5J5FA

X-ray crystal structure of acetylcholine binding protein (achbp) in complex with n4,n4-bis[(pyridin-2-yl)methyl]-6-(thiophen-3-yl)pyrimidine-2,4-diamine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
212
structure length
212
Chain Sequence
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Substituted 2-Aminopyrimidines Selective for alpha 7-Nicotinic Acetylcholine Receptor Activation and Association with Acetylcholine Binding Proteins.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein
total genus 57
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j5fA00
2X00A 2BYQA 2PH9A 3C79A 5L4HA 4TWFA 3UU6A 3GUAA 4Z91A 3TLWA 4HFCA 3TLVA 3UQ4A 2XNUA 3ZDHA 5J5FA 1UX2A 2YOEA 5LG3A 3U8MA 4Z90A 4XHEA 4QABA 4PIRA 3SH1A 1UW6A 2BG9B 2W8GA 5HCJA 3TLUA 4UY2A 2Y57A 3RHWA 3EHZA 3RI5A 4AFHA 4LMKA 4QACA 5J5HA 5BW2A 2XQ7A 4LMLA 3RIAA 3SIOA 2QC1B 2XNVA 5SYOA 2XYSA 5L47A 5CO5A 2BYRA 4QAAA 5KZUA 4XK9A 4HFDA 2XZ6A 3PEOA 3EI0A 4UM1A 4HFEA 5AFMA 5BRXA 3U8NA 4NPPA 4IL9A 2XYTA 2BYNA 1UV6A 4HFHA 4QH1A 4TWDA 4QH5A 2ZJVA 5TVCA 3WTIA 4EZ1A 5AINA 4TNWA 2BG9C 3ZKRA 3JAFA 2XQ6A 5J5GA 3UQ7A 3TLTA 2BR7A 5AFHA 5HEGA 2W8FA 5AFKA 2Y56A 4NZBA 4AFTA 3C84A 1I9BA 4DBMA 3EAMA 5HEJA 5IUXA 4HFIA 2XQ5A 4LMJA 5AFNA 2YMEA 4QH4A 4ZZCA 3UU4A 3IGQA 3WIPA 2BYSA 2Y7YA 3LSVA 4ZK4A 4TWHA 4ILBA 4F8HA 2XNTA 5LXBA 2WNLA 2Y58A 2BG9E 5HEOA 3SQ6A 3TLSA 3U8JA 4ALXA 4ZJSA 2WZYA 3P50A 4HFBA 2XQAA 3UUBA 2C9TA 4ILAA 3U8KA 3JADA 2XQ4A 5AFJA 5BP0A 2YMDA 4UM3P 2UZ6A 5AFLA 4BQTA 2BR8A 3U8LA 3WTOA 2XQ3A 5JMEA 2X00D 3RQUA 5J5IA 4ZRUA 2BJ0A 4WV9A 4FRRA 3WTJA 2YN6A 3WTNA 3WTHA 4D01A 3RQWA 2BG9A 4AFGA 3WTLA 2ZJUA 3SQ9A 3P4WA 4UM3A 2XZ5A 3RIFA 3T4MA 2Y54A 3WTMA 5KE4A 4X5TA 2WNCA 5HEUA 4A97A 4UXUA 5HEHA 3ZDGA 4ZJTA 2BYPA 4IL4A 2XQ9A 3UU8A 4BFQA 5AFMB 5L4EA 5J0ZA 4ZR6A 3PMZA 4B5DA 3UU3A 4UM3S 4HQPA 3JAEA 2XQ8A 5HCMA 2WNJA 5CFBA 4ZK1A 2VL0A 4A98A 2WN9A 5FJVA 4IREA 3WTKA 4COFA 4ILCA 4ZZBA 2PGZA 4TNVA 3UU5A 2YKSA
chains in the Genus database with same CATH superfamily
2X00A 2BYQA 2PH9A 3C79A 5L4HA 4TWFA 3UU6A 3GUAA 4Z91A 3TLWA 4HFCA 3TLVA 3UQ4A 2XNUA 3ZDHA 5J5FA 1UX2A 2YOEA 5LG3A 3U8MA 4Z90A 4XHEA 4QABA 4PIRA 3SH1A 1UW6A 2BG9B 2W8GA 5HCJA 3TLUA 4UY2A 2Y57A 3RHWA 3EHZA 3RI5A 4AFHA 4LMKA 4QACA 5J5HA 5BW2A 2XQ7A 4LMLA 3RIAA 3SIOA 2QC1B 2XNVA 5SYOA 2XYSA 5L47A 5CO5A 2BYRA 4QAAA 5KZUA 4XK9A 4HFDA 2XZ6A 3PEOA 3EI0A 4UM1A 4HFEA 5AFMA 5BRXA 3U8NA 4NPPA 4IL9A 2XYTA 2BYNA 1UV6A 4HFHA 4QH1A 4TWDA 4QH5A 2ZJVA 5TVCA 3WTIA 4EZ1A 5AINA 4TNWA 2BG9C 3ZKRA 3JAFA 2XQ6A 5J5GA 3UQ7A 3TLTA 2BR7A 5AFHA 5HEGA 2W8FA 5AFKA 2Y56A 4NZBA 4AFTA 3C84A 1I9BA 4DBMA 3EAMA 5HEJA 5IUXA 4HFIA 2XQ5A 4LMJA 5AFNA 2YMEA 4QH4A 4ZZCA 3UU4A 3IGQA 3WIPA 2BYSA 2Y7YA 3LSVA 4ZK4A 4TWHA 4ILBA 4F8HA 2XNTA 5LXBA 2WNLA 2Y58A 2BG9E 5HEOA 3SQ6A 3TLSA 3U8JA 4ALXA 4ZJSA 2WZYA 3P50A 4HFBA 2XQAA 3UUBA 2C9TA 4ILAA 3U8KA 3JADA 2XQ4A 5AFJA 5BP0A 2YMDA 4UM3P 2UZ6A 5AFLA 4BQTA 2BR8A 3U8LA 3WTOA 2XQ3A 5JMEA 2X00D 3RQUA 5J5IA 4ZRUA 2BJ0A 4WV9A 4FRRA 3WTJA 2YN6A 3WTNA 3WTHA 4D01A 3RQWA 2BG9A 4AFGA 3WTLA 2ZJUA 3SQ9A 3P4WA 4UM3A 2XZ5A 3RIFA 3T4MA 2Y54A 3WTMA 5KE4A 4X5TA 2WNCA 5HEUA 4A97A 4UXUA 5HEHA 3ZDGA 4ZJTA 2BYPA 4IL4A 2XQ9A 3UU8A 4BFQA 5AFMB 5L4EA 5J0ZA 4ZR6A 3PMZA 4B5DA 3UU3A 4UM3S 4HQPA 3JAEA 2XQ8A 5HCMA 2WNJA 5CFBA 4ZK1A 2VL0A 4A98A 2WN9A 5FJVA 4IREA 3WTKA 4COFA 4ILCA 4ZZBA 2PGZA 4TNVA 3UU5A 2YKSA
chains in the Genus database with same CATH topology
2X00A 2BYQA 2PH9A 3C79A 5L4HA 4TWFA 3UU6A 3GUAA 4Z91A 3TLWA 4HFCA 3TLVA 3UQ4A 2XNUA 3ZDHA 5J5FA 1UX2A 2YOEA 5LG3A 3U8MA 4Z90A 4XHEA 4QABA 4PIRA 3SH1A 1UW6A 2BG9B 2W8GA 5HCJA 3TLUA 4UY2A 2Y57A 3RHWA 3EHZA 3RI5A 4AFHA 4LMKA 4QACA 5J5HA 5BW2A 2XQ7A 4LMLA 3RIAA 3SIOA 2QC1B 2XNVA 5SYOA 2XYSA 5L47A 5CO5A 2BYRA 4QAAA 5KZUA 4XK9A 4HFDA 2XZ6A 3PEOA 3EI0A 4UM1A 4HFEA 5AFMA 5BRXA 3U8NA 4NPPA 4IL9A 2XYTA 2BYNA 1UV6A 4HFHA 4QH1A 4TWDA 4QH5A 2ZJVA 5TVCA 3WTIA 4EZ1A 5AINA 4TNWA 2BG9C 3ZKRA 3JAFA 2XQ6A 5J5GA 3UQ7A 3TLTA 2BR7A 5AFHA 5HEGA 2W8FA 5AFKA 2Y56A 4NZBA 4AFTA 3C84A 1I9BA 4DBMA 3EAMA 5HEJA 5IUXA 4HFIA 2XQ5A 4LMJA 5AFNA 2YMEA 4QH4A 4ZZCA 3UU4A 3IGQA 3WIPA 2BYSA 2Y7YA 3LSVA 4ZK4A 4TWHA 4ILBA 4F8HA 2XNTA 5LXBA 2WNLA 2Y58A 2BG9E 5HEOA 3SQ6A 3TLSA 3U8JA 4ALXA 4ZJSA 2WZYA 3P50A 4HFBA 2XQAA 3UUBA 2C9TA 4ILAA 3U8KA 3JADA 2XQ4A 5AFJA 5BP0A 2YMDA 4UM3P 2UZ6A 5AFLA 4BQTA 2BR8A 3U8LA 3WTOA 2XQ3A 5JMEA 2X00D 3RQUA 5J5IA 4ZRUA 2BJ0A 4WV9A 4FRRA 3WTJA 2YN6A 3WTNA 3WTHA 4D01A 3RQWA 2BG9A 4AFGA 3WTLA 2ZJUA 3SQ9A 3P4WA 4UM3A 2XZ5A 3RIFA 3T4MA 2Y54A 3WTMA 5KE4A 4X5TA 2WNCA 5HEUA 4A97A 4UXUA 5HEHA 3ZDGA 4ZJTA 2BYPA 4IL4A 2XQ9A 3UU8A 4BFQA 5AFMB 5L4EA 5J0ZA 4ZR6A 3PMZA 4B5DA 3UU3A 4UM3S 4HQPA 3JAEA 2XQ8A 5HCMA 2WNJA 5CFBA 4ZK1A 2VL0A 4A98A 2WN9A 5FJVA 4IREA 3WTKA 4COFA 4ILCA 4ZZBA 2PGZA 4TNVA 3UU5A 2YKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X00 A;  2BYQ A;  2PH9 A;  3C79 A;  5L4H A;  4TWF A;  3UU6 A;  3GUA A;  4Z91 A;  3TLW A;  4HFC A;  3TLV A;  3UQ4 A;  2XNU A;  3ZDH A;  5J5F A;  1UX2 A;  2YOE A;  5LG3 A;  3U8M A;  4Z90 A;  4XHE A;  4QAB A;  4PIR A;  3SH1 A;  1UW6 A;  2BG9 B;  2W8G A;  5HCJ A;  3TLU A;  4UY2 A;  2Y57 A;  3RHW A;  3EHZ A;  3RI5 A;  4AFH A;  4LMK A;  4QAC A;  5J5H A;  5BW2 A;  2XQ7 A;  4LML A;  3RIA A;  3SIO A;  2QC1 B;  2XNV A;  5SYO A;  2XYS A;  5L47 A;  5CO5 A;  2BYR A;  4QAA A;  5KZU A;  4XK9 A;  4HFD A;  2XZ6 A;  3PEO A;  3EI0 A;  4UM1 A;  4HFE A;  5AFM A;  5BRX A;  3U8N A;  4NPP A;  4IL9 A;  2XYT A;  2BYN A;  1UV6 A;  4HFH A;  4QH1 A;  4TWD A;  4QH5 A;  2ZJV A;  5TVC A;  3WTI A;  4EZ1 A;  5AIN A;  4TNW A;  2BG9 C;  3ZKR A;  3JAF A;  2XQ6 A;  5J5G A;  3UQ7 A;  3TLT A;  2BR7 A;  5AFH A;  5HEG A;  2W8F A;  5AFK A;  2Y56 A;  4NZB A;  4AFT A;  3C84 A;  1I9B A;  4DBM A;  3EAM A;  5HEJ A;  5IUX A;  4HFI A;  2XQ5 A;  4LMJ A;  5AFN A;  2YME A;  4QH4 A;  4ZZC A;  3UU4 A;  3IGQ A;  3WIP A;  2BYS A;  2Y7Y A;  3LSV A;  4ZK4 A;  4TWH A;  4ILB A;  4F8H A;  2XNT A;  5LXB A;  2WNL A;  2Y58 A;  2BG9 E;  5HEO A;  3SQ6 A;  3TLS A;  3U8J A;  4ALX A;  4ZJS A;  2WZY A;  3P50 A;  4HFB A;  2XQA A;  3UUB A;  2C9T A;  4ILA A;  3U8K A;  3JAD A;  2XQ4 A;  5AFJ A;  5BP0 A;  2YMD A;  4UM3 P;  2UZ6 A;  5AFL A;  4BQT A;  2BR8 A;  3U8L A;  3WTO A;  2XQ3 A;  5JME A;  2X00 D;  3RQU A;  5J5I A;  4ZRU A;  2BJ0 A;  4WV9 A;  4FRR A;  3WTJ A;  2YN6 A;  3WTN A;  3WTH A;  4D01 A;  3RQW A;  2BG9 A;  4AFG A;  3WTL A;  2ZJU A;  3SQ9 A;  3P4W A;  4UM3 A;  2XZ5 A;  3RIF A;  3T4M A;  2Y54 A;  3WTM A;  5KE4 A;  4X5T A;  2WNC A;  5HEU A;  4A97 A;  4UXU A;  5HEH A;  3ZDG A;  4ZJT A;  2BYP A;  4IL4 A;  2XQ9 A;  3UU8 A;  4BFQ A;  5AFM B;  5L4E A;  5J0Z A;  4ZR6 A;  3PMZ A;  4B5D A;  3UU3 A;  4UM3 S;  4HQP A;  3JAE A;  2XQ8 A;  5HCM A;  2WNJ A;  5CFB A;  4ZK1 A;  2VL0 A;  4A98 A;  2WN9 A;  5FJV A;  4IRE A;  3WTK A;  4COF A;  4ILC A;  4ZZB A;  2PGZ A;  4TNV A;  3UU5 A;  2YKS A; 
#chains in the Genus database with same CATH topology
 2X00 A;  2BYQ A;  2PH9 A;  3C79 A;  5L4H A;  4TWF A;  3UU6 A;  3GUA A;  4Z91 A;  3TLW A;  4HFC A;  3TLV A;  3UQ4 A;  2XNU A;  3ZDH A;  5J5F A;  1UX2 A;  2YOE A;  5LG3 A;  3U8M A;  4Z90 A;  4XHE A;  4QAB A;  4PIR A;  3SH1 A;  1UW6 A;  2BG9 B;  2W8G A;  5HCJ A;  3TLU A;  4UY2 A;  2Y57 A;  3RHW A;  3EHZ A;  3RI5 A;  4AFH A;  4LMK A;  4QAC A;  5J5H A;  5BW2 A;  2XQ7 A;  4LML A;  3RIA A;  3SIO A;  2QC1 B;  2XNV A;  5SYO A;  2XYS A;  5L47 A;  5CO5 A;  2BYR A;  4QAA A;  5KZU A;  4XK9 A;  4HFD A;  2XZ6 A;  3PEO A;  3EI0 A;  4UM1 A;  4HFE A;  5AFM A;  5BRX A;  3U8N A;  4NPP A;  4IL9 A;  2XYT A;  2BYN A;  1UV6 A;  4HFH A;  4QH1 A;  4TWD A;  4QH5 A;  2ZJV A;  5TVC A;  3WTI A;  4EZ1 A;  5AIN A;  4TNW A;  2BG9 C;  3ZKR A;  3JAF A;  2XQ6 A;  5J5G A;  3UQ7 A;  3TLT A;  2BR7 A;  5AFH A;  5HEG A;  2W8F A;  5AFK A;  2Y56 A;  4NZB A;  4AFT A;  3C84 A;  1I9B A;  4DBM A;  3EAM A;  5HEJ A;  5IUX A;  4HFI A;  2XQ5 A;  4LMJ A;  5AFN A;  2YME A;  4QH4 A;  4ZZC A;  3UU4 A;  3IGQ A;  3WIP A;  2BYS A;  2Y7Y A;  3LSV A;  4ZK4 A;  4TWH A;  4ILB A;  4F8H A;  2XNT A;  5LXB A;  2WNL A;  2Y58 A;  2BG9 E;  5HEO A;  3SQ6 A;  3TLS A;  3U8J A;  4ALX A;  4ZJS A;  2WZY A;  3P50 A;  4HFB A;  2XQA A;  3UUB A;  2C9T A;  4ILA A;  3U8K A;  3JAD A;  2XQ4 A;  5AFJ A;  5BP0 A;  2YMD A;  4UM3 P;  2UZ6 A;  5AFL A;  4BQT A;  2BR8 A;  3U8L A;  3WTO A;  2XQ3 A;  5JME A;  2X00 D;  3RQU A;  5J5I A;  4ZRU A;  2BJ0 A;  4WV9 A;  4FRR A;  3WTJ A;  2YN6 A;  3WTN A;  3WTH A;  4D01 A;  3RQW A;  2BG9 A;  4AFG A;  3WTL A;  2ZJU A;  3SQ9 A;  3P4W A;  4UM3 A;  2XZ5 A;  3RIF A;  3T4M A;  2Y54 A;  3WTM A;  5KE4 A;  4X5T A;  2WNC A;  5HEU A;  4A97 A;  4UXU A;  5HEH A;  3ZDG A;  4ZJT A;  2BYP A;  4IL4 A;  2XQ9 A;  3UU8 A;  4BFQ A;  5AFM B;  5L4E A;  5J0Z A;  4ZR6 A;  3PMZ A;  4B5D A;  3UU3 A;  4UM3 S;  4HQP A;  3JAE A;  2XQ8 A;  5HCM A;  2WNJ A;  5CFB A;  4ZK1 A;  2VL0 A;  4A98 A;  2WN9 A;  5FJV A;  4IRE A;  3WTK A;  4COF A;  4ILC A;  4ZZB A;  2PGZ A;  4TNV A;  3UU5 A;  2YKS A; 
#chains in the Genus database with same CATH homology
 2X00 A;  2BYQ A;  2PH9 A;  3C79 A;  5L4H A;  4TWF A;  3UU6 A;  3GUA A;  4Z91 A;  3TLW A;  4HFC A;  3TLV A;  3UQ4 A;  2XNU A;  3ZDH A;  5J5F A;  1UX2 A;  2YOE A;  5LG3 A;  3U8M A;  4Z90 A;  4XHE A;  4QAB A;  4PIR A;  3SH1 A;  1UW6 A;  2BG9 B;  2W8G A;  5HCJ A;  3TLU A;  4UY2 A;  2Y57 A;  3RHW A;  3EHZ A;  3RI5 A;  4AFH A;  4LMK A;  4QAC A;  5J5H A;  5BW2 A;  2XQ7 A;  4LML A;  3RIA A;  3SIO A;  2QC1 B;  2XNV A;  5SYO A;  2XYS A;  5L47 A;  5CO5 A;  2BYR A;  4QAA A;  5KZU A;  4XK9 A;  4HFD A;  2XZ6 A;  3PEO A;  3EI0 A;  4UM1 A;  4HFE A;  5AFM A;  5BRX A;  3U8N A;  4NPP A;  4IL9 A;  2XYT A;  2BYN A;  1UV6 A;  4HFH A;  4QH1 A;  4TWD A;  4QH5 A;  2ZJV A;  5TVC A;  3WTI A;  4EZ1 A;  5AIN A;  4TNW A;  2BG9 C;  3ZKR A;  3JAF A;  2XQ6 A;  5J5G A;  3UQ7 A;  3TLT A;  2BR7 A;  5AFH A;  5HEG A;  2W8F A;  5AFK A;  2Y56 A;  4NZB A;  4AFT A;  3C84 A;  1I9B A;  4DBM A;  3EAM A;  5HEJ A;  5IUX A;  4HFI A;  2XQ5 A;  4LMJ A;  5AFN A;  2YME A;  4QH4 A;  4ZZC A;  3UU4 A;  3IGQ A;  3WIP A;  2BYS A;  2Y7Y A;  3LSV A;  4ZK4 A;  4TWH A;  4ILB A;  4F8H A;  2XNT A;  5LXB A;  2WNL A;  2Y58 A;  2BG9 E;  5HEO A;  3SQ6 A;  3TLS A;  3U8J A;  4ALX A;  4ZJS A;  2WZY A;  3P50 A;  4HFB A;  2XQA A;  3UUB A;  2C9T A;  4ILA A;  3U8K A;  3JAD A;  2XQ4 A;  5AFJ A;  5BP0 A;  2YMD A;  4UM3 P;  2UZ6 A;  5AFL A;  4BQT A;  2BR8 A;  3U8L A;  3WTO A;  2XQ3 A;  5JME A;  2X00 D;  3RQU A;  5J5I A;  4ZRU A;  2BJ0 A;  4WV9 A;  4FRR A;  3WTJ A;  2YN6 A;  3WTN A;  3WTH A;  4D01 A;  3RQW A;  2BG9 A;  4AFG A;  3WTL A;  2ZJU A;  3SQ9 A;  3P4W A;  4UM3 A;  2XZ5 A;  3RIF A;  3T4M A;  2Y54 A;  3WTM A;  5KE4 A;  4X5T A;  2WNC A;  5HEU A;  4A97 A;  4UXU A;  5HEH A;  3ZDG A;  4ZJT A;  2BYP A;  4IL4 A;  2XQ9 A;  3UU8 A;  4BFQ A;  5AFM B;  5L4E A;  5J0Z A;  4ZR6 A;  3PMZ A;  4B5D A;  3UU3 A;  4UM3 S;  4HQP A;  3JAE A;  2XQ8 A;  5HCM A;  2WNJ A;  5CFB A;  4ZK1 A;  2VL0 A;  4A98 A;  2WN9 A;  5FJV A;  4IRE A;  3WTK A;  4COF A;  4ILC A;  4ZZB A;  2PGZ A;  4TNV A;  3UU5 A;  2YKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...