5J5FA

X-ray crystal structure of acetylcholine binding protein (achbp) in complex with n4,n4-bis[(pyridin-2-yl)methyl]-6-(thiophen-3-yl)pyrimidine-2,4-diamine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
212
structure length
212
Chain Sequence
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein
molecule keywords Acetylcholine-binding protein
publication title Substituted 2-Aminopyrimidines Selective for alpha 7-Nicotinic Acetylcholine Receptor Activation and Association with Acetylcholine Binding Proteins.
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 57
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j5fA00
3TLVA 4HFHA 3UQ7A 4X5TA 3UQ4A 2BR7A 3RI5A 2XQ9A 4TWHA 4UM3A 5BW2A 4A97A 2XQ6A 2Y56A 4A98A 4ZR6A 5FJVA 3TLWA 4D01A 3U8JA 4DBMA 5HEJA 5J5GA 5HCJA 5BRXA 4AFGA 4NZBA 4HQPA 3UU6A 2C9TA 2WZYA 3IGQA 2X00D 2PH9A 3TLSA 5L4HA 3U8LA 2XQ3A 4HFBA 4LMKA 2PGZA 2Y54A 3JAFA 5HCMA 4TWFA 3U8KA 4ZZBA 4IL9A 3WTKA 3RIFA 5AFLA 2BG9A 1UW6A 2XYSA 3WTJA 2XQ5A 2BG9B 4EZ1A 3TLTA 4HFEA 4ALXA 3JADA 4ILBA 4UM3P 4ZJSA 4HFCA 4UY2A 4FRRA 2X00A 5AINA 4QH4A 3JAEA 5TVCA 4UM1A 5HEGA 5JMEA 2YMDA 4TNVA 4BQTA 5J5HA 2BYNA 2BJ0A 3EI0A 4ZK4A 3UU3A 3C79A 5HEOA 5LXBA 4AFHA 2XQ4A 5HEUA 4HFDA 4NPPA 2XNTA 2W8FA 4QABA 4UXUA 3UUBA 5HEHA 5L4EA 4Z91A 3WTOA 3P50A 3T4MA 3C84A 2YOEA 2BR8A 3RHWA 4IREA 2YKSA 5KZUA 3WIPA 3PMZA 4XK9A 3EAMA 3SIOA 1I9BA 3ZDHA 5IUXA 4QACA 1UV6A 5AFHA 2ZJUA 2UZ6A 2BG9E 2BYQA 2QC1B 3WTLA 5AFKA 4BFQA 2BYRA 5AFMA 5CFBA 2W8GA 5CO5A 5KE4A 3SH1A 2ZJVA 3P4WA 4TWDA 3WTNA 5AFMB 4ILCA 4QH5A 3SQ9A 3UU4A 4IL4A 2Y58A 5AFNA 2WNJA 2XQ7A 3PEOA 2VL0A 5J5IA 4LMJA 4UM3S 2Y57A 4PIRA 3ZKRA 2WNCA 2YMEA 4QAAA 5J0ZA 2WN9A 3UU5A 4Z90A 3U8MA 3WTIA 4ZZCA 2BG9C 4TNWA 2BYSA 2XQ8A 3WTHA 3ZDGA 4LMLA 4QH1A 4AFTA 1UX2A 4ZRUA 3RQUA 3RQWA 2WNLA 2XYTA 2XNVA 5BP0A 3GUAA 4WV9A 5SYOA 2YN6A 3WTMA 2Y7YA 3LSVA 4ZK1A 4COFA 3SQ6A 5AFJA 2XNUA 4ILAA 5L47A 2XQAA 2BYPA 3UU8A 5J5FA 3TLUA 4ZJTA 3RIAA 3U8NA 2XZ5A 3EHZA 4F8HA 4B5DA 5LG3A 4XHEA 4HFIA 2XZ6A
chains in the Genus database with same CATH superfamily
3TLVA 4HFHA 3UQ7A 4X5TA 3UQ4A 2BR7A 3RI5A 2XQ9A 4TWHA 4UM3A 5BW2A 4A97A 2XQ6A 2Y56A 4A98A 4ZR6A 5FJVA 3TLWA 4D01A 3U8JA 4DBMA 5HEJA 5J5GA 5HCJA 5BRXA 4AFGA 4NZBA 4HQPA 3UU6A 2C9TA 2WZYA 3IGQA 2X00D 2PH9A 3TLSA 5L4HA 3U8LA 2XQ3A 4HFBA 4LMKA 2PGZA 2Y54A 3JAFA 5HCMA 4TWFA 3U8KA 4ZZBA 4IL9A 3WTKA 3RIFA 5AFLA 2BG9A 1UW6A 2XYSA 3WTJA 2XQ5A 2BG9B 4EZ1A 3TLTA 4HFEA 4ALXA 3JADA 4ILBA 4UM3P 4ZJSA 4HFCA 4UY2A 4FRRA 2X00A 5AINA 4QH4A 3JAEA 5TVCA 4UM1A 5HEGA 5JMEA 2YMDA 4TNVA 4BQTA 5J5HA 2BYNA 2BJ0A 3EI0A 4ZK4A 3UU3A 3C79A 5HEOA 5LXBA 4AFHA 2XQ4A 5HEUA 4HFDA 4NPPA 2XNTA 2W8FA 4QABA 4UXUA 3UUBA 5HEHA 5L4EA 4Z91A 3WTOA 3P50A 3T4MA 3C84A 2YOEA 2BR8A 3RHWA 4IREA 2YKSA 5KZUA 3WIPA 3PMZA 4XK9A 3EAMA 3SIOA 1I9BA 3ZDHA 5IUXA 4QACA 1UV6A 5AFHA 2ZJUA 2UZ6A 2BG9E 2BYQA 2QC1B 3WTLA 5AFKA 4BFQA 2BYRA 5AFMA 5CFBA 2W8GA 5CO5A 5KE4A 3SH1A 2ZJVA 3P4WA 4TWDA 3WTNA 5AFMB 4ILCA 4QH5A 3SQ9A 3UU4A 4IL4A 2Y58A 5AFNA 2WNJA 2XQ7A 3PEOA 2VL0A 5J5IA 4LMJA 4UM3S 2Y57A 4PIRA 3ZKRA 2WNCA 2YMEA 4QAAA 5J0ZA 2WN9A 3UU5A 4Z90A 3U8MA 3WTIA 4ZZCA 2BG9C 4TNWA 2BYSA 2XQ8A 3WTHA 3ZDGA 4LMLA 4QH1A 4AFTA 1UX2A 4ZRUA 3RQUA 3RQWA 2WNLA 2XYTA 2XNVA 5BP0A 3GUAA 4WV9A 5SYOA 2YN6A 3WTMA 2Y7YA 3LSVA 4ZK1A 4COFA 3SQ6A 5AFJA 2XNUA 4ILAA 5L47A 2XQAA 2BYPA 3UU8A 5J5FA 3TLUA 4ZJTA 3RIAA 3U8NA 2XZ5A 3EHZA 4F8HA 4B5DA 5LG3A 4XHEA 4HFIA 2XZ6A
chains in the Genus database with same CATH topology
3TLVA 4HFHA 3UQ7A 4X5TA 3UQ4A 2BR7A 3RI5A 2XQ9A 4TWHA 4UM3A 5BW2A 4A97A 2XQ6A 2Y56A 4A98A 4ZR6A 5FJVA 3TLWA 4D01A 3U8JA 4DBMA 5HEJA 5J5GA 5HCJA 5BRXA 4AFGA 4NZBA 4HQPA 3UU6A 2C9TA 2WZYA 3IGQA 2X00D 2PH9A 3TLSA 5L4HA 3U8LA 2XQ3A 4HFBA 4LMKA 2PGZA 2Y54A 3JAFA 5HCMA 4TWFA 3U8KA 4ZZBA 4IL9A 3WTKA 3RIFA 5AFLA 2BG9A 1UW6A 2XYSA 3WTJA 2XQ5A 2BG9B 4EZ1A 3TLTA 4HFEA 4ALXA 3JADA 4ILBA 4UM3P 4ZJSA 4HFCA 4UY2A 4FRRA 2X00A 5AINA 4QH4A 3JAEA 5TVCA 4UM1A 5HEGA 5JMEA 2YMDA 4TNVA 4BQTA 5J5HA 2BYNA 2BJ0A 3EI0A 4ZK4A 3UU3A 3C79A 5HEOA 5LXBA 4AFHA 2XQ4A 5HEUA 4HFDA 4NPPA 2XNTA 2W8FA 4QABA 4UXUA 3UUBA 5HEHA 5L4EA 4Z91A 3WTOA 3P50A 3T4MA 3C84A 2YOEA 2BR8A 3RHWA 4IREA 2YKSA 5KZUA 3WIPA 3PMZA 4XK9A 3EAMA 3SIOA 1I9BA 3ZDHA 5IUXA 4QACA 1UV6A 5AFHA 2ZJUA 2UZ6A 2BG9E 2BYQA 2QC1B 3WTLA 5AFKA 4BFQA 2BYRA 5AFMA 5CFBA 2W8GA 5CO5A 5KE4A 3SH1A 2ZJVA 3P4WA 4TWDA 3WTNA 5AFMB 4ILCA 4QH5A 3SQ9A 3UU4A 4IL4A 2Y58A 5AFNA 2WNJA 2XQ7A 3PEOA 2VL0A 5J5IA 4LMJA 4UM3S 2Y57A 4PIRA 3ZKRA 2WNCA 2YMEA 4QAAA 5J0ZA 2WN9A 3UU5A 4Z90A 3U8MA 3WTIA 4ZZCA 2BG9C 4TNWA 2BYSA 2XQ8A 3WTHA 3ZDGA 4LMLA 4QH1A 4AFTA 1UX2A 4ZRUA 3RQUA 3RQWA 2WNLA 2XYTA 2XNVA 5BP0A 3GUAA 4WV9A 5SYOA 2YN6A 3WTMA 2Y7YA 3LSVA 4ZK1A 4COFA 3SQ6A 5AFJA 2XNUA 4ILAA 5L47A 2XQAA 2BYPA 3UU8A 5J5FA 3TLUA 4ZJTA 3RIAA 3U8NA 2XZ5A 3EHZA 4F8HA 4B5DA 5LG3A 4XHEA 4HFIA 2XZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLV A;  4HFH A;  3UQ7 A;  4X5T A;  3UQ4 A;  2BR7 A;  3RI5 A;  2XQ9 A;  4TWH A;  4UM3 A;  5BW2 A;  4A97 A;  2XQ6 A;  2Y56 A;  4A98 A;  4ZR6 A;  5FJV A;  3TLW A;  4D01 A;  3U8J A;  4DBM A;  5HEJ A;  5J5G A;  5HCJ A;  5BRX A;  4AFG A;  4NZB A;  4HQP A;  3UU6 A;  2C9T A;  2WZY A;  3IGQ A;  2X00 D;  2PH9 A;  3TLS A;  5L4H A;  3U8L A;  2XQ3 A;  4HFB A;  4LMK A;  2PGZ A;  2Y54 A;  3JAF A;  5HCM A;  4TWF A;  3U8K A;  4ZZB A;  4IL9 A;  3WTK A;  3RIF A;  5AFL A;  2BG9 A;  1UW6 A;  2XYS A;  3WTJ A;  2XQ5 A;  2BG9 B;  4EZ1 A;  3TLT A;  4HFE A;  4ALX A;  3JAD A;  4ILB A;  4UM3 P;  4ZJS A;  4HFC A;  4UY2 A;  4FRR A;  2X00 A;  5AIN A;  4QH4 A;  3JAE A;  5TVC A;  4UM1 A;  5HEG A;  5JME A;  2YMD A;  4TNV A;  4BQT A;  5J5H A;  2BYN A;  2BJ0 A;  3EI0 A;  4ZK4 A;  3UU3 A;  3C79 A;  5HEO A;  5LXB A;  4AFH A;  2XQ4 A;  5HEU A;  4HFD A;  4NPP A;  2XNT A;  2W8F A;  4QAB A;  4UXU A;  3UUB A;  5HEH A;  5L4E A;  4Z91 A;  3WTO A;  3P50 A;  3T4M A;  3C84 A;  2YOE A;  2BR8 A;  3RHW A;  4IRE A;  2YKS A;  5KZU A;  3WIP A;  3PMZ A;  4XK9 A;  3EAM A;  3SIO A;  1I9B A;  3ZDH A;  5IUX A;  4QAC A;  1UV6 A;  5AFH A;  2ZJU A;  2UZ6 A;  2BG9 E;  2BYQ A;  2QC1 B;  3WTL A;  5AFK A;  4BFQ A;  2BYR A;  5AFM A;  5CFB A;  2W8G A;  5CO5 A;  5KE4 A;  3SH1 A;  2ZJV A;  3P4W A;  4TWD A;  3WTN A;  5AFM B;  4ILC A;  4QH5 A;  3SQ9 A;  3UU4 A;  4IL4 A;  2Y58 A;  5AFN A;  2WNJ A;  2XQ7 A;  3PEO A;  2VL0 A;  5J5I A;  4LMJ A;  4UM3 S;  2Y57 A;  4PIR A;  3ZKR A;  2WNC A;  2YME A;  4QAA A;  5J0Z A;  2WN9 A;  3UU5 A;  4Z90 A;  3U8M A;  3WTI A;  4ZZC A;  2BG9 C;  4TNW A;  2BYS A;  2XQ8 A;  3WTH A;  3ZDG A;  4LML A;  4QH1 A;  4AFT A;  1UX2 A;  4ZRU A;  3RQU A;  3RQW A;  2WNL A;  2XYT A;  2XNV A;  5BP0 A;  3GUA A;  4WV9 A;  5SYO A;  2YN6 A;  3WTM A;  2Y7Y A;  3LSV A;  4ZK1 A;  4COF A;  3SQ6 A;  5AFJ A;  2XNU A;  4ILA A;  5L47 A;  2XQA A;  2BYP A;  3UU8 A;  5J5F A;  3TLU A;  4ZJT A;  3RIA A;  3U8N A;  2XZ5 A;  3EHZ A;  4F8H A;  4B5D A;  5LG3 A;  4XHE A;  4HFI A;  2XZ6 A; 
#chains in the Genus database with same CATH topology
 3TLV A;  4HFH A;  3UQ7 A;  4X5T A;  3UQ4 A;  2BR7 A;  3RI5 A;  2XQ9 A;  4TWH A;  4UM3 A;  5BW2 A;  4A97 A;  2XQ6 A;  2Y56 A;  4A98 A;  4ZR6 A;  5FJV A;  3TLW A;  4D01 A;  3U8J A;  4DBM A;  5HEJ A;  5J5G A;  5HCJ A;  5BRX A;  4AFG A;  4NZB A;  4HQP A;  3UU6 A;  2C9T A;  2WZY A;  3IGQ A;  2X00 D;  2PH9 A;  3TLS A;  5L4H A;  3U8L A;  2XQ3 A;  4HFB A;  4LMK A;  2PGZ A;  2Y54 A;  3JAF A;  5HCM A;  4TWF A;  3U8K A;  4ZZB A;  4IL9 A;  3WTK A;  3RIF A;  5AFL A;  2BG9 A;  1UW6 A;  2XYS A;  3WTJ A;  2XQ5 A;  2BG9 B;  4EZ1 A;  3TLT A;  4HFE A;  4ALX A;  3JAD A;  4ILB A;  4UM3 P;  4ZJS A;  4HFC A;  4UY2 A;  4FRR A;  2X00 A;  5AIN A;  4QH4 A;  3JAE A;  5TVC A;  4UM1 A;  5HEG A;  5JME A;  2YMD A;  4TNV A;  4BQT A;  5J5H A;  2BYN A;  2BJ0 A;  3EI0 A;  4ZK4 A;  3UU3 A;  3C79 A;  5HEO A;  5LXB A;  4AFH A;  2XQ4 A;  5HEU A;  4HFD A;  4NPP A;  2XNT A;  2W8F A;  4QAB A;  4UXU A;  3UUB A;  5HEH A;  5L4E A;  4Z91 A;  3WTO A;  3P50 A;  3T4M A;  3C84 A;  2YOE A;  2BR8 A;  3RHW A;  4IRE A;  2YKS A;  5KZU A;  3WIP A;  3PMZ A;  4XK9 A;  3EAM A;  3SIO A;  1I9B A;  3ZDH A;  5IUX A;  4QAC A;  1UV6 A;  5AFH A;  2ZJU A;  2UZ6 A;  2BG9 E;  2BYQ A;  2QC1 B;  3WTL A;  5AFK A;  4BFQ A;  2BYR A;  5AFM A;  5CFB A;  2W8G A;  5CO5 A;  5KE4 A;  3SH1 A;  2ZJV A;  3P4W A;  4TWD A;  3WTN A;  5AFM B;  4ILC A;  4QH5 A;  3SQ9 A;  3UU4 A;  4IL4 A;  2Y58 A;  5AFN A;  2WNJ A;  2XQ7 A;  3PEO A;  2VL0 A;  5J5I A;  4LMJ A;  4UM3 S;  2Y57 A;  4PIR A;  3ZKR A;  2WNC A;  2YME A;  4QAA A;  5J0Z A;  2WN9 A;  3UU5 A;  4Z90 A;  3U8M A;  3WTI A;  4ZZC A;  2BG9 C;  4TNW A;  2BYS A;  2XQ8 A;  3WTH A;  3ZDG A;  4LML A;  4QH1 A;  4AFT A;  1UX2 A;  4ZRU A;  3RQU A;  3RQW A;  2WNL A;  2XYT A;  2XNV A;  5BP0 A;  3GUA A;  4WV9 A;  5SYO A;  2YN6 A;  3WTM A;  2Y7Y A;  3LSV A;  4ZK1 A;  4COF A;  3SQ6 A;  5AFJ A;  2XNU A;  4ILA A;  5L47 A;  2XQA A;  2BYP A;  3UU8 A;  5J5F A;  3TLU A;  4ZJT A;  3RIA A;  3U8N A;  2XZ5 A;  3EHZ A;  4F8H A;  4B5D A;  5LG3 A;  4XHE A;  4HFI A;  2XZ6 A; 
#chains in the Genus database with same CATH homology
 3TLV A;  4HFH A;  3UQ7 A;  4X5T A;  3UQ4 A;  2BR7 A;  3RI5 A;  2XQ9 A;  4TWH A;  4UM3 A;  5BW2 A;  4A97 A;  2XQ6 A;  2Y56 A;  4A98 A;  4ZR6 A;  5FJV A;  3TLW A;  4D01 A;  3U8J A;  4DBM A;  5HEJ A;  5J5G A;  5HCJ A;  5BRX A;  4AFG A;  4NZB A;  4HQP A;  3UU6 A;  2C9T A;  2WZY A;  3IGQ A;  2X00 D;  2PH9 A;  3TLS A;  5L4H A;  3U8L A;  2XQ3 A;  4HFB A;  4LMK A;  2PGZ A;  2Y54 A;  3JAF A;  5HCM A;  4TWF A;  3U8K A;  4ZZB A;  4IL9 A;  3WTK A;  3RIF A;  5AFL A;  2BG9 A;  1UW6 A;  2XYS A;  3WTJ A;  2XQ5 A;  2BG9 B;  4EZ1 A;  3TLT A;  4HFE A;  4ALX A;  3JAD A;  4ILB A;  4UM3 P;  4ZJS A;  4HFC A;  4UY2 A;  4FRR A;  2X00 A;  5AIN A;  4QH4 A;  3JAE A;  5TVC A;  4UM1 A;  5HEG A;  5JME A;  2YMD A;  4TNV A;  4BQT A;  5J5H A;  2BYN A;  2BJ0 A;  3EI0 A;  4ZK4 A;  3UU3 A;  3C79 A;  5HEO A;  5LXB A;  4AFH A;  2XQ4 A;  5HEU A;  4HFD A;  4NPP A;  2XNT A;  2W8F A;  4QAB A;  4UXU A;  3UUB A;  5HEH A;  5L4E A;  4Z91 A;  3WTO A;  3P50 A;  3T4M A;  3C84 A;  2YOE A;  2BR8 A;  3RHW A;  4IRE A;  2YKS A;  5KZU A;  3WIP A;  3PMZ A;  4XK9 A;  3EAM A;  3SIO A;  1I9B A;  3ZDH A;  5IUX A;  4QAC A;  1UV6 A;  5AFH A;  2ZJU A;  2UZ6 A;  2BG9 E;  2BYQ A;  2QC1 B;  3WTL A;  5AFK A;  4BFQ A;  2BYR A;  5AFM A;  5CFB A;  2W8G A;  5CO5 A;  5KE4 A;  3SH1 A;  2ZJV A;  3P4W A;  4TWD A;  3WTN A;  5AFM B;  4ILC A;  4QH5 A;  3SQ9 A;  3UU4 A;  4IL4 A;  2Y58 A;  5AFN A;  2WNJ A;  2XQ7 A;  3PEO A;  2VL0 A;  5J5I A;  4LMJ A;  4UM3 S;  2Y57 A;  4PIR A;  3ZKR A;  2WNC A;  2YME A;  4QAA A;  5J0Z A;  2WN9 A;  3UU5 A;  4Z90 A;  3U8M A;  3WTI A;  4ZZC A;  2BG9 C;  4TNW A;  2BYS A;  2XQ8 A;  3WTH A;  3ZDG A;  4LML A;  4QH1 A;  4AFT A;  1UX2 A;  4ZRU A;  3RQU A;  3RQW A;  2WNL A;  2XYT A;  2XNV A;  5BP0 A;  3GUA A;  4WV9 A;  5SYO A;  2YN6 A;  3WTM A;  2Y7Y A;  3LSV A;  4ZK1 A;  4COF A;  3SQ6 A;  5AFJ A;  2XNU A;  4ILA A;  5L47 A;  2XQA A;  2BYP A;  3UU8 A;  5J5F A;  3TLU A;  4ZJT A;  3RIA A;  3U8N A;  2XZ5 A;  3EHZ A;  4F8H A;  4B5D A;  5LG3 A;  4XHE A;  4HFI A;  2XZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...