5J5FA

X-ray crystal structure of acetylcholine binding protein (achbp) in complex with n4,n4-bis[(pyridin-2-yl)methyl]-6-(thiophen-3-yl)pyrimidine-2,4-diamine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
212
structure length
212
Chain Sequence
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Substituted 2-Aminopyrimidines Selective for alpha 7-Nicotinic Acetylcholine Receptor Activation and Association with Acetylcholine Binding Proteins.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein
total genus 57
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j5fA00
4UM3S 4QAAA 4NZBA 2XNTA 5AFHA 2BYSA 3T4MA 4A97A 2W8GA 3RQWA 2WN9A 3RQUA 3UUBA 3WTMA 4ILCA 2BYPA 4BQTA 5AFMA 2XYSA 4HFCA 4B5DA 2YMDA 5LXBA 4TNVA 5AFLA 2W8FA 4HFBA 2BG9E 4UM1A 4ILAA 3UU5A 2Y54A 3JAFA 5LG3A 2XQ5A 4QH4A 3ZDHA 5SYOA 4D01A 4XK9A 3JADA 3UU3A 2WNCA 2VL0A 2WNLA 3TLUA 4BFQA 4COFA 2XZ6A 4TNWA 3SIOA 5IUXA 2PGZA 4HFEA 3TLSA 3TLTA 5AFMB 3U8LA 4UM3A 2XQ3A 2PH9A 4A98A 2BG9A 2WNJA 3PMZA 5AFJA 3SQ6A 4TWFA 5HCMA 3ZKRA 4F8HA 5J5HA 3WTHA 3EI0A 3TLWA 3WIPA 3EHZA 4ZRUA 4LMKA 3PEOA 4Z90A 3C84A 3UU6A 5J0ZA 3GUAA 3RIFA 4HFIA 2BYNA 4UXUA 5CFBA 2XNUA 4ZZBA 4QH5A 5FJVA 5JMEA 2XQ6A 2UZ6A 4QH1A 3RHWA 5L4EA 5CO5A 2Y56A 5J5GA 4AFTA 3RI5A 4ZK4A 2BG9B 3TLVA 3WTNA 5HEGA 2BR8A 5J5IA 2YMEA 5KZUA 5BP0A 2XQ7A 5BRXA 3SH1A 3ZDGA 3P4WA 5AINA 4IREA 4HQPA 2XQ4A 2YN6A 1UX2A 4ILBA 3U8MA 2YOEA 5AFKA 4WV9A 3WTLA 2BR7A 5TVCA 4UM3P 3IGQA 1UV6A 3U8NA 3P50A 1I9BA 2Y7YA 2XQ8A 3EAMA 4IL9A 3U8KA 2X00A 5HEUA 4ZJSA 2Y58A 3RIAA 3WTIA 2Y57A 3C79A 5KE4A 4QACA 4AFGA 4IL4A 2WZYA 4LMJA 5L47A 4LMLA 5HCJA 2XQAA 5AFNA 4AFHA 4HFHA 5HEOA 3UU8A 4X5TA 3WTOA 2YKSA 3UQ7A 4NPPA 2XNVA 4ALXA 3LSVA 2BYRA 2ZJVA 5J5FA 3SQ9A 4PIRA 4TWDA 2BG9C 4DBMA 5HEJA 2ZJUA 3WTKA 3UQ4A 5HEHA 4ZJTA 2XQ9A 4XHEA 3UU4A 4UY2A 2XZ5A 5L4HA 2X00D 3JAEA 2BJ0A 4QABA 4ZZCA 5BW2A 4Z91A 3WTJA 1UW6A 4ZK1A 2C9TA 2XYTA 3U8JA 4HFDA 4TWHA 4ZR6A 4EZ1A 2QC1B 2BYQA 4FRRA
chains in the Genus database with same CATH superfamily
4UM3S 4QAAA 4NZBA 2XNTA 5AFHA 2BYSA 3T4MA 4A97A 2W8GA 3RQWA 2WN9A 3RQUA 3UUBA 3WTMA 4ILCA 2BYPA 4BQTA 5AFMA 2XYSA 4HFCA 4B5DA 2YMDA 5LXBA 4TNVA 5AFLA 2W8FA 4HFBA 2BG9E 4UM1A 4ILAA 3UU5A 2Y54A 3JAFA 5LG3A 2XQ5A 4QH4A 3ZDHA 5SYOA 4D01A 4XK9A 3JADA 3UU3A 2WNCA 2VL0A 2WNLA 3TLUA 4BFQA 4COFA 2XZ6A 4TNWA 3SIOA 5IUXA 2PGZA 4HFEA 3TLSA 3TLTA 5AFMB 3U8LA 4UM3A 2XQ3A 2PH9A 4A98A 2BG9A 2WNJA 3PMZA 5AFJA 3SQ6A 4TWFA 5HCMA 3ZKRA 4F8HA 5J5HA 3WTHA 3EI0A 3TLWA 3WIPA 3EHZA 4ZRUA 4LMKA 3PEOA 4Z90A 3C84A 3UU6A 5J0ZA 3GUAA 3RIFA 4HFIA 2BYNA 4UXUA 5CFBA 2XNUA 4ZZBA 4QH5A 5FJVA 5JMEA 2XQ6A 2UZ6A 4QH1A 3RHWA 5L4EA 5CO5A 2Y56A 5J5GA 4AFTA 3RI5A 4ZK4A 2BG9B 3TLVA 3WTNA 5HEGA 2BR8A 5J5IA 2YMEA 5KZUA 5BP0A 2XQ7A 5BRXA 3SH1A 3ZDGA 3P4WA 5AINA 4IREA 4HQPA 2XQ4A 2YN6A 1UX2A 4ILBA 3U8MA 2YOEA 5AFKA 4WV9A 3WTLA 2BR7A 5TVCA 4UM3P 3IGQA 1UV6A 3U8NA 3P50A 1I9BA 2Y7YA 2XQ8A 3EAMA 4IL9A 3U8KA 2X00A 5HEUA 4ZJSA 2Y58A 3RIAA 3WTIA 2Y57A 3C79A 5KE4A 4QACA 4AFGA 4IL4A 2WZYA 4LMJA 5L47A 4LMLA 5HCJA 2XQAA 5AFNA 4AFHA 4HFHA 5HEOA 3UU8A 4X5TA 3WTOA 2YKSA 3UQ7A 4NPPA 2XNVA 4ALXA 3LSVA 2BYRA 2ZJVA 5J5FA 3SQ9A 4PIRA 4TWDA 2BG9C 4DBMA 5HEJA 2ZJUA 3WTKA 3UQ4A 5HEHA 4ZJTA 2XQ9A 4XHEA 3UU4A 4UY2A 2XZ5A 5L4HA 2X00D 3JAEA 2BJ0A 4QABA 4ZZCA 5BW2A 4Z91A 3WTJA 1UW6A 4ZK1A 2C9TA 2XYTA 3U8JA 4HFDA 4TWHA 4ZR6A 4EZ1A 2QC1B 2BYQA 4FRRA
chains in the Genus database with same CATH topology
4UM3S 4QAAA 4NZBA 2XNTA 5AFHA 2BYSA 3T4MA 4A97A 2W8GA 3RQWA 2WN9A 3RQUA 3UUBA 3WTMA 4ILCA 2BYPA 4BQTA 5AFMA 2XYSA 4HFCA 4B5DA 2YMDA 5LXBA 4TNVA 5AFLA 2W8FA 4HFBA 2BG9E 4UM1A 4ILAA 3UU5A 2Y54A 3JAFA 5LG3A 2XQ5A 4QH4A 3ZDHA 5SYOA 4D01A 4XK9A 3JADA 3UU3A 2WNCA 2VL0A 2WNLA 3TLUA 4BFQA 4COFA 2XZ6A 4TNWA 3SIOA 5IUXA 2PGZA 4HFEA 3TLSA 3TLTA 5AFMB 3U8LA 4UM3A 2XQ3A 2PH9A 4A98A 2BG9A 2WNJA 3PMZA 5AFJA 3SQ6A 4TWFA 5HCMA 3ZKRA 4F8HA 5J5HA 3WTHA 3EI0A 3TLWA 3WIPA 3EHZA 4ZRUA 4LMKA 3PEOA 4Z90A 3C84A 3UU6A 5J0ZA 3GUAA 3RIFA 4HFIA 2BYNA 4UXUA 5CFBA 2XNUA 4ZZBA 4QH5A 5FJVA 5JMEA 2XQ6A 2UZ6A 4QH1A 3RHWA 5L4EA 5CO5A 2Y56A 5J5GA 4AFTA 3RI5A 4ZK4A 2BG9B 3TLVA 3WTNA 5HEGA 2BR8A 5J5IA 2YMEA 5KZUA 5BP0A 2XQ7A 5BRXA 3SH1A 3ZDGA 3P4WA 5AINA 4IREA 4HQPA 2XQ4A 2YN6A 1UX2A 4ILBA 3U8MA 2YOEA 5AFKA 4WV9A 3WTLA 2BR7A 5TVCA 4UM3P 3IGQA 1UV6A 3U8NA 3P50A 1I9BA 2Y7YA 2XQ8A 3EAMA 4IL9A 3U8KA 2X00A 5HEUA 4ZJSA 2Y58A 3RIAA 3WTIA 2Y57A 3C79A 5KE4A 4QACA 4AFGA 4IL4A 2WZYA 4LMJA 5L47A 4LMLA 5HCJA 2XQAA 5AFNA 4AFHA 4HFHA 5HEOA 3UU8A 4X5TA 3WTOA 2YKSA 3UQ7A 4NPPA 2XNVA 4ALXA 3LSVA 2BYRA 2ZJVA 5J5FA 3SQ9A 4PIRA 4TWDA 2BG9C 4DBMA 5HEJA 2ZJUA 3WTKA 3UQ4A 5HEHA 4ZJTA 2XQ9A 4XHEA 3UU4A 4UY2A 2XZ5A 5L4HA 2X00D 3JAEA 2BJ0A 4QABA 4ZZCA 5BW2A 4Z91A 3WTJA 1UW6A 4ZK1A 2C9TA 2XYTA 3U8JA 4HFDA 4TWHA 4ZR6A 4EZ1A 2QC1B 2BYQA 4FRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UM3 S;  4QAA A;  4NZB A;  2XNT A;  5AFH A;  2BYS A;  3T4M A;  4A97 A;  2W8G A;  3RQW A;  2WN9 A;  3RQU A;  3UUB A;  3WTM A;  4ILC A;  2BYP A;  4BQT A;  5AFM A;  2XYS A;  4HFC A;  4B5D A;  2YMD A;  5LXB A;  4TNV A;  5AFL A;  2W8F A;  4HFB A;  2BG9 E;  4UM1 A;  4ILA A;  3UU5 A;  2Y54 A;  3JAF A;  5LG3 A;  2XQ5 A;  4QH4 A;  3ZDH A;  5SYO A;  4D01 A;  4XK9 A;  3JAD A;  3UU3 A;  2WNC A;  2VL0 A;  2WNL A;  3TLU A;  4BFQ A;  4COF A;  2XZ6 A;  4TNW A;  3SIO A;  5IUX A;  2PGZ A;  4HFE A;  3TLS A;  3TLT A;  5AFM B;  3U8L A;  4UM3 A;  2XQ3 A;  2PH9 A;  4A98 A;  2BG9 A;  2WNJ A;  3PMZ A;  5AFJ A;  3SQ6 A;  4TWF A;  5HCM A;  3ZKR A;  4F8H A;  5J5H A;  3WTH A;  3EI0 A;  3TLW A;  3WIP A;  3EHZ A;  4ZRU A;  4LMK A;  3PEO A;  4Z90 A;  3C84 A;  3UU6 A;  5J0Z A;  3GUA A;  3RIF A;  4HFI A;  2BYN A;  4UXU A;  5CFB A;  2XNU A;  4ZZB A;  4QH5 A;  5FJV A;  5JME A;  2XQ6 A;  2UZ6 A;  4QH1 A;  3RHW A;  5L4E A;  5CO5 A;  2Y56 A;  5J5G A;  4AFT A;  3RI5 A;  4ZK4 A;  2BG9 B;  3TLV A;  3WTN A;  5HEG A;  2BR8 A;  5J5I A;  2YME A;  5KZU A;  5BP0 A;  2XQ7 A;  5BRX A;  3SH1 A;  3ZDG A;  3P4W A;  5AIN A;  4IRE A;  4HQP A;  2XQ4 A;  2YN6 A;  1UX2 A;  4ILB A;  3U8M A;  2YOE A;  5AFK A;  4WV9 A;  3WTL A;  2BR7 A;  5TVC A;  4UM3 P;  3IGQ A;  1UV6 A;  3U8N A;  3P50 A;  1I9B A;  2Y7Y A;  2XQ8 A;  3EAM A;  4IL9 A;  3U8K A;  2X00 A;  5HEU A;  4ZJS A;  2Y58 A;  3RIA A;  3WTI A;  2Y57 A;  3C79 A;  5KE4 A;  4QAC A;  4AFG A;  4IL4 A;  2WZY A;  4LMJ A;  5L47 A;  4LML A;  5HCJ A;  2XQA A;  5AFN A;  4AFH A;  4HFH A;  5HEO A;  3UU8 A;  4X5T A;  3WTO A;  2YKS A;  3UQ7 A;  4NPP A;  2XNV A;  4ALX A;  3LSV A;  2BYR A;  2ZJV A;  5J5F A;  3SQ9 A;  4PIR A;  4TWD A;  2BG9 C;  4DBM A;  5HEJ A;  2ZJU A;  3WTK A;  3UQ4 A;  5HEH A;  4ZJT A;  2XQ9 A;  4XHE A;  3UU4 A;  4UY2 A;  2XZ5 A;  5L4H A;  2X00 D;  3JAE A;  2BJ0 A;  4QAB A;  4ZZC A;  5BW2 A;  4Z91 A;  3WTJ A;  1UW6 A;  4ZK1 A;  2C9T A;  2XYT A;  3U8J A;  4HFD A;  4TWH A;  4ZR6 A;  4EZ1 A;  2QC1 B;  2BYQ A;  4FRR A; 
#chains in the Genus database with same CATH topology
 4UM3 S;  4QAA A;  4NZB A;  2XNT A;  5AFH A;  2BYS A;  3T4M A;  4A97 A;  2W8G A;  3RQW A;  2WN9 A;  3RQU A;  3UUB A;  3WTM A;  4ILC A;  2BYP A;  4BQT A;  5AFM A;  2XYS A;  4HFC A;  4B5D A;  2YMD A;  5LXB A;  4TNV A;  5AFL A;  2W8F A;  4HFB A;  2BG9 E;  4UM1 A;  4ILA A;  3UU5 A;  2Y54 A;  3JAF A;  5LG3 A;  2XQ5 A;  4QH4 A;  3ZDH A;  5SYO A;  4D01 A;  4XK9 A;  3JAD A;  3UU3 A;  2WNC A;  2VL0 A;  2WNL A;  3TLU A;  4BFQ A;  4COF A;  2XZ6 A;  4TNW A;  3SIO A;  5IUX A;  2PGZ A;  4HFE A;  3TLS A;  3TLT A;  5AFM B;  3U8L A;  4UM3 A;  2XQ3 A;  2PH9 A;  4A98 A;  2BG9 A;  2WNJ A;  3PMZ A;  5AFJ A;  3SQ6 A;  4TWF A;  5HCM A;  3ZKR A;  4F8H A;  5J5H A;  3WTH A;  3EI0 A;  3TLW A;  3WIP A;  3EHZ A;  4ZRU A;  4LMK A;  3PEO A;  4Z90 A;  3C84 A;  3UU6 A;  5J0Z A;  3GUA A;  3RIF A;  4HFI A;  2BYN A;  4UXU A;  5CFB A;  2XNU A;  4ZZB A;  4QH5 A;  5FJV A;  5JME A;  2XQ6 A;  2UZ6 A;  4QH1 A;  3RHW A;  5L4E A;  5CO5 A;  2Y56 A;  5J5G A;  4AFT A;  3RI5 A;  4ZK4 A;  2BG9 B;  3TLV A;  3WTN A;  5HEG A;  2BR8 A;  5J5I A;  2YME A;  5KZU A;  5BP0 A;  2XQ7 A;  5BRX A;  3SH1 A;  3ZDG A;  3P4W A;  5AIN A;  4IRE A;  4HQP A;  2XQ4 A;  2YN6 A;  1UX2 A;  4ILB A;  3U8M A;  2YOE A;  5AFK A;  4WV9 A;  3WTL A;  2BR7 A;  5TVC A;  4UM3 P;  3IGQ A;  1UV6 A;  3U8N A;  3P50 A;  1I9B A;  2Y7Y A;  2XQ8 A;  3EAM A;  4IL9 A;  3U8K A;  2X00 A;  5HEU A;  4ZJS A;  2Y58 A;  3RIA A;  3WTI A;  2Y57 A;  3C79 A;  5KE4 A;  4QAC A;  4AFG A;  4IL4 A;  2WZY A;  4LMJ A;  5L47 A;  4LML A;  5HCJ A;  2XQA A;  5AFN A;  4AFH A;  4HFH A;  5HEO A;  3UU8 A;  4X5T A;  3WTO A;  2YKS A;  3UQ7 A;  4NPP A;  2XNV A;  4ALX A;  3LSV A;  2BYR A;  2ZJV A;  5J5F A;  3SQ9 A;  4PIR A;  4TWD A;  2BG9 C;  4DBM A;  5HEJ A;  2ZJU A;  3WTK A;  3UQ4 A;  5HEH A;  4ZJT A;  2XQ9 A;  4XHE A;  3UU4 A;  4UY2 A;  2XZ5 A;  5L4H A;  2X00 D;  3JAE A;  2BJ0 A;  4QAB A;  4ZZC A;  5BW2 A;  4Z91 A;  3WTJ A;  1UW6 A;  4ZK1 A;  2C9T A;  2XYT A;  3U8J A;  4HFD A;  4TWH A;  4ZR6 A;  4EZ1 A;  2QC1 B;  2BYQ A;  4FRR A; 
#chains in the Genus database with same CATH homology
 4UM3 S;  4QAA A;  4NZB A;  2XNT A;  5AFH A;  2BYS A;  3T4M A;  4A97 A;  2W8G A;  3RQW A;  2WN9 A;  3RQU A;  3UUB A;  3WTM A;  4ILC A;  2BYP A;  4BQT A;  5AFM A;  2XYS A;  4HFC A;  4B5D A;  2YMD A;  5LXB A;  4TNV A;  5AFL A;  2W8F A;  4HFB A;  2BG9 E;  4UM1 A;  4ILA A;  3UU5 A;  2Y54 A;  3JAF A;  5LG3 A;  2XQ5 A;  4QH4 A;  3ZDH A;  5SYO A;  4D01 A;  4XK9 A;  3JAD A;  3UU3 A;  2WNC A;  2VL0 A;  2WNL A;  3TLU A;  4BFQ A;  4COF A;  2XZ6 A;  4TNW A;  3SIO A;  5IUX A;  2PGZ A;  4HFE A;  3TLS A;  3TLT A;  5AFM B;  3U8L A;  4UM3 A;  2XQ3 A;  2PH9 A;  4A98 A;  2BG9 A;  2WNJ A;  3PMZ A;  5AFJ A;  3SQ6 A;  4TWF A;  5HCM A;  3ZKR A;  4F8H A;  5J5H A;  3WTH A;  3EI0 A;  3TLW A;  3WIP A;  3EHZ A;  4ZRU A;  4LMK A;  3PEO A;  4Z90 A;  3C84 A;  3UU6 A;  5J0Z A;  3GUA A;  3RIF A;  4HFI A;  2BYN A;  4UXU A;  5CFB A;  2XNU A;  4ZZB A;  4QH5 A;  5FJV A;  5JME A;  2XQ6 A;  2UZ6 A;  4QH1 A;  3RHW A;  5L4E A;  5CO5 A;  2Y56 A;  5J5G A;  4AFT A;  3RI5 A;  4ZK4 A;  2BG9 B;  3TLV A;  3WTN A;  5HEG A;  2BR8 A;  5J5I A;  2YME A;  5KZU A;  5BP0 A;  2XQ7 A;  5BRX A;  3SH1 A;  3ZDG A;  3P4W A;  5AIN A;  4IRE A;  4HQP A;  2XQ4 A;  2YN6 A;  1UX2 A;  4ILB A;  3U8M A;  2YOE A;  5AFK A;  4WV9 A;  3WTL A;  2BR7 A;  5TVC A;  4UM3 P;  3IGQ A;  1UV6 A;  3U8N A;  3P50 A;  1I9B A;  2Y7Y A;  2XQ8 A;  3EAM A;  4IL9 A;  3U8K A;  2X00 A;  5HEU A;  4ZJS A;  2Y58 A;  3RIA A;  3WTI A;  2Y57 A;  3C79 A;  5KE4 A;  4QAC A;  4AFG A;  4IL4 A;  2WZY A;  4LMJ A;  5L47 A;  4LML A;  5HCJ A;  2XQA A;  5AFN A;  4AFH A;  4HFH A;  5HEO A;  3UU8 A;  4X5T A;  3WTO A;  2YKS A;  3UQ7 A;  4NPP A;  2XNV A;  4ALX A;  3LSV A;  2BYR A;  2ZJV A;  5J5F A;  3SQ9 A;  4PIR A;  4TWD A;  2BG9 C;  4DBM A;  5HEJ A;  2ZJU A;  3WTK A;  3UQ4 A;  5HEH A;  4ZJT A;  2XQ9 A;  4XHE A;  3UU4 A;  4UY2 A;  2XZ5 A;  5L4H A;  2X00 D;  3JAE A;  2BJ0 A;  4QAB A;  4ZZC A;  5BW2 A;  4Z91 A;  3WTJ A;  1UW6 A;  4ZK1 A;  2C9T A;  2XYT A;  3U8J A;  4HFD A;  4TWH A;  4ZR6 A;  4EZ1 A;  2QC1 B;  2BYQ A;  4FRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...