2XQ4A 3IGQA 2X00A 5AFHA 2YKSA 4ZZCA 2PH9A 5HEJA 4F8HA 4ZRUA 4TWFA 3JADA 4DBMA 4HFIA 4QABA 2BYPA 2BYRA 2BYQA 5AFLA 5KE4A 2XZ5A 4HFEA 3SIOA 1UX2A 4IL4A 3TLVA 4A98A 4LMLA 4ZZBA 5J5IA 3JAEA 4HFDA 2ZJUA 3RHWA 4A97A 5AFMB 2XQ3A 5AFJA 3SH1A 3WTLA 5KZUA 5L4HA 1UW6A 5L47A 3U8JA 2XYSA 4TWHA 3PEOA 2XNUA 2Y54A 2XQ8A 5HEHA 2W8GA 2Y56A 3EI0A 1I9BA 3TLTA 2XQ7A 3WIPA 4HQPA 5HEGA 2QC1B 4IREA 5HCMA 3C84A 4QAAA 5HEOA 4EZ1A 2BR7A 2WNJA 5L4EA 4BFQA 3RQUA 4FRRA 4AFGA 5BP0A 3ZDHA 3RIFA 1UV6A 3PMZA 4ALXA 4X5TA 2XQ5A 5J0ZA 5TVCA 3TLUA 2BYSA 4QH5A 5BRXA 2YMEA 5SYOA 5FJVA 2W8FA 5IUXA 4B5DA 2XZ6A 4ILAA 4XHEA 3WTHA 4AFTA 4UM3P 3C79A 3GUAA 2PGZA 4ZR6A 3UQ7A 4UY2A 4WV9A 4Z90A 2WZYA 2WNCA 2Y57A 2WN9A 2XNVA 3UU8A 5LG3A 4QACA 3WTMA 3WTOA 2Y7YA 4HFHA 4Z91A 3UU5A 2BR8A 4HFBA 4COFA 2UZ6A 4NZBA 4ZJSA 2BG9C 2BG9E 2Y58A 4UM3A 3SQ6A 4IL9A 2XQ9A 4ILCA 3U8KA 5BW2A 3EAMA 4QH4A 3RI5A 2WNLA 3EHZA 5HCJA 3TLSA 3U8LA 3RQWA 2XNTA 5CO5A 4NPPA 5J5GA 4LMJA 4QH1A
chains in the Genus database with same CATH topology
3UU4A 3T4MA 5J5FA 3WTKA 2YOEA 3WTIA 3SQ9A 3ZKRA 2X00D 3U8MA 5AFKA 2YN6A 3WTNA 4HFCA 4BQTA 3UU3A 4AFHA 4D01A 3JAFA 3P50A 4PIRA 4TNVA 5JMEA 2XQ6A 3ZDGA 5J5HA 4UM3S 5CFBA 2XQAA 2BJ0A 4ZJTA 2VL0A 4TNWA 4TWDA 2XYTA 3UUBA 2C9TA 5HEUA 3RIAA 3TLWA 4XK9A 2BG9B 3UU6A 4UM1A 4ZK1A 4ILBA 4ZK4A 2BYNA 2YMDA 2ZJVA 3WTJA 5AINA 2BG9A 5AFMA 3P4WA 3UQ4A 4LMKA 5LXBA 4UXUA 3U8NA 3LSVA 5AFNA 2XQ4A 3IGQA 2X00A 5AFHA 2YKSA 4ZZCA 2PH9A 5HEJA 4F8HA 4ZRUA 4TWFA 3JADA 4DBMA 4HFIA 4QABA 2BYPA 2BYRA 2BYQA 5AFLA 5KE4A 2XZ5A 4HFEA 3SIOA 1UX2A 4IL4A 3TLVA 4A98A 4LMLA 4ZZBA 5J5IA 3JAEA 4HFDA 2ZJUA 3RHWA 4A97A 5AFMB 2XQ3A 5AFJA 3SH1A 3WTLA 5KZUA 5L4HA 1UW6A 5L47A 3U8JA 2XYSA 4TWHA 3PEOA 2XNUA 2Y54A 2XQ8A 5HEHA 2W8GA 2Y56A 3EI0A 1I9BA 3TLTA 2XQ7A 3WIPA 4HQPA 5HEGA 2QC1B 4IREA 5HCMA 3C84A 4QAAA 5HEOA 4EZ1A 2BR7A 2WNJA 5L4EA 4BFQA 3RQUA 4FRRA 4AFGA 5BP0A 3ZDHA 3RIFA 1UV6A 3PMZA 4ALXA 4X5TA 2XQ5A 5J0ZA 5TVCA 3TLUA 2BYSA 4QH5A 5BRXA 2YMEA 5SYOA 5FJVA 2W8FA 5IUXA 4B5DA 2XZ6A 4ILAA 4XHEA 3WTHA 4AFTA 4UM3P 3C79A 3GUAA 2PGZA 4ZR6A 3UQ7A 4UY2A 4WV9A 4Z90A 2WZYA 2WNCA 2Y57A 2WN9A 2XNVA 3UU8A 5LG3A 4QACA 3WTMA 3WTOA 2Y7YA 4HFHA 4Z91A 3UU5A 2BR8A 4HFBA 4COFA 2UZ6A 4NZBA 4ZJSA 2BG9C 2BG9E 2Y58A 4UM3A 3SQ6A 4IL9A 2XQ9A 4ILCA 3U8KA 5BW2A 3EAMA 4QH4A 3RI5A 2WNLA 3EHZA 5HCJA 3TLSA 3U8LA 3RQWA 2XNTA 5CO5A 4NPPA 5J5GA 4LMJA 4QH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU4 A;  3T4M A;  5J5F A;  3WTK A;  2YOE A;  3WTI A;  3SQ9 A;  3ZKR A;  2X00 D;  3U8M A;  5AFK A;  2YN6 A;  3WTN A;  4HFC A;  4BQT A;  3UU3 A;  4AFH A;  4D01 A;  3JAF A;  3P50 A;  4PIR A;  4TNV A;  5JME A;  2XQ6 A;  3ZDG A;  5J5H A;  4UM3 S;  5CFB A;  2XQA A;  2BJ0 A;  4ZJT A;  2VL0 A;  4TNW A;  4TWD A;  2XYT A;  3UUB A;  2C9T A;  5HEU A;  3RIA A;  3TLW A;  4XK9 A;  2BG9 B;  3UU6 A;  4UM1 A;  4ZK1 A;  4ILB A;  4ZK4 A;  2BYN A;  2YMD A;  2ZJV A;  3WTJ A;  5AIN A;  2BG9 A;  5AFM A;  3P4W A;  3UQ4 A;  4LMK A;  5LXB A;  4UXU A;  3U8N A;  3LSV A;  5AFN A;  2XQ4 A;  3IGQ A;  2X00 A;  5AFH A;  2YKS A;  4ZZC A;  2PH9 A;  5HEJ A;  4F8H A;  4ZRU A;  4TWF A;  3JAD A;  4DBM A;  4HFI A;  4QAB A;  2BYP A;  2BYR A;  2BYQ A;  5AFL A;  5KE4 A;  2XZ5 A;  4HFE A;  3SIO A;  1UX2 A;  4IL4 A;  3TLV A;  4A98 A;  4LML A;  4ZZB A;  5J5I A;  3JAE A;  4HFD A;  2ZJU A;  3RHW A;  4A97 A;  5AFM B;  2XQ3 A;  5AFJ A;  3SH1 A;  3WTL A;  5KZU A;  5L4H A;  1UW6 A;  5L47 A;  3U8J A;  2XYS A;  4TWH A;  3PEO A;  2XNU A;  2Y54 A;  2XQ8 A;  5HEH A;  2W8G A;  2Y56 A;  3EI0 A;  1I9B A;  3TLT A;  2XQ7 A;  3WIP A;  4HQP A;  5HEG A;  2QC1 B;  4IRE A;  5HCM A;  3C84 A;  4QAA A;  5HEO A;  4EZ1 A;  2BR7 A;  2WNJ A;  5L4E A;  4BFQ A;  3RQU A;  4FRR A;  4AFG A;  5BP0 A;  3ZDH A;  3RIF A;  1UV6 A;  3PMZ A;  4ALX A;  4X5T A;  2XQ5 A;  5J0Z A;  5TVC A;  3TLU A;  2BYS A;  4QH5 A;  5BRX A;  2YME A;  5SYO A;  5FJV A;  2W8F A;  5IUX A;  4B5D A;  2XZ6 A;  4ILA A;  4XHE A;  3WTH A;  4AFT A;  4UM3 P;  3C79 A;  3GUA A;  2PGZ A;  4ZR6 A;  3UQ7 A;  4UY2 A;  4WV9 A;  4Z90 A;  2WZY A;  2WNC A;  2Y57 A;  2WN9 A;  2XNV A;  3UU8 A;  5LG3 A;  4QAC A;  3WTM A;  3WTO A;  2Y7Y A;  4HFH A;  4Z91 A;  3UU5 A;  2BR8 A;  4HFB A;  4COF A;  2UZ6 A;  4NZB A;  4ZJS A;  2BG9 C;  2BG9 E;  2Y58 A;  4UM3 A;  3SQ6 A;  4IL9 A;  2XQ9 A;  4ILC A;  3U8K A;  5BW2 A;  3EAM A;  4QH4 A;  3RI5 A;  2WNL A;  3EHZ A;  5HCJ A;  3TLS A;  3U8L A;  3RQW A;  2XNT A;  5CO5 A;  4NPP A;  5J5G A;  4LMJ A;  4QH1 A; 
#chains in the Genus database with same CATH topology
 3UU4 A;  3T4M A;  5J5F A;  3WTK A;  2YOE A;  3WTI A;  3SQ9 A;  3ZKR A;  2X00 D;  3U8M A;  5AFK A;  2YN6 A;  3WTN A;  4HFC A;  4BQT A;  3UU3 A;  4AFH A;  4D01 A;  3JAF A;  3P50 A;  4PIR A;  4TNV A;  5JME A;  2XQ6 A;  3ZDG A;  5J5H A;  4UM3 S;  5CFB A;  2XQA A;  2BJ0 A;  4ZJT A;  2VL0 A;  4TNW A;  4TWD A;  2XYT A;  3UUB A;  2C9T A;  5HEU A;  3RIA A;  3TLW A;  4XK9 A;  2BG9 B;  3UU6 A;  4UM1 A;  4ZK1 A;  4ILB A;  4ZK4 A;  2BYN A;  2YMD A;  2ZJV A;  3WTJ A;  5AIN A;  2BG9 A;  5AFM A;  3P4W A;  3UQ4 A;  4LMK A;  5LXB A;  4UXU A;  3U8N A;  3LSV A;  5AFN A;  2XQ4 A;  3IGQ A;  2X00 A;  5AFH A;  2YKS A;  4ZZC A;  2PH9 A;  5HEJ A;  4F8H A;  4ZRU A;  4TWF A;  3JAD A;  4DBM A;  4HFI A;  4QAB A;  2BYP A;  2BYR A;  2BYQ A;  5AFL A;  5KE4 A;  2XZ5 A;  4HFE A;  3SIO A;  1UX2 A;  4IL4 A;  3TLV A;  4A98 A;  4LML A;  4ZZB A;  5J5I A;  3JAE A;  4HFD A;  2ZJU A;  3RHW A;  4A97 A;  5AFM B;  2XQ3 A;  5AFJ A;  3SH1 A;  3WTL A;  5KZU A;  5L4H A;  1UW6 A;  5L47 A;  3U8J A;  2XYS A;  4TWH A;  3PEO A;  2XNU A;  2Y54 A;  2XQ8 A;  5HEH A;  2W8G A;  2Y56 A;  3EI0 A;  1I9B A;  3TLT A;  2XQ7 A;  3WIP A;  4HQP A;  5HEG A;  2QC1 B;  4IRE A;  5HCM A;  3C84 A;  4QAA A;  5HEO A;  4EZ1 A;  2BR7 A;  2WNJ A;  5L4E A;  4BFQ A;  3RQU A;  4FRR A;  4AFG A;  5BP0 A;  3ZDH A;  3RIF A;  1UV6 A;  3PMZ A;  4ALX A;  4X5T A;  2XQ5 A;  5J0Z A;  5TVC A;  3TLU A;  2BYS A;  4QH5 A;  5BRX A;  2YME A;  5SYO A;  5FJV A;  2W8F A;  5IUX A;  4B5D A;  2XZ6 A;  4ILA A;  4XHE A;  3WTH A;  4AFT A;  4UM3 P;  3C79 A;  3GUA A;  2PGZ A;  4ZR6 A;  3UQ7 A;  4UY2 A;  4WV9 A;  4Z90 A;  2WZY A;  2WNC A;  2Y57 A;  2WN9 A;  2XNV A;  3UU8 A;  5LG3 A;  4QAC A;  3WTM A;  3WTO A;  2Y7Y A;  4HFH A;  4Z91 A;  3UU5 A;  2BR8 A;  4HFB A;  4COF A;  2UZ6 A;  4NZB A;  4ZJS A;  2BG9 C;  2BG9 E;  2Y58 A;  4UM3 A;  3SQ6 A;  4IL9 A;  2XQ9 A;  4ILC A;  3U8K A;  5BW2 A;  3EAM A;  4QH4 A;  3RI5 A;  2WNL A;  3EHZ A;  5HCJ A;  3TLS A;  3U8L A;  3RQW A;  2XNT A;  5CO5 A;  4NPP A;  5J5G A;  4LMJ A;  4QH1 A; 
#chains in the Genus database with same CATH homology
 3UU4 A;  3T4M A;  5J5F A;  3WTK A;  2YOE A;  3WTI A;  3SQ9 A;  3ZKR A;  2X00 D;  3U8M A;  5AFK A;  2YN6 A;  3WTN A;  4HFC A;  4BQT A;  3UU3 A;  4AFH A;  4D01 A;  3JAF A;  3P50 A;  4PIR A;  4TNV A;  5JME A;  2XQ6 A;  3ZDG A;  5J5H A;  4UM3 S;  5CFB A;  2XQA A;  2BJ0 A;  4ZJT A;  2VL0 A;  4TNW A;  4TWD A;  2XYT A;  3UUB A;  2C9T A;  5HEU A;  3RIA A;  3TLW A;  4XK9 A;  2BG9 B;  3UU6 A;  4UM1 A;  4ZK1 A;  4ILB A;  4ZK4 A;  2BYN A;  2YMD A;  2ZJV A;  3WTJ A;  5AIN A;  2BG9 A;  5AFM A;  3P4W A;  3UQ4 A;  4LMK A;  5LXB A;  4UXU A;  3U8N A;  3LSV A;  5AFN A;  2XQ4 A;  3IGQ A;  2X00 A;  5AFH A;  2YKS A;  4ZZC A;  2PH9 A;  5HEJ A;  4F8H A;  4ZRU A;  4TWF A;  3JAD A;  4DBM A;  4HFI A;  4QAB A;  2BYP A;  2BYR A;  2BYQ A;  5AFL A;  5KE4 A;  2XZ5 A;  4HFE A;  3SIO A;  1UX2 A;  4IL4 A;  3TLV A;  4A98 A;  4LML A;  4ZZB A;  5J5I A;  3JAE A;  4HFD A;  2ZJU A;  3RHW A;  4A97 A;  5AFM B;  2XQ3 A;  5AFJ A;  3SH1 A;  3WTL A;  5KZU A;  5L4H A;  1UW6 A;  5L47 A;  3U8J A;  2XYS A;  4TWH A;  3PEO A;  2XNU A;  2Y54 A;  2XQ8 A;  5HEH A;  2W8G A;  2Y56 A;  3EI0 A;  1I9B A;  3TLT A;  2XQ7 A;  3WIP A;  4HQP A;  5HEG A;  2QC1 B;  4IRE A;  5HCM A;  3C84 A;  4QAA A;  5HEO A;  4EZ1 A;  2BR7 A;  2WNJ A;  5L4E A;  4BFQ A;  3RQU A;  4FRR A;  4AFG A;  5BP0 A;  3ZDH A;  3RIF A;  1UV6 A;  3PMZ A;  4ALX A;  4X5T A;  2XQ5 A;  5J0Z A;  5TVC A;  3TLU A;  2BYS A;  4QH5 A;  5BRX A;  2YME A;  5SYO A;  5FJV A;  2W8F A;  5IUX A;  4B5D A;  2XZ6 A;  4ILA A;  4XHE A;  3WTH A;  4AFT A;  4UM3 P;  3C79 A;  3GUA A;  2PGZ A;  4ZR6 A;  3UQ7 A;  4UY2 A;  4WV9 A;  4Z90 A;  2WZY A;  2WNC A;  2Y57 A;  2WN9 A;  2XNV A;  3UU8 A;  5LG3 A;  4QAC A;  3WTM A;  3WTO A;  2Y7Y A;  4HFH A;  4Z91 A;  3UU5 A;  2BR8 A;  4HFB A;  4COF A;  2UZ6 A;  4NZB A;  4ZJS A;  2BG9 C;  2BG9 E;  2Y58 A;  4UM3 A;  3SQ6 A;  4IL9 A;  2XQ9 A;  4ILC A;  3U8K A;  5BW2 A;  3EAM A;  4QH4 A;  3RI5 A;  2WNL A;  3EHZ A;  5HCJ A;  3TLS A;  3U8L A;  3RQW A;  2XNT A;  5CO5 A;  4NPP A;  5J5G A;  4LMJ A;  4QH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...