5BP0A

X-ray crystal structure of lymnaea stagnalis acetylcholine binding protein (ls-achbp) in complex with 5-fluoronicotine (ti-4650)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
205
structure length
199
Chain Sequence
KLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Comparisons of Binding Affinities for Neuronal Nicotinic Receptors (NNRs) and AChBPs
rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine binding protein
total genus 42
structure length 199
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5bp0A00
3JADA 5L47A 1UX2A 1UV6A 5AFMB 4ILCA 2XNVA 5HCJA 4HFIA 2BR8A 4BQTA 4PIRA 4NZBA 4ILAA 3C84A 5J5GA 3RI5A 3TLUA 4ZZBA 4NPPA 2QC1B 3SQ6A 3U8LA 5J5IA 5JMEA 4ZK4A 5TVCA 2VL0A 4Z90A 2X00A 4UM3P 3PEOA 4TNWA 5HEHA 2X00D 4LMKA 2Y57A 2Y7YA 3SQ9A 4LMJA 2BYQA 3P4WA 2Y56A 3U8MA 2WNLA 5FJVA 3WTHA 3ZKRA 3WTIA 4HFEA 5HCMA 3U8KA 3EAMA 3EI0A 4UM3S 4WV9A 3TLVA 5CFBA 3WTOA 5AFNA 4FRRA 5LG3A 3WTMA 5AFJA 4Z91A 5AFHA 5AFKA 4HFBA 3UU3A 3IGQA 3U8JA 5CO5A 2PH9A 4B5DA 4IREA 2BG9A 3SH1A 5L4EA 2BYNA 2BJ0A 3GUAA 3RQWA 3WIPA 2BR7A 2WNCA 2XQ6A 2XQ7A 4ZR6A 5SYOA 4UM3A 5HEJA 4ILBA 4TWDA 2XZ6A 2ZJVA 5BP0A 5AFLA 3WTLA 4D01A 2ZJUA 4HFCA 4ZK1A 5BRXA 4ZJTA 4ALXA 5BW2A 3RIAA 5AINA 3UQ4A 5AFMA 3RIFA 4HFDA 3RQUA 4UM1A 4IL9A 2Y54A 2XQ8A 4X5TA 3UU8A 4AFHA 3SIOA 4COFA 3JAFA 4F8HA 2XZ5A 4ZRUA 2XNUA 2XQ5A 2WNJA 2XQAA 3LSVA 3PMZA 4QH1A 3TLSA 5J0ZA 2XNTA 5J5HA 3ZDHA 4QH4A 3WTJA 2BG9C 3TLWA 3ZDGA 2YMEA 2C9TA 3P50A 5HEGA 4UXUA 3UU6A 3UU4A 2WZYA 4TWHA 4HQPA 5LXBA 4DBMA 2XYTA 4A97A 4QH5A 4TNVA 4IL4A 5KZUA 4AFTA 3C79A 5J5FA 4ZZCA 1I9BA 5IUXA 4AFGA 3JAEA 3RHWA 2YMDA 2YOEA 2BYPA 5HEUA 3T4MA 4BFQA 4TWFA 4LMLA 2W8FA 3UQ7A 3TLTA 2Y58A 4XK9A 2XYSA 2YN6A 4QACA 4XHEA 5L4HA 4A98A 4QABA 2BYRA 2BYSA 4HFHA 4ZJSA 4UY2A 2W8GA 2PGZA 2BG9B 4QAAA 2YKSA 3U8NA 2BG9E 4EZ1A 3UUBA 2WN9A 3EHZA 2XQ9A 3WTKA 5HEOA 2UZ6A 1UW6A 3WTNA 3UU5A 2XQ3A 2XQ4A 5KE4A
chains in the Genus database with same CATH superfamily
3JADA 5L47A 1UX2A 1UV6A 5AFMB 4ILCA 2XNVA 5HCJA 4HFIA 2BR8A 4BQTA 4PIRA 4NZBA 4ILAA 3C84A 5J5GA 3RI5A 3TLUA 4ZZBA 4NPPA 2QC1B 3SQ6A 3U8LA 5J5IA 5JMEA 4ZK4A 5TVCA 2VL0A 4Z90A 2X00A 4UM3P 3PEOA 4TNWA 5HEHA 2X00D 4LMKA 2Y57A 2Y7YA 3SQ9A 4LMJA 2BYQA 3P4WA 2Y56A 3U8MA 2WNLA 5FJVA 3WTHA 3ZKRA 3WTIA 4HFEA 5HCMA 3U8KA 3EAMA 3EI0A 4UM3S 4WV9A 3TLVA 5CFBA 3WTOA 5AFNA 4FRRA 5LG3A 3WTMA 5AFJA 4Z91A 5AFHA 5AFKA 4HFBA 3UU3A 3IGQA 3U8JA 5CO5A 2PH9A 4B5DA 4IREA 2BG9A 3SH1A 5L4EA 2BYNA 2BJ0A 3GUAA 3RQWA 3WIPA 2BR7A 2WNCA 2XQ6A 2XQ7A 4ZR6A 5SYOA 4UM3A 5HEJA 4ILBA 4TWDA 2XZ6A 2ZJVA 5BP0A 5AFLA 3WTLA 4D01A 2ZJUA 4HFCA 4ZK1A 5BRXA 4ZJTA 4ALXA 5BW2A 3RIAA 5AINA 3UQ4A 5AFMA 3RIFA 4HFDA 3RQUA 4UM1A 4IL9A 2Y54A 2XQ8A 4X5TA 3UU8A 4AFHA 3SIOA 4COFA 3JAFA 4F8HA 2XZ5A 4ZRUA 2XNUA 2XQ5A 2WNJA 2XQAA 3LSVA 3PMZA 4QH1A 3TLSA 5J0ZA 2XNTA 5J5HA 3ZDHA 4QH4A 3WTJA 2BG9C 3TLWA 3ZDGA 2YMEA 2C9TA 3P50A 5HEGA 4UXUA 3UU6A 3UU4A 2WZYA 4TWHA 4HQPA 5LXBA 4DBMA 2XYTA 4A97A 4QH5A 4TNVA 4IL4A 5KZUA 4AFTA 3C79A 5J5FA 4ZZCA 1I9BA 5IUXA 4AFGA 3JAEA 3RHWA 2YMDA 2YOEA 2BYPA 5HEUA 3T4MA 4BFQA 4TWFA 4LMLA 2W8FA 3UQ7A 3TLTA 2Y58A 4XK9A 2XYSA 2YN6A 4QACA 4XHEA 5L4HA 4A98A 4QABA 2BYRA 2BYSA 4HFHA 4ZJSA 4UY2A 2W8GA 2PGZA 2BG9B 4QAAA 2YKSA 3U8NA 2BG9E 4EZ1A 3UUBA 2WN9A 3EHZA 2XQ9A 3WTKA 5HEOA 2UZ6A 1UW6A 3WTNA 3UU5A 2XQ3A 2XQ4A 5KE4A
chains in the Genus database with same CATH topology
3JADA 5L47A 1UX2A 1UV6A 5AFMB 4ILCA 2XNVA 5HCJA 4HFIA 2BR8A 4BQTA 4PIRA 4NZBA 4ILAA 3C84A 5J5GA 3RI5A 3TLUA 4ZZBA 4NPPA 2QC1B 3SQ6A 3U8LA 5J5IA 5JMEA 4ZK4A 5TVCA 2VL0A 4Z90A 2X00A 4UM3P 3PEOA 4TNWA 5HEHA 2X00D 4LMKA 2Y57A 2Y7YA 3SQ9A 4LMJA 2BYQA 3P4WA 2Y56A 3U8MA 2WNLA 5FJVA 3WTHA 3ZKRA 3WTIA 4HFEA 5HCMA 3U8KA 3EAMA 3EI0A 4UM3S 4WV9A 3TLVA 5CFBA 3WTOA 5AFNA 4FRRA 5LG3A 3WTMA 5AFJA 4Z91A 5AFHA 5AFKA 4HFBA 3UU3A 3IGQA 3U8JA 5CO5A 2PH9A 4B5DA 4IREA 2BG9A 3SH1A 5L4EA 2BYNA 2BJ0A 3GUAA 3RQWA 3WIPA 2BR7A 2WNCA 2XQ6A 2XQ7A 4ZR6A 5SYOA 4UM3A 5HEJA 4ILBA 4TWDA 2XZ6A 2ZJVA 5BP0A 5AFLA 3WTLA 4D01A 2ZJUA 4HFCA 4ZK1A 5BRXA 4ZJTA 4ALXA 5BW2A 3RIAA 5AINA 3UQ4A 5AFMA 3RIFA 4HFDA 3RQUA 4UM1A 4IL9A 2Y54A 2XQ8A 4X5TA 3UU8A 4AFHA 3SIOA 4COFA 3JAFA 4F8HA 2XZ5A 4ZRUA 2XNUA 2XQ5A 2WNJA 2XQAA 3LSVA 3PMZA 4QH1A 3TLSA 5J0ZA 2XNTA 5J5HA 3ZDHA 4QH4A 3WTJA 2BG9C 3TLWA 3ZDGA 2YMEA 2C9TA 3P50A 5HEGA 4UXUA 3UU6A 3UU4A 2WZYA 4TWHA 4HQPA 5LXBA 4DBMA 2XYTA 4A97A 4QH5A 4TNVA 4IL4A 5KZUA 4AFTA 3C79A 5J5FA 4ZZCA 1I9BA 5IUXA 4AFGA 3JAEA 3RHWA 2YMDA 2YOEA 2BYPA 5HEUA 3T4MA 4BFQA 4TWFA 4LMLA 2W8FA 3UQ7A 3TLTA 2Y58A 4XK9A 2XYSA 2YN6A 4QACA 4XHEA 5L4HA 4A98A 4QABA 2BYRA 2BYSA 4HFHA 4ZJSA 4UY2A 2W8GA 2PGZA 2BG9B 4QAAA 2YKSA 3U8NA 2BG9E 4EZ1A 3UUBA 2WN9A 3EHZA 2XQ9A 3WTKA 5HEOA 2UZ6A 1UW6A 3WTNA 3UU5A 2XQ3A 2XQ4A 5KE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAD A;  5L47 A;  1UX2 A;  1UV6 A;  5AFM B;  4ILC A;  2XNV A;  5HCJ A;  4HFI A;  2BR8 A;  4BQT A;  4PIR A;  4NZB A;  4ILA A;  3C84 A;  5J5G A;  3RI5 A;  3TLU A;  4ZZB A;  4NPP A;  2QC1 B;  3SQ6 A;  3U8L A;  5J5I A;  5JME A;  4ZK4 A;  5TVC A;  2VL0 A;  4Z90 A;  2X00 A;  4UM3 P;  3PEO A;  4TNW A;  5HEH A;  2X00 D;  4LMK A;  2Y57 A;  2Y7Y A;  3SQ9 A;  4LMJ A;  2BYQ A;  3P4W A;  2Y56 A;  3U8M A;  2WNL A;  5FJV A;  3WTH A;  3ZKR A;  3WTI A;  4HFE A;  5HCM A;  3U8K A;  3EAM A;  3EI0 A;  4UM3 S;  4WV9 A;  3TLV A;  5CFB A;  3WTO A;  5AFN A;  4FRR A;  5LG3 A;  3WTM A;  5AFJ A;  4Z91 A;  5AFH A;  5AFK A;  4HFB A;  3UU3 A;  3IGQ A;  3U8J A;  5CO5 A;  2PH9 A;  4B5D A;  4IRE A;  2BG9 A;  3SH1 A;  5L4E A;  2BYN A;  2BJ0 A;  3GUA A;  3RQW A;  3WIP A;  2BR7 A;  2WNC A;  2XQ6 A;  2XQ7 A;  4ZR6 A;  5SYO A;  4UM3 A;  5HEJ A;  4ILB A;  4TWD A;  2XZ6 A;  2ZJV A;  5BP0 A;  5AFL A;  3WTL A;  4D01 A;  2ZJU A;  4HFC A;  4ZK1 A;  5BRX A;  4ZJT A;  4ALX A;  5BW2 A;  3RIA A;  5AIN A;  3UQ4 A;  5AFM A;  3RIF A;  4HFD A;  3RQU A;  4UM1 A;  4IL9 A;  2Y54 A;  2XQ8 A;  4X5T A;  3UU8 A;  4AFH A;  3SIO A;  4COF A;  3JAF A;  4F8H A;  2XZ5 A;  4ZRU A;  2XNU A;  2XQ5 A;  2WNJ A;  2XQA A;  3LSV A;  3PMZ A;  4QH1 A;  3TLS A;  5J0Z A;  2XNT A;  5J5H A;  3ZDH A;  4QH4 A;  3WTJ A;  2BG9 C;  3TLW A;  3ZDG A;  2YME A;  2C9T A;  3P50 A;  5HEG A;  4UXU A;  3UU6 A;  3UU4 A;  2WZY A;  4TWH A;  4HQP A;  5LXB A;  4DBM A;  2XYT A;  4A97 A;  4QH5 A;  4TNV A;  4IL4 A;  5KZU A;  4AFT A;  3C79 A;  5J5F A;  4ZZC A;  1I9B A;  5IUX A;  4AFG A;  3JAE A;  3RHW A;  2YMD A;  2YOE A;  2BYP A;  5HEU A;  3T4M A;  4BFQ A;  4TWF A;  4LML A;  2W8F A;  3UQ7 A;  3TLT A;  2Y58 A;  4XK9 A;  2XYS A;  2YN6 A;  4QAC A;  4XHE A;  5L4H A;  4A98 A;  4QAB A;  2BYR A;  2BYS A;  4HFH A;  4ZJS A;  4UY2 A;  2W8G A;  2PGZ A;  2BG9 B;  4QAA A;  2YKS A;  3U8N A;  2BG9 E;  4EZ1 A;  3UUB A;  2WN9 A;  3EHZ A;  2XQ9 A;  3WTK A;  5HEO A;  2UZ6 A;  1UW6 A;  3WTN A;  3UU5 A;  2XQ3 A;  2XQ4 A;  5KE4 A; 
#chains in the Genus database with same CATH topology
 3JAD A;  5L47 A;  1UX2 A;  1UV6 A;  5AFM B;  4ILC A;  2XNV A;  5HCJ A;  4HFI A;  2BR8 A;  4BQT A;  4PIR A;  4NZB A;  4ILA A;  3C84 A;  5J5G A;  3RI5 A;  3TLU A;  4ZZB A;  4NPP A;  2QC1 B;  3SQ6 A;  3U8L A;  5J5I A;  5JME A;  4ZK4 A;  5TVC A;  2VL0 A;  4Z90 A;  2X00 A;  4UM3 P;  3PEO A;  4TNW A;  5HEH A;  2X00 D;  4LMK A;  2Y57 A;  2Y7Y A;  3SQ9 A;  4LMJ A;  2BYQ A;  3P4W A;  2Y56 A;  3U8M A;  2WNL A;  5FJV A;  3WTH A;  3ZKR A;  3WTI A;  4HFE A;  5HCM A;  3U8K A;  3EAM A;  3EI0 A;  4UM3 S;  4WV9 A;  3TLV A;  5CFB A;  3WTO A;  5AFN A;  4FRR A;  5LG3 A;  3WTM A;  5AFJ A;  4Z91 A;  5AFH A;  5AFK A;  4HFB A;  3UU3 A;  3IGQ A;  3U8J A;  5CO5 A;  2PH9 A;  4B5D A;  4IRE A;  2BG9 A;  3SH1 A;  5L4E A;  2BYN A;  2BJ0 A;  3GUA A;  3RQW A;  3WIP A;  2BR7 A;  2WNC A;  2XQ6 A;  2XQ7 A;  4ZR6 A;  5SYO A;  4UM3 A;  5HEJ A;  4ILB A;  4TWD A;  2XZ6 A;  2ZJV A;  5BP0 A;  5AFL A;  3WTL A;  4D01 A;  2ZJU A;  4HFC A;  4ZK1 A;  5BRX A;  4ZJT A;  4ALX A;  5BW2 A;  3RIA A;  5AIN A;  3UQ4 A;  5AFM A;  3RIF A;  4HFD A;  3RQU A;  4UM1 A;  4IL9 A;  2Y54 A;  2XQ8 A;  4X5T A;  3UU8 A;  4AFH A;  3SIO A;  4COF A;  3JAF A;  4F8H A;  2XZ5 A;  4ZRU A;  2XNU A;  2XQ5 A;  2WNJ A;  2XQA A;  3LSV A;  3PMZ A;  4QH1 A;  3TLS A;  5J0Z A;  2XNT A;  5J5H A;  3ZDH A;  4QH4 A;  3WTJ A;  2BG9 C;  3TLW A;  3ZDG A;  2YME A;  2C9T A;  3P50 A;  5HEG A;  4UXU A;  3UU6 A;  3UU4 A;  2WZY A;  4TWH A;  4HQP A;  5LXB A;  4DBM A;  2XYT A;  4A97 A;  4QH5 A;  4TNV A;  4IL4 A;  5KZU A;  4AFT A;  3C79 A;  5J5F A;  4ZZC A;  1I9B A;  5IUX A;  4AFG A;  3JAE A;  3RHW A;  2YMD A;  2YOE A;  2BYP A;  5HEU A;  3T4M A;  4BFQ A;  4TWF A;  4LML A;  2W8F A;  3UQ7 A;  3TLT A;  2Y58 A;  4XK9 A;  2XYS A;  2YN6 A;  4QAC A;  4XHE A;  5L4H A;  4A98 A;  4QAB A;  2BYR A;  2BYS A;  4HFH A;  4ZJS A;  4UY2 A;  2W8G A;  2PGZ A;  2BG9 B;  4QAA A;  2YKS A;  3U8N A;  2BG9 E;  4EZ1 A;  3UUB A;  2WN9 A;  3EHZ A;  2XQ9 A;  3WTK A;  5HEO A;  2UZ6 A;  1UW6 A;  3WTN A;  3UU5 A;  2XQ3 A;  2XQ4 A;  5KE4 A; 
#chains in the Genus database with same CATH homology
 3JAD A;  5L47 A;  1UX2 A;  1UV6 A;  5AFM B;  4ILC A;  2XNV A;  5HCJ A;  4HFI A;  2BR8 A;  4BQT A;  4PIR A;  4NZB A;  4ILA A;  3C84 A;  5J5G A;  3RI5 A;  3TLU A;  4ZZB A;  4NPP A;  2QC1 B;  3SQ6 A;  3U8L A;  5J5I A;  5JME A;  4ZK4 A;  5TVC A;  2VL0 A;  4Z90 A;  2X00 A;  4UM3 P;  3PEO A;  4TNW A;  5HEH A;  2X00 D;  4LMK A;  2Y57 A;  2Y7Y A;  3SQ9 A;  4LMJ A;  2BYQ A;  3P4W A;  2Y56 A;  3U8M A;  2WNL A;  5FJV A;  3WTH A;  3ZKR A;  3WTI A;  4HFE A;  5HCM A;  3U8K A;  3EAM A;  3EI0 A;  4UM3 S;  4WV9 A;  3TLV A;  5CFB A;  3WTO A;  5AFN A;  4FRR A;  5LG3 A;  3WTM A;  5AFJ A;  4Z91 A;  5AFH A;  5AFK A;  4HFB A;  3UU3 A;  3IGQ A;  3U8J A;  5CO5 A;  2PH9 A;  4B5D A;  4IRE A;  2BG9 A;  3SH1 A;  5L4E A;  2BYN A;  2BJ0 A;  3GUA A;  3RQW A;  3WIP A;  2BR7 A;  2WNC A;  2XQ6 A;  2XQ7 A;  4ZR6 A;  5SYO A;  4UM3 A;  5HEJ A;  4ILB A;  4TWD A;  2XZ6 A;  2ZJV A;  5BP0 A;  5AFL A;  3WTL A;  4D01 A;  2ZJU A;  4HFC A;  4ZK1 A;  5BRX A;  4ZJT A;  4ALX A;  5BW2 A;  3RIA A;  5AIN A;  3UQ4 A;  5AFM A;  3RIF A;  4HFD A;  3RQU A;  4UM1 A;  4IL9 A;  2Y54 A;  2XQ8 A;  4X5T A;  3UU8 A;  4AFH A;  3SIO A;  4COF A;  3JAF A;  4F8H A;  2XZ5 A;  4ZRU A;  2XNU A;  2XQ5 A;  2WNJ A;  2XQA A;  3LSV A;  3PMZ A;  4QH1 A;  3TLS A;  5J0Z A;  2XNT A;  5J5H A;  3ZDH A;  4QH4 A;  3WTJ A;  2BG9 C;  3TLW A;  3ZDG A;  2YME A;  2C9T A;  3P50 A;  5HEG A;  4UXU A;  3UU6 A;  3UU4 A;  2WZY A;  4TWH A;  4HQP A;  5LXB A;  4DBM A;  2XYT A;  4A97 A;  4QH5 A;  4TNV A;  4IL4 A;  5KZU A;  4AFT A;  3C79 A;  5J5F A;  4ZZC A;  1I9B A;  5IUX A;  4AFG A;  3JAE A;  3RHW A;  2YMD A;  2YOE A;  2BYP A;  5HEU A;  3T4M A;  4BFQ A;  4TWF A;  4LML A;  2W8F A;  3UQ7 A;  3TLT A;  2Y58 A;  4XK9 A;  2XYS A;  2YN6 A;  4QAC A;  4XHE A;  5L4H A;  4A98 A;  4QAB A;  2BYR A;  2BYS A;  4HFH A;  4ZJS A;  4UY2 A;  2W8G A;  2PGZ A;  2BG9 B;  4QAA A;  2YKS A;  3U8N A;  2BG9 E;  4EZ1 A;  3UUB A;  2WN9 A;  3EHZ A;  2XQ9 A;  3WTK A;  5HEO A;  2UZ6 A;  1UW6 A;  3WTN A;  3UU5 A;  2XQ3 A;  2XQ4 A;  5KE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...