5BP0A

X-ray crystal structure of lymnaea stagnalis acetylcholine binding protein (ls-achbp) in complex with 5-fluoronicotine (ti-4650)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
205
structure length
199
Chain Sequence
KLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine binding protein
molecule keywords Acetylcholine-binding protein
publication title Comparisons of Binding Affinities for Neuronal Nicotinic Receptors (NNRs) and AChBPs
rcsb
source organism Lymnaea stagnalis
total genus 42
structure length 199
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5bp0A00
4QH4A 4UXUA 4LMJA 5AINA 3SQ9A 5L4HA 5AFNA 3TLVA 4EZ1A 2PGZA 4LMKA 4UM3A 5HEHA 5AFHA 2XQAA 3P4WA 5HEJA 2XNUA 5LXBA 3TLWA 3U8KA 3P50A 4HFIA 4HFDA 4IL4A 4TWHA 3UU6A 3SQ6A 3C79A 2Y57A 5CO5A 5HCMA 3RI5A 3WTMA 5AFMA 3IGQA 4AFTA 2UZ6A 2YMDA 2XQ3A 4Z91A 3UU8A 5JMEA 2XQ5A 3WTLA 4ALXA 2WZYA 5FJVA 3RIFA 2Y7YA 3LSVA 5BRXA 4ZRUA 3U8MA 2VL0A 4ZR6A 5BW2A 3WTKA 3RIAA 3EI0A 2XYTA 3PEOA 2ZJVA 4ZZCA 2XZ6A 5IUXA 2WN9A 3UU5A 2BG9C 2BG9B 4NPPA 4ZK4A 4HFEA 3UU3A 2PH9A 4ILAA 4HFBA 3WTOA 1I9BA 2XYSA 2C9TA 2XNVA 3U8JA 4A98A 4UM1A 3U8LA 5AFKA 5AFMB 2BR8A 2ZJUA 4WV9A 2YOEA 4COFA 2Y54A 4ZJSA 4F8HA 4ILCA 5TVCA 4B5DA 4FRRA 2WNLA 3ZKRA 5J5GA 4ZK1A 5CFBA 3WIPA 5SYOA 3U8NA 4A97A 4XK9A 2BYQA 4QABA 5KZUA 3ZDHA 1UW6A 4QH1A 5AFLA 5LG3A 2Y58A 2BYNA 4D01A 2XQ8A 4IREA 3UUBA 4ZJTA 3JADA 4IL9A 4XHEA 2BR7A 5AFJA 4TWFA 2YMEA 3TLTA 3WTNA 5KE4A 3RQWA 3TLSA 5HEUA 3T4MA 4HFHA 4TWDA 4Z90A 3UQ7A 3SIOA 2BYPA 3UQ4A 4LMLA 5J5IA 4DBMA 3TLUA 2WNCA 3WTHA 2W8GA 2QC1B 3C84A 2XZ5A 3GUAA 3RQUA 4UM3P 4AFHA 2BG9E 4UM3S 2XNTA 2X00A 5HEGA 1UX2A 5L4EA 3WTIA 2X00D 3JAFA 2BJ0A 2XQ6A 4TNWA 3EHZA 3WTJA 2YKSA 3ZDGA 4HQPA 4X5TA 4QH5A 5J5FA 2W8FA 2XQ4A 2WNJA 5HCJA 1UV6A 2BG9A 4ILBA 4QACA 2XQ9A 5HEOA 2XQ7A 3PMZA 3UU4A 4BQTA 3EAMA 5J5HA 5J0ZA 2BYRA 3RHWA 4QAAA 2Y56A 3JAEA 4PIRA 4TNVA 4AFGA 5L47A 4ZZBA 4UY2A 5BP0A 4NZBA 4BFQA 4HFCA 3SH1A 2YN6A 2BYSA
chains in the Genus database with same CATH superfamily
4QH4A 4UXUA 4LMJA 5AINA 3SQ9A 5L4HA 5AFNA 3TLVA 4EZ1A 2PGZA 4LMKA 4UM3A 5HEHA 5AFHA 2XQAA 3P4WA 5HEJA 2XNUA 5LXBA 3TLWA 3U8KA 3P50A 4HFIA 4HFDA 4IL4A 4TWHA 3UU6A 3SQ6A 3C79A 2Y57A 5CO5A 5HCMA 3RI5A 3WTMA 5AFMA 3IGQA 4AFTA 2UZ6A 2YMDA 2XQ3A 4Z91A 3UU8A 5JMEA 2XQ5A 3WTLA 4ALXA 2WZYA 5FJVA 3RIFA 2Y7YA 3LSVA 5BRXA 4ZRUA 3U8MA 2VL0A 4ZR6A 5BW2A 3WTKA 3RIAA 3EI0A 2XYTA 3PEOA 2ZJVA 4ZZCA 2XZ6A 5IUXA 2WN9A 3UU5A 2BG9C 2BG9B 4NPPA 4ZK4A 4HFEA 3UU3A 2PH9A 4ILAA 4HFBA 3WTOA 1I9BA 2XYSA 2C9TA 2XNVA 3U8JA 4A98A 4UM1A 3U8LA 5AFKA 5AFMB 2BR8A 2ZJUA 4WV9A 2YOEA 4COFA 2Y54A 4ZJSA 4F8HA 4ILCA 5TVCA 4B5DA 4FRRA 2WNLA 3ZKRA 5J5GA 4ZK1A 5CFBA 3WIPA 5SYOA 3U8NA 4A97A 4XK9A 2BYQA 4QABA 5KZUA 3ZDHA 1UW6A 4QH1A 5AFLA 5LG3A 2Y58A 2BYNA 4D01A 2XQ8A 4IREA 3UUBA 4ZJTA 3JADA 4IL9A 4XHEA 2BR7A 5AFJA 4TWFA 2YMEA 3TLTA 3WTNA 5KE4A 3RQWA 3TLSA 5HEUA 3T4MA 4HFHA 4TWDA 4Z90A 3UQ7A 3SIOA 2BYPA 3UQ4A 4LMLA 5J5IA 4DBMA 3TLUA 2WNCA 3WTHA 2W8GA 2QC1B 3C84A 2XZ5A 3GUAA 3RQUA 4UM3P 4AFHA 2BG9E 4UM3S 2XNTA 2X00A 5HEGA 1UX2A 5L4EA 3WTIA 2X00D 3JAFA 2BJ0A 2XQ6A 4TNWA 3EHZA 3WTJA 2YKSA 3ZDGA 4HQPA 4X5TA 4QH5A 5J5FA 2W8FA 2XQ4A 2WNJA 5HCJA 1UV6A 2BG9A 4ILBA 4QACA 2XQ9A 5HEOA 2XQ7A 3PMZA 3UU4A 4BQTA 3EAMA 5J5HA 5J0ZA 2BYRA 3RHWA 4QAAA 2Y56A 3JAEA 4PIRA 4TNVA 4AFGA 5L47A 4ZZBA 4UY2A 5BP0A 4NZBA 4BFQA 4HFCA 3SH1A 2YN6A 2BYSA
chains in the Genus database with same CATH topology
4QH4A 4UXUA 4LMJA 5AINA 3SQ9A 5L4HA 5AFNA 3TLVA 4EZ1A 2PGZA 4LMKA 4UM3A 5HEHA 5AFHA 2XQAA 3P4WA 5HEJA 2XNUA 5LXBA 3TLWA 3U8KA 3P50A 4HFIA 4HFDA 4IL4A 4TWHA 3UU6A 3SQ6A 3C79A 2Y57A 5CO5A 5HCMA 3RI5A 3WTMA 5AFMA 3IGQA 4AFTA 2UZ6A 2YMDA 2XQ3A 4Z91A 3UU8A 5JMEA 2XQ5A 3WTLA 4ALXA 2WZYA 5FJVA 3RIFA 2Y7YA 3LSVA 5BRXA 4ZRUA 3U8MA 2VL0A 4ZR6A 5BW2A 3WTKA 3RIAA 3EI0A 2XYTA 3PEOA 2ZJVA 4ZZCA 2XZ6A 5IUXA 2WN9A 3UU5A 2BG9C 2BG9B 4NPPA 4ZK4A 4HFEA 3UU3A 2PH9A 4ILAA 4HFBA 3WTOA 1I9BA 2XYSA 2C9TA 2XNVA 3U8JA 4A98A 4UM1A 3U8LA 5AFKA 5AFMB 2BR8A 2ZJUA 4WV9A 2YOEA 4COFA 2Y54A 4ZJSA 4F8HA 4ILCA 5TVCA 4B5DA 4FRRA 2WNLA 3ZKRA 5J5GA 4ZK1A 5CFBA 3WIPA 5SYOA 3U8NA 4A97A 4XK9A 2BYQA 4QABA 5KZUA 3ZDHA 1UW6A 4QH1A 5AFLA 5LG3A 2Y58A 2BYNA 4D01A 2XQ8A 4IREA 3UUBA 4ZJTA 3JADA 4IL9A 4XHEA 2BR7A 5AFJA 4TWFA 2YMEA 3TLTA 3WTNA 5KE4A 3RQWA 3TLSA 5HEUA 3T4MA 4HFHA 4TWDA 4Z90A 3UQ7A 3SIOA 2BYPA 3UQ4A 4LMLA 5J5IA 4DBMA 3TLUA 2WNCA 3WTHA 2W8GA 2QC1B 3C84A 2XZ5A 3GUAA 3RQUA 4UM3P 4AFHA 2BG9E 4UM3S 2XNTA 2X00A 5HEGA 1UX2A 5L4EA 3WTIA 2X00D 3JAFA 2BJ0A 2XQ6A 4TNWA 3EHZA 3WTJA 2YKSA 3ZDGA 4HQPA 4X5TA 4QH5A 5J5FA 2W8FA 2XQ4A 2WNJA 5HCJA 1UV6A 2BG9A 4ILBA 4QACA 2XQ9A 5HEOA 2XQ7A 3PMZA 3UU4A 4BQTA 3EAMA 5J5HA 5J0ZA 2BYRA 3RHWA 4QAAA 2Y56A 3JAEA 4PIRA 4TNVA 4AFGA 5L47A 4ZZBA 4UY2A 5BP0A 4NZBA 4BFQA 4HFCA 3SH1A 2YN6A 2BYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH4 A;  4UXU A;  4LMJ A;  5AIN A;  3SQ9 A;  5L4H A;  5AFN A;  3TLV A;  4EZ1 A;  2PGZ A;  4LMK A;  4UM3 A;  5HEH A;  5AFH A;  2XQA A;  3P4W A;  5HEJ A;  2XNU A;  5LXB A;  3TLW A;  3U8K A;  3P50 A;  4HFI A;  4HFD A;  4IL4 A;  4TWH A;  3UU6 A;  3SQ6 A;  3C79 A;  2Y57 A;  5CO5 A;  5HCM A;  3RI5 A;  3WTM A;  5AFM A;  3IGQ A;  4AFT A;  2UZ6 A;  2YMD A;  2XQ3 A;  4Z91 A;  3UU8 A;  5JME A;  2XQ5 A;  3WTL A;  4ALX A;  2WZY A;  5FJV A;  3RIF A;  2Y7Y A;  3LSV A;  5BRX A;  4ZRU A;  3U8M A;  2VL0 A;  4ZR6 A;  5BW2 A;  3WTK A;  3RIA A;  3EI0 A;  2XYT A;  3PEO A;  2ZJV A;  4ZZC A;  2XZ6 A;  5IUX A;  2WN9 A;  3UU5 A;  2BG9 C;  2BG9 B;  4NPP A;  4ZK4 A;  4HFE A;  3UU3 A;  2PH9 A;  4ILA A;  4HFB A;  3WTO A;  1I9B A;  2XYS A;  2C9T A;  2XNV A;  3U8J A;  4A98 A;  4UM1 A;  3U8L A;  5AFK A;  5AFM B;  2BR8 A;  2ZJU A;  4WV9 A;  2YOE A;  4COF A;  2Y54 A;  4ZJS A;  4F8H A;  4ILC A;  5TVC A;  4B5D A;  4FRR A;  2WNL A;  3ZKR A;  5J5G A;  4ZK1 A;  5CFB A;  3WIP A;  5SYO A;  3U8N A;  4A97 A;  4XK9 A;  2BYQ A;  4QAB A;  5KZU A;  3ZDH A;  1UW6 A;  4QH1 A;  5AFL A;  5LG3 A;  2Y58 A;  2BYN A;  4D01 A;  2XQ8 A;  4IRE A;  3UUB A;  4ZJT A;  3JAD A;  4IL9 A;  4XHE A;  2BR7 A;  5AFJ A;  4TWF A;  2YME A;  3TLT A;  3WTN A;  5KE4 A;  3RQW A;  3TLS A;  5HEU A;  3T4M A;  4HFH A;  4TWD A;  4Z90 A;  3UQ7 A;  3SIO A;  2BYP A;  3UQ4 A;  4LML A;  5J5I A;  4DBM A;  3TLU A;  2WNC A;  3WTH A;  2W8G A;  2QC1 B;  3C84 A;  2XZ5 A;  3GUA A;  3RQU A;  4UM3 P;  4AFH A;  2BG9 E;  4UM3 S;  2XNT A;  2X00 A;  5HEG A;  1UX2 A;  5L4E A;  3WTI A;  2X00 D;  3JAF A;  2BJ0 A;  2XQ6 A;  4TNW A;  3EHZ A;  3WTJ A;  2YKS A;  3ZDG A;  4HQP A;  4X5T A;  4QH5 A;  5J5F A;  2W8F A;  2XQ4 A;  2WNJ A;  5HCJ A;  1UV6 A;  2BG9 A;  4ILB A;  4QAC A;  2XQ9 A;  5HEO A;  2XQ7 A;  3PMZ A;  3UU4 A;  4BQT A;  3EAM A;  5J5H A;  5J0Z A;  2BYR A;  3RHW A;  4QAA A;  2Y56 A;  3JAE A;  4PIR A;  4TNV A;  4AFG A;  5L47 A;  4ZZB A;  4UY2 A;  5BP0 A;  4NZB A;  4BFQ A;  4HFC A;  3SH1 A;  2YN6 A;  2BYS A; 
#chains in the Genus database with same CATH topology
 4QH4 A;  4UXU A;  4LMJ A;  5AIN A;  3SQ9 A;  5L4H A;  5AFN A;  3TLV A;  4EZ1 A;  2PGZ A;  4LMK A;  4UM3 A;  5HEH A;  5AFH A;  2XQA A;  3P4W A;  5HEJ A;  2XNU A;  5LXB A;  3TLW A;  3U8K A;  3P50 A;  4HFI A;  4HFD A;  4IL4 A;  4TWH A;  3UU6 A;  3SQ6 A;  3C79 A;  2Y57 A;  5CO5 A;  5HCM A;  3RI5 A;  3WTM A;  5AFM A;  3IGQ A;  4AFT A;  2UZ6 A;  2YMD A;  2XQ3 A;  4Z91 A;  3UU8 A;  5JME A;  2XQ5 A;  3WTL A;  4ALX A;  2WZY A;  5FJV A;  3RIF A;  2Y7Y A;  3LSV A;  5BRX A;  4ZRU A;  3U8M A;  2VL0 A;  4ZR6 A;  5BW2 A;  3WTK A;  3RIA A;  3EI0 A;  2XYT A;  3PEO A;  2ZJV A;  4ZZC A;  2XZ6 A;  5IUX A;  2WN9 A;  3UU5 A;  2BG9 C;  2BG9 B;  4NPP A;  4ZK4 A;  4HFE A;  3UU3 A;  2PH9 A;  4ILA A;  4HFB A;  3WTO A;  1I9B A;  2XYS A;  2C9T A;  2XNV A;  3U8J A;  4A98 A;  4UM1 A;  3U8L A;  5AFK A;  5AFM B;  2BR8 A;  2ZJU A;  4WV9 A;  2YOE A;  4COF A;  2Y54 A;  4ZJS A;  4F8H A;  4ILC A;  5TVC A;  4B5D A;  4FRR A;  2WNL A;  3ZKR A;  5J5G A;  4ZK1 A;  5CFB A;  3WIP A;  5SYO A;  3U8N A;  4A97 A;  4XK9 A;  2BYQ A;  4QAB A;  5KZU A;  3ZDH A;  1UW6 A;  4QH1 A;  5AFL A;  5LG3 A;  2Y58 A;  2BYN A;  4D01 A;  2XQ8 A;  4IRE A;  3UUB A;  4ZJT A;  3JAD A;  4IL9 A;  4XHE A;  2BR7 A;  5AFJ A;  4TWF A;  2YME A;  3TLT A;  3WTN A;  5KE4 A;  3RQW A;  3TLS A;  5HEU A;  3T4M A;  4HFH A;  4TWD A;  4Z90 A;  3UQ7 A;  3SIO A;  2BYP A;  3UQ4 A;  4LML A;  5J5I A;  4DBM A;  3TLU A;  2WNC A;  3WTH A;  2W8G A;  2QC1 B;  3C84 A;  2XZ5 A;  3GUA A;  3RQU A;  4UM3 P;  4AFH A;  2BG9 E;  4UM3 S;  2XNT A;  2X00 A;  5HEG A;  1UX2 A;  5L4E A;  3WTI A;  2X00 D;  3JAF A;  2BJ0 A;  2XQ6 A;  4TNW A;  3EHZ A;  3WTJ A;  2YKS A;  3ZDG A;  4HQP A;  4X5T A;  4QH5 A;  5J5F A;  2W8F A;  2XQ4 A;  2WNJ A;  5HCJ A;  1UV6 A;  2BG9 A;  4ILB A;  4QAC A;  2XQ9 A;  5HEO A;  2XQ7 A;  3PMZ A;  3UU4 A;  4BQT A;  3EAM A;  5J5H A;  5J0Z A;  2BYR A;  3RHW A;  4QAA A;  2Y56 A;  3JAE A;  4PIR A;  4TNV A;  4AFG A;  5L47 A;  4ZZB A;  4UY2 A;  5BP0 A;  4NZB A;  4BFQ A;  4HFC A;  3SH1 A;  2YN6 A;  2BYS A; 
#chains in the Genus database with same CATH homology
 4QH4 A;  4UXU A;  4LMJ A;  5AIN A;  3SQ9 A;  5L4H A;  5AFN A;  3TLV A;  4EZ1 A;  2PGZ A;  4LMK A;  4UM3 A;  5HEH A;  5AFH A;  2XQA A;  3P4W A;  5HEJ A;  2XNU A;  5LXB A;  3TLW A;  3U8K A;  3P50 A;  4HFI A;  4HFD A;  4IL4 A;  4TWH A;  3UU6 A;  3SQ6 A;  3C79 A;  2Y57 A;  5CO5 A;  5HCM A;  3RI5 A;  3WTM A;  5AFM A;  3IGQ A;  4AFT A;  2UZ6 A;  2YMD A;  2XQ3 A;  4Z91 A;  3UU8 A;  5JME A;  2XQ5 A;  3WTL A;  4ALX A;  2WZY A;  5FJV A;  3RIF A;  2Y7Y A;  3LSV A;  5BRX A;  4ZRU A;  3U8M A;  2VL0 A;  4ZR6 A;  5BW2 A;  3WTK A;  3RIA A;  3EI0 A;  2XYT A;  3PEO A;  2ZJV A;  4ZZC A;  2XZ6 A;  5IUX A;  2WN9 A;  3UU5 A;  2BG9 C;  2BG9 B;  4NPP A;  4ZK4 A;  4HFE A;  3UU3 A;  2PH9 A;  4ILA A;  4HFB A;  3WTO A;  1I9B A;  2XYS A;  2C9T A;  2XNV A;  3U8J A;  4A98 A;  4UM1 A;  3U8L A;  5AFK A;  5AFM B;  2BR8 A;  2ZJU A;  4WV9 A;  2YOE A;  4COF A;  2Y54 A;  4ZJS A;  4F8H A;  4ILC A;  5TVC A;  4B5D A;  4FRR A;  2WNL A;  3ZKR A;  5J5G A;  4ZK1 A;  5CFB A;  3WIP A;  5SYO A;  3U8N A;  4A97 A;  4XK9 A;  2BYQ A;  4QAB A;  5KZU A;  3ZDH A;  1UW6 A;  4QH1 A;  5AFL A;  5LG3 A;  2Y58 A;  2BYN A;  4D01 A;  2XQ8 A;  4IRE A;  3UUB A;  4ZJT A;  3JAD A;  4IL9 A;  4XHE A;  2BR7 A;  5AFJ A;  4TWF A;  2YME A;  3TLT A;  3WTN A;  5KE4 A;  3RQW A;  3TLS A;  5HEU A;  3T4M A;  4HFH A;  4TWD A;  4Z90 A;  3UQ7 A;  3SIO A;  2BYP A;  3UQ4 A;  4LML A;  5J5I A;  4DBM A;  3TLU A;  2WNC A;  3WTH A;  2W8G A;  2QC1 B;  3C84 A;  2XZ5 A;  3GUA A;  3RQU A;  4UM3 P;  4AFH A;  2BG9 E;  4UM3 S;  2XNT A;  2X00 A;  5HEG A;  1UX2 A;  5L4E A;  3WTI A;  2X00 D;  3JAF A;  2BJ0 A;  2XQ6 A;  4TNW A;  3EHZ A;  3WTJ A;  2YKS A;  3ZDG A;  4HQP A;  4X5T A;  4QH5 A;  5J5F A;  2W8F A;  2XQ4 A;  2WNJ A;  5HCJ A;  1UV6 A;  2BG9 A;  4ILB A;  4QAC A;  2XQ9 A;  5HEO A;  2XQ7 A;  3PMZ A;  3UU4 A;  4BQT A;  3EAM A;  5J5H A;  5J0Z A;  2BYR A;  3RHW A;  4QAA A;  2Y56 A;  3JAE A;  4PIR A;  4TNV A;  4AFG A;  5L47 A;  4ZZB A;  4UY2 A;  5BP0 A;  4NZB A;  4BFQ A;  4HFC A;  3SH1 A;  2YN6 A;  2BYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...