2XQ5A

Pentameric ligand gated ion channel glic in complex with tetraethylarsonium (teas)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
total genus 74
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq5A01
2X00D 4HFHA 3EAMA 2XQ3A 2XYSA 3C79A 2XQ6A 2YN6A 2WNJA 3WTLA 5FJVA 4XHEA 4EZ1A 5AINA 2Y7YA 4DBMA 5AFMB 4WV9A 2BG9A 5L4HA 4UM3A 3U8KA 3PMZA 2XQAA 3JAEA 4QH4A 2X00A 2Y57A 3WTMA 3WIPA 4AFGA 3TLWA 2C9TA 2XNTA 3UU5A 4Z90A 4A97A 2XQ4A 3UU8A 5J5IA 3SIOA 4TWFA 3UU3A 2UZ6A 4LMLA 4ZZCA 3JAFA 1UX2A 4UXUA 5J0ZA 3PEOA 2XNVA 4AFTA 5AFKA 4UM3P 4A98A 2WNLA 2XNUA 2MAWA 2BYPA 2XZ6A 5HEJA 2YMEA 3U8MA 5BP0A 2ZJUA 4ZK4A 3UUBA 5HEHA 4HFBA 4ILAA 3GUAA 2WNCA 3WTIA 3ZKRA 1UW6A 2LKHA 4ILBA 4TWDA 1OEDC 4ALXA 5TVCA 2BR7A 5CO5A 3RIFA 5IUXA 4ILCA 4ZRUA 2W8FA 3T4MA 5LXBA 4QH5A 2YMDA 4HQPA 3RQUA 2XQ9A 5L4EA 3UQ4A 4HFEA 2XQ5A 3U8JA 3RI5A 4D01A 1OEDB 3WTJA 2BG9E 2VL0A 4UY2A 3U8LA 5HEGA 4TWHA 3UQ7A 3TLTA 4TNWA 4LMJA 4HFDA 3IGQA 2M6IA 3C84A 2M6BA 3JADA 4UM1A 4NZBA 2LM2A 2BR8A 4F8HA 3WTHA 4HFCA 3U8NA 2LLYA 5CFBA 3EI0A 5AFLA 2Y54A 4XK9A 2BYQA 4B5DA 4QACA 1OEDA 1I9BA 4QH1A 5SYOA 2YOEA 2PH9A 3TLVA 2Y56A 4Z91A 2BJ0A 5AFHA 5J5GA 3UU4A 2W8GA 3WTOA 3TLUA 4BQTA 4QAAA 4IL9A 4TNVA 2BYNA 3LSVA 5KE4A 2ZJVA 2QC1B 4X5TA 4AFHA 3ZDHA 2WN9A 5LG3A 5AFNA 4ZJSA 4PIRA 3SQ6A 5JMEA 4NPPA 4LMKA 4QABA 3UU6A 5AFJA 3P4WA 2PGZA 3WTNA 4ZR6A 5KZUA 5J5FA 4IREA 2BYSA 2BYRA 2WZYA 5L47A 3SQ9A 4FRRA 4ZZBA 4ZJTA 4ZK1A 3WTKA 4UM3S 2XQ7A 2BG9C 3EHZA 1UV6A 3ZDGA 4BFQA 2XQ8A 5HCJA 3P50A 5HCMA 5HEOA 5BRXA 2YKSA 3RIAA 3RHWA 4COFA 1OEDE 4IL4A 5AFMA 3SH1A 3RQWA 2XYTA 2Y58A 2XZ5A 5J5HA 2BG9B 2KSRA 2LKGA 3TLSA 5HEUA 5BW2A 4HFIA
chains in the Genus database with same CATH superfamily
2X9YA 2FUPA 2XYSA 1T72A 2XQ6A 3S4UA 3ONJA 3WTLA 5KDMC 4YJ3E 4WV9A 2YDQA 3NRXA 2NWBA 3LK3B 5JQGE 4ZHQE 4JI8T 2K9AA 3F2EA 3UU8A 2XM2A 1HX1B 4ZXLA 4BJNA 2XNVA 1SUMB 1IBKT 3DJBA 1Z8UA 3UFGA 3ZKRA 3K8PC 4ALXA 5H6RB 5TVCA 1UCUA 2VWAA 2V6YA 2LT3A 3P4SA 2Q9QA 4HFEA 5JTGA 3AE1A 3U78A 4HKAA 3KDSE 3ZMZB 2M6IA 1ZP0A 3RIUC 2LM2A 5C2TA 3KFWX 3FZFB 3D0TA 4E7SA 2B1EA 4OYJA 4LFAT 3IHRA 1ZEEA 3UU4A 5AQMB 2WDRA 4X5TA 5J1GA 1US7B 5JMEA 4CI2B 5GONE 1MNDA 2UUCT 3N9LA 3SQ9A 2VKHA 2XAJB 3PUZF 1UV6A 5FY1A 3OBVE 3QB5A 5LYJE 3CQGB 1D1CA 2KMFA 3ZYMA 4DR5T 2VKOA 4CXXA 1J5WA 1V9DA 4WYVA 5LA6E 2VASA 5AFMA 1BR2A 1Y64B 1LVKA 2YN6A 4EEDA 2NTYA 4XHEA 2IAKA 5AINA 2ZM2A 1WYBA 2JRKA 3T8OA 4H9PC 2YU2A 4O4LE 4PFPA 2WWVA 4LMLA 5FKYA 1IJ6A 2WNLA 4JI5T 4FI5A 3U8MA 4H9SE 3O4XE 2X9WA 2IUBA 2VVSA 4J2CA 5CO5A 5IUXA 1HG2A 1WLXA 5LXBA 3RYHE 3RI5A 3L8RA 4DUZT 3HKCE 5EK4A 3NBXX 1XNRT 4F8HA 3Q9DA 3FBZA 2UXDT 1BR4A 4QH1A 3ONXA 2Y56A 4IDZA 2J47A 2V7KA 4P0BA 3BQKA 4UF0A 2Y8DA 2F4VT 4NPPA 2ZLYA 2KNDA 2BS4A 5HAXA 3CMLA 2A2FX 3AB3B 3CK6A 3LJCA 4DMVA 1T8BA 3I9WA 5ABGA 4DV4T 1X79A 3A8YC 4QX7B 3ABVA 3RF1A 1SHZC 5JDNA 1B7TA 3U8KA 2XQAA 5AQPB 3ZPOA 4QH4A 2X00A 2JMHA 2W63A 4DV1T 4A97A 3MJXA 3T1YT 2XQ4A 3BK9A 3UU3A 4UXUA 2D2SA 4QX8B 3KVBA 2YMEA 3GUAA 1H7CA 4NIQA 4JEUB 4HWCA 3X1DA 3O1JA 4H9RC 5A1LA 1HTJF 2YMDA 4JV5T 3ZCIA 4UVAB 2W62A 5JRCB 2H88A 3OVUA 4GYSA 2I0MA 2JQ9A 4D01A 3AA1B 2OLTA 2IDOB 4O4IE 4TWHA 4EAHA 2XY8B 2W61A 3ZT7A 3KV9A 2C5KT 3UULA 2VQFT 2DI4A 1JNZA 2NR4A 4GOUA 3VR9A 2IW5B 3WTOA 4TNVA 2IMLA 5L3EB 2V1DB 4CN4A 4IE6A 3SQ6A 3UU6A 2WZHA 2C5JA 4HWIB 3M65A 4ZJTA 2CWOA 2XUEA 1U4QA 2V7JA 2LHNA 4IE4A 4YTPA 4L9IA 2QRXA 2K24A 2W2UA 3PU8A 2VURA 4ZOLE 1OXZA 3SS1A 5AFMB 2BBHA 5LGUB 3AAIA 3TLWA 5LB7B 4Z90A 4TWFA 2WBLA 5AQFB 4IGUA 5HEJA 3KVAA 3BQIA 3UUBA 2H7VC 1BR0A 4UR9A 2LKHA 3U3IA 4MALA 1U5PA 2QA7A 3AAEB 2QGSA 4CN6A 3SFDA 4X64T 2XAHB 1W09A 1W9RA 4QWNB 3HKEE 3WTJA 2CMRA 2W0GA 1ZV4X 4JI7T 5L3BB 3U8LA 5HEGA 5LHIB 5FNVE 5AQQB 2V7MA 5LHGB 5JR9B 2LLYA 1KEYA 4QACA 3AEFA 2H89A 2HPJA 3ONLC 3DTOA 4B6XA 2IIUA 4V1Av 2ZJVA 5AQTB 2J1DG 4AISA 2I59A 1WRDA 3N9QA 4CN1A 4QABA 1SA0E 4WBOA 3RX6A 2YEVC 3F31A 2JIWA 2XAFB 2XQ7A 4TV9E 3FZMB 2ZMAA 4UEMA 3RIUA 4YFSA 4CI3B 4AKLA 3FZLB 3RLFF 1UX4A 4HGAA 2NOXA 2X00D 2K5BB 5AQIB 5ABHA 4I43B 5J2TE 1HG5A 2PFVA 4AFGA 4AQFA 1N36T 2XNTA 1QUUA 4XBFB 3MZKB 1D1BA 1YQ4A 3TKLB 3CQXC 2LOPA 3LFMA 3KV6A 1T7SA 4ANJA 2EHOC 2MTQA 3OKQA 2WP9A 3W15B 2LM9A 4EYUA 4JI3T 2DHRA 5BR8T 4L5GA 1CHUA 3C4ZA 4HEAA 2DNXA 2NW7A 2E9XA 4UY2A 2LSGA 3OJAA 3VKGA 4UV8B 4ZI3C 3C84A 3ZN1B 3JADA 4UM1A 3EVYA 3JC6D 3U8NA 2Q9QC 2WS3A 5FVKA 2V6XA 5H6QB 4NXNT 1OWAA 4X62T 4UVCB 1XMQT 2X67A 2PH9A 3GWHA 3ZJ1A 2BJ0A 5AQRB 4IHJE 3V5SA 5HXSA 5AQOB 5JDQA 3ZMVB 2CBIA 3G06A 3UUNA 4NXMT 4OX9T 4M1PA 2CCQA 3ZT5A 3EHZA 4ZI7E 2LSKA 2JMKA 3P50A 3RGLA 1AJ3A 3RKOA 2VKJA 4IDNA 4PJNA 1OEDE 2Y48B 4H9QC 2LKGA 1ZHCA 3MXZA 2CBJA 2LRLA 4U7IA 4HFHA 3EAMA 5FMNA 5FY7A 2PJQA 2X0YA 3CKDA 3CX7B 3WI3A 4B3RT 4YTNA 3UU5A 4YSYA 3PEOA 3IBPA 4U31A 3C98B 4O2AE 4OFZA 4WZXA 2HH7A 3SRZA 4ILUA 5FVLA 1W0AA 2XAQB 1NEKA 4KP3C 4PAGA 5L4EA 4YHHT 3P4QA 3U8JA 3N9PA 2VVNA 4UXNB 3N9OA 2WDQA 4PJLA 4JI4T 2AE9A 2BKOA 4JI2T 4PW8A 2BKPA 5JVDE 1IBMT 5JRCA 1N32T 4DR3T 4DBQA 3EDVA 4ZEYA 5DQWA 2QC1B 3C4XA 3AXJA 2R6GF 1N34T 3QC9A 4LMKA 3RKGA 2PGZA 1DU2A 1HNZT 1O3XA 4UM3S 2AXDS 4I55E 4KMCA 5L3FB 4K0KT 2SPCA 4AXPA 2GK9A 3PDYA 3NZPA 3SH1A 2XYTA 4LF6T 3AE3A 3EABA 2YDRA 2B76A 1LKXA 3LG7A 2WWUA 5CB4E 3JAEA 1HX8A 4LFBT 4ISTA 1KK7A 1FMWA 4KHPT 4EEBA 4P09A 4UIGA 2N9DA 2ACXA 2YINA 4QXHB 2BYPA 3GA8A 1M7KA 2CA5A 3LBXA 4UF0B 4YTMA 2W8FA 1MIYA 3UQ4A 1SE7A 3VR8A 3VU7H 1UUSA 3PURA 2EHOA 4YY3T 2W4XA 1L0VA 2UU9T 2M6BA 3UTKA 2LEHA 2LE8A 4GIWA 2N1GA 5BMVE 2WU2A 5AQSB 2E8IA 2YU1A 4KHZF 3N2GE 4DR1T 4BQTA 2XJ7A 2NP9A 1YKHB 4JI0T 2UXXB 5HWXA 5FP3A 4AKGA 2LJLA 5HXRA 2LHRA 3WTNA 4ZR6A 2X0LB 2BYSA 4ZK1A 4BFQA 1XMOT 2XM1A 4EOZB 5JDLA 5HWYA 1MMAA 3C64A 3QK6A 2V7IA 2FJEA 2VK9A 2UUBT 4B3MT 4DR7T 3L3PA 1VOMA 3O1HA 3PJAA 4JI6T 2Y7YA 4EV6A 2WZIA 3I1AA 1HFAA 2C9TA 3Q5EA 4U74A 3AE6A 2BDEA 4EB6E 2CEAA 4FJOA 4ZI2D 3N2OA 4AFTA 3VRBA 1XDPA 2E9XD 3FZKB 3PU3A 3ZMSB 3AECA 3O1IA 2Z6EA 4IT4A 3H3MA 4HWFA 1D0ZA 2BVLA 4X66T 2RA1A 2XHEB 5DABA 4QHOA 2E2AA 4K0UA 3K3OA 2YOEA 4O4JE 2RPAA 4Z91A 1G8XA 2W8GA 2NTXA 3TLUA 2BYNA 3LSVA 4E7ZA 3AEBA 4AFHA 4TN7B 2E9XC 4PNIA 3QUJA 4ZI2C 4CXYA 5LG4A 2UUAT 4X20E 5EZYE 2HHHT 1HCIA 2BYRA 4ZZBA 2KXPB 4B3TT 4PJJA 2HN1A 5HEOA 4LF9T 2X9HA 3Q5XA 3EUHA 5HEUA 4JBWF 3AE2A 3KINB 2XQ3A 3CPZA 4EXTA 4HN9A 3AA6B 2BBJA 5J2UE 3VRAA 5L2LA 3AAAB 1XNQT 4DR6T 3C51A 2V8SV 1HF8A 3LDQB 3GMIA 3IF8B 3PUAA 1NENA 3FBLA 2WM9A 4ZZCA 4JYAT 2PBIA 3J9X1 2PG8A 2XAGB 3KBTA 2LSJA 2ZJUA 4LF8T 2YK0A 5HEHA 4ZK4A 4DIDB 4HTEA 4DV2T 4H9OC 4MBQA 3AE5A 2WCAA 5IWAT 4QH5A 2L8KA 5F5WA 4CI1B 2OV9A 3AE8A 4DUYT 3ZSSA 2A3DA 3N9NA 5HXHA 2XQ9A 3WAJA 2BVMA 4I4TE 3QOFA 5FXVA 5FXXA 3PUWF 1LVFA 4NZBA 2BR8A 2DL1A 4LF7T 3OYZA 4EZ4A 5ETWA 5FXWA 5LMNT 2BYQA 2LSIA 2X68A 3QNUA 3RYIE 4I0UA 5HXEA 2DLRA 2KZ7B 2CXFA 1YQ3A 3N9MA 2LRKA 2CE7A 1I6ZA 3P4WA 2MBGA 2L3LA 4OK0A 4U2YA 3P4PA 4FRRA 2BG9C 4X1KE 2ACZA 5BRXA 4UELA 5J5HA 5LCYA 4B3ST 2BG9B 3GN5A 1UX2A 5KMGP 3F57A 4EZ1A 1E7PA 2P9BA 5DJQC 4QXBB 3Q2MA 4PK4A 4IDOA 2W00A 5J5IA 4AQGA 2UZ6A 3JAFA 4XAXB 4DO0A 2XNUA 2MAWA 1YW0A 2LSYA 2WB5A 5L3GB 4P0AA 5LGNB 4Z8XA 3T4MA 5AQLB 4HQPA 3RQUA 4LFCT 3PUXF 2ODVA 5ABFB 3K1SA 2VL0A 2CXLA 1Y01A 1XDOA 4TNWA 3AEEA 2KWHA 4ISSA 2JPFA 2J4GA 1BR1A 3ZYLA 4XK9A 5LJNA 1FIOA 3AEGA 1UURA 1GQEA 2K48A 1IBLT 2UXCT 4ERRA 1NWMX 3PUVF 3LK2B 2VKDA 4IL9A 2H3RA 5LBQB 3H37A 2XSBA 4NUVA 1UGOA 5JR9A 3RYCE 2WY2A 2H7OA 4IIJE 4X1IE 3MKDA 5AFUL 4H63V 1J1JA 5LGTB 4MLKA 2Y58A 5LJMA 3CVRA 1WR6A 4GK0E 5JDMA 3ETVA 3AVSA 3NVOA 1YXRA 4GKJT 5AQGB 4ZS3A 1WYCA 2XASB 3ZC1A 1VRBA 4DR4T 1D1AA 4U33A 4QXCB 5AFKA 1KNPA 5HYAA 4U2ZA 1MIWA 2MYSA 4DMWA 3B13A 4U3CA 3N2KE 2WNCA 4DBRA 1OEDC 4YSZA 4Q25A 2Q9QD 2XQ5A 3JC6C 1S35A 1OEDB 4AIUA 5AQKB 4O4HE 3PUYF 3IGQA 3AA7B 1E2AA 4TUYE 3K3NA 2BZBA 3H3AA 4KI0F 2D0UA 5CFBA 4QKNA 5ABFA 4ADZA 3QB5K 3E0ZA 3TLVA 5AFHA 2V5DA 1XZYA 2JQKA 2QYWA 3FXDB 1HS7A 1W0BA 1X9BA 3Q5WA 1JNRA 5LMUT 4X65T 3FHNA 5AFJA 4KUMB 2LOSA 2IHR1 2WZYA 1HR0T 2C5IT 3CQCB 5FYMA 1HNWT 2D5UA 3RIAA 1R8IA 4O8SA 3RHWA 4XZCA 2XZ5A 3LBXB 5BW2A 4HFIA 3PJAJ 3RRWA 3C79A 2XZEA 4BJMA 2WMNA 5LP6E 2X51A 2BG9A 3GN5B 3IA3A 4ZS2A 5FY0A 4DVDA 4JI1T 2FJDA 4WBNE 4IE5A 3K3QC 4KBMB 2OA5A 5JH7E 4UM3P 4DV5T 3FB2A 3UUXB 1UW6A 2W67A 5KXJA 4BA9A 3BQLA 3M3ZB 3I0OA 5JDFA 3AE9A 1IAPA 4ILCA 1WCRA 4C90A 3NZQA 2V5CA 5AQUB 4JLEA 4PJMA 3VKHA 3WTHA 4DV3T 4AKHA 2CRBA 4B5DA 2VB6A 1I9BA 4H9NC 3IEEA 3RRCA 1WFDA 4YT0A 5KE4A 5LXTE 3AA0B 3PV0F 2JQHA 2C0SA 3T1HT 3PUQA 2WN9A 1ZOYA 4PIRA 3N5LA 1G73A 4DV0T 1MMDA 3ZMTB 5J5FA 1XWMA 2MPKA 4GK5E 3WTKA 2J62A 4MFRA 2BS2A 4OHFA 2ZM6T 4COFA 4IL4A 2HN2A 4WNKA 4U7YA 4L0RA 3LK42 2KSRA 4G2AA 3SFEA 3ZN0B 5F8PA 3NKZA 4YHJA 4TV8E 2NW8A 3PMZA 3HL6A 3WTMA 2X0HA 3NWIA 3SIOA 4DV6T 2WSSV 5FL1A 4JUYA 5M4YA 3UT5E 2V26A 2XZ6A 5TAOA 1UK5A 4HFBA 4EZHA 3O9XA 4CZZB 3L09A 2X66A 4ZRUA 2XQYA 3FZHB 4IE7A 3B57A 4A5XA 2KT9A 1D0YA 3RYFE 5HXCA 4HFDA 1Z0PA 4GYRA 3I9YA 3ZCJA 5AFLA 1KF6A 4I50E 3MK7C 4QAAA 3UFEA 2V7LA 4HFVA 5AFNA 2PTFA 4ZJSA 4HWDA 5KZUA 2E9XB 4IREA 5L47A 3ETUA 4PFOA 1ZKEA 2Q9QB 3ZT6A 1WR0A 2XQ8A 3ZJ2A 5AQJB 2X9XA 3CWZB 5EK2A 2V6YB 5AQHB 3PUSA 5DQVA 4ZI3D 2BKNA 1KFYA 2ZM8A 4WW0A 2IC9A 4U72A 3AVRA 2WNJA 1KNRA 5JDGA 4EGWA 5FJVA 3RC8A 2Y6XA 1IJ5A 2DWGA 4DBMA 2YDSA 4AKRB 5L4HA 5IHYA 3MACA 4OYKA 4CXWA 4KX6A 2KLQA 5CA0E 2E5LT 2UXBT 4PK6A 4G63A 5J0ZA 3Q5DA 5C3JA 4YJ2E 1MIVA 3DP7A 4ILAA 4ILBA 1MNEA 3P4RA 2CPTA 4UV9B 3RIFA 3C4WA 5EK3A 3CX8B 2K3WA 4IDQA 4IE0A 1QLBA 2D9DA 3UQ7A 4LMJA 5CA1E 3HKDE 3ZMUB 4HWHA 3KBUA 2EHOB 2CHNA 3EI0A 3OYXA 3P7IA 4AI6A 1OEDA 5CJ5A 3RC3A 5L3DB 2VL8A 1KNZA 3EDUA 4YSXA 2FJAA 3J7Yq 3WAKA 2CLYC 2IC6A 2CXDA 4AQYT 1D0XA 4GKKT 3E08A 5HCJA 1I94T 3I0QA 2VQET 1CUNA 3HKBE 3RQWA 4F6RC 1J5ET 2WMOA 2UXNB 3ZC0A 4H63H 2N2NA 4DV7T 3KV4A 3OTOT 3L39A 1T98A 3PUGA 3WIPA 3R84B 1FEWA 5LOVE 4O2BE 2CHOA 2G0UA 2HPLA 3B5MA 4LF4T 2JJ9A 2KINB 3AXJB 4JEHB 3E22E 1N33T 2DWKA 4AKIA 1YKEB 5AQNB 5JR9C 4MHCA 3RH3A 3MA9A 5ABEA 2QVAA 3NRYA 5LBMA 3ANWA 5L3CB 1IZNB 3VHLA 2WDVA 1M62A 3FXEB 1QSDA 3V5UA 2WU5A 3ANWB 2XSAA 5LG3A 2CLYB 3AE4A 1MMNA 1S94A 4HE8A 2FBWA 2CM0A 1FMVA 2A72A 3OPCA 1UX5A 1VCSA 1YD8G 5HCMA 2YKSA 1FJGT 4EYYR 4PK5A 2KWIB 5KX5E 5JREA 4C91A 3UUMA 5LHHB 3AEAA 3A5XA 4IDPA 4LF5T 3C50A 4UM3A 2WQYA 2DCFA 3KV5A 2Y57A 3ZLIA 2ZM0A 1EZ3A 4CQIA 4TX5A 4YXDA 1VCTA 3HI2A 2E5VA 3CX6B 5JDHA 4A98A 4NUUA 2XTLA 4A56A 5BP0A 3AE7A 3JCFA 3R6NA 3WTIA 4TWDA 1E1HB 2WAUA 2BR7A 5LNKA 1HNXT 5F3JA 3ZSTA 5CGMA 3ZEFB 4AQFC 4UVBB 2BG9E 3AEDA 4ASKA 4TZ4C 2JQQA 3TLTA 1NAFA 5ADXL 3ESLA 4HFCA 4DR2T 3CIRA 4DNDA 3A7MA 3P8CD 2Y54A 3SWHA 5C8YE 4N78D 2I6HA 2EHOD 5SYOA 2D0TA 2ODUA 5J5GA 1LRZA 5FL0A 2ES0A 2M67A 4P1NA 3RPUA 5E0OA 5FXZA 3ZDHA 3SOLA 3HA4A 3ZYKA 2RP4A 4YLHA 2XPKA 5AQVB 3PE0A 2A9UA 3HR0A 2W66A 3ZDGA 2NW9A 3PTRB 2L9QA 5IYZE 2FJBA 2BS3A 4EIWA 4X1YE 1MMGA 2CWYA 2MOZA 3TLSA 4BAYB
chains in the Genus database with same CATH topology
2X00D 4HFHA 3EAMA 2XQ3A 2XYSA 3C79A 2XQ6A 2YN6A 2WNJA 3WTLA 5FJVA 4XHEA 4EZ1A 5AINA 2Y7YA 4DBMA 5AFMB 4WV9A 2BG9A 5L4HA 4UM3A 3U8KA 3PMZA 2XQAA 3JAEA 4QH4A 2X00A 2Y57A 3WTMA 3WIPA 4AFGA 3TLWA 2C9TA 2XNTA 3UU5A 4Z90A 4A97A 2XQ4A 3UU8A 5J5IA 3SIOA 4TWFA 3UU3A 2UZ6A 4LMLA 4ZZCA 3JAFA 1UX2A 4UXUA 5J0ZA 3PEOA 2XNVA 4AFTA 5AFKA 4UM3P 4A98A 2WNLA 2XNUA 2MAWA 2BYPA 2XZ6A 5HEJA 2YMEA 3U8MA 5BP0A 2ZJUA 4ZK4A 3UUBA 5HEHA 4HFBA 4ILAA 3GUAA 2WNCA 3WTIA 3ZKRA 1UW6A 2LKHA 4ILBA 4TWDA 1OEDC 4ALXA 5TVCA 2BR7A 5CO5A 3RIFA 5IUXA 4ILCA 4ZRUA 2W8FA 3T4MA 5LXBA 4QH5A 2YMDA 4HQPA 3RQUA 2XQ9A 5L4EA 3UQ4A 4HFEA 2XQ5A 3U8JA 3RI5A 4D01A 1OEDB 3WTJA 2BG9E 2VL0A 4UY2A 3U8LA 5HEGA 4TWHA 3UQ7A 3TLTA 4TNWA 4LMJA 4HFDA 3IGQA 2M6IA 3C84A 2M6BA 3JADA 4UM1A 4NZBA 2LM2A 2BR8A 4F8HA 3WTHA 4HFCA 3U8NA 2LLYA 5CFBA 3EI0A 5AFLA 2Y54A 4XK9A 2BYQA 4B5DA 4QACA 1OEDA 1I9BA 4QH1A 5SYOA 2YOEA 2PH9A 3TLVA 2Y56A 4Z91A 2BJ0A 5AFHA 5J5GA 3UU4A 2W8GA 3WTOA 3TLUA 4BQTA 4QAAA 4IL9A 4TNVA 2BYNA 3LSVA 5KE4A 2ZJVA 2QC1B 4X5TA 4AFHA 3ZDHA 2WN9A 5LG3A 5AFNA 4ZJSA 4PIRA 3SQ6A 5JMEA 4NPPA 4LMKA 4QABA 3UU6A 5AFJA 3P4WA 2PGZA 3WTNA 4ZR6A 5KZUA 5J5FA 4IREA 2BYSA 2BYRA 2WZYA 5L47A 3SQ9A 4FRRA 4ZZBA 4ZJTA 4ZK1A 3WTKA 4UM3S 2XQ7A 2BG9C 3EHZA 1UV6A 3ZDGA 4BFQA 2XQ8A 5HCJA 3P50A 5HCMA 5HEOA 5BRXA 2YKSA 3RIAA 3RHWA 4COFA 1OEDE 4IL4A 5AFMA 3SH1A 3RQWA 2XYTA 2Y58A 2XZ5A 5J5HA 2BG9B 2KSRA 2LKGA 3TLSA 5HEUA 5BW2A 4HFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X00 D;  4HFH A;  3EAM A;  2XQ3 A;  2XYS A;  3C79 A;  2XQ6 A;  2YN6 A;  2WNJ A;  3WTL A;  5FJV A;  4XHE A;  4EZ1 A;  5AIN A;  2Y7Y A;  4DBM A;  5AFM B;  4WV9 A;  2BG9 A;  5L4H A;  4UM3 A;  3U8K A;  3PMZ A;  2XQA A;  3JAE A;  4QH4 A;  2X00 A;  2Y57 A;  3WTM A;  3WIP A;  4AFG A;  3TLW A;  2C9T A;  2XNT A;  3UU5 A;  4Z90 A;  4A97 A;  2XQ4 A;  3UU8 A;  5J5I A;  3SIO A;  4TWF A;  3UU3 A;  2UZ6 A;  4LML A;  4ZZC A;  3JAF A;  1UX2 A;  4UXU A;  5J0Z A;  3PEO A;  2XNV A;  4AFT A;  5AFK A;  4UM3 P;  4A98 A;  2WNL A;  2XNU A;  2MAW A;  2BYP A;  2XZ6 A;  5HEJ A;  2YME A;  3U8M A;  5BP0 A;  2ZJU A;  4ZK4 A;  3UUB A;  5HEH A;  4HFB A;  4ILA A;  3GUA A;  2WNC A;  3WTI A;  3ZKR A;  1UW6 A;  2LKH A;  4ILB A;  4TWD A;  1OED C;  4ALX A;  5TVC A;  2BR7 A;  5CO5 A;  3RIF A;  5IUX A;  4ILC A;  4ZRU A;  2W8F A;  3T4M A;  5LXB A;  4QH5 A;  2YMD A;  4HQP A;  3RQU A;  2XQ9 A;  5L4E A;  3UQ4 A;  4HFE A;  2XQ5 A;  3U8J A;  3RI5 A;  4D01 A;  1OED B;  3WTJ A;  2BG9 E;  2VL0 A;  4UY2 A;  3U8L A;  5HEG A;  4TWH A;  3UQ7 A;  3TLT A;  4TNW A;  4LMJ A;  4HFD A;  3IGQ A;  2M6I A;  3C84 A;  2M6B A;  3JAD A;  4UM1 A;  4NZB A;  2LM2 A;  2BR8 A;  4F8H A;  3WTH A;  4HFC A;  3U8N A;  2LLY A;  5CFB A;  3EI0 A;  5AFL A;  2Y54 A;  4XK9 A;  2BYQ A;  4B5D A;  4QAC A;  1OED A;  1I9B A;  4QH1 A;  5SYO A;  2YOE A;  2PH9 A;  3TLV A;  2Y56 A;  4Z91 A;  2BJ0 A;  5AFH A;  5J5G A;  3UU4 A;  2W8G A;  3WTO A;  3TLU A;  4BQT A;  4QAA A;  4IL9 A;  4TNV A;  2BYN A;  3LSV A;  5KE4 A;  2ZJV A;  2QC1 B;  4X5T A;  4AFH A;  3ZDH A;  2WN9 A;  5LG3 A;  5AFN A;  4ZJS A;  4PIR A;  3SQ6 A;  5JME A;  4NPP A;  4LMK A;  4QAB A;  3UU6 A;  5AFJ A;  3P4W A;  2PGZ A;  3WTN A;  4ZR6 A;  5KZU A;  5J5F A;  4IRE A;  2BYS A;  2BYR A;  2WZY A;  5L47 A;  3SQ9 A;  4FRR A;  4ZZB A;  4ZJT A;  4ZK1 A;  3WTK A;  4UM3 S;  2XQ7 A;  2BG9 C;  3EHZ A;  1UV6 A;  3ZDG A;  4BFQ A;  2XQ8 A;  5HCJ A;  3P50 A;  5HCM A;  5HEO A;  5BRX A;  2YKS A;  3RIA A;  3RHW A;  4COF A;  1OED E;  4IL4 A;  5AFM A;  3SH1 A;  3RQW A;  2XYT A;  2Y58 A;  2XZ5 A;  5J5H A;  2BG9 B;  2KSR A;  2LKG A;  3TLS A;  5HEU A;  5BW2 A;  4HFI A; 
#chains in the Genus database with same CATH topology
 2X9Y A;  2FUP A;  2XYS A;  1T72 A;  2XQ6 A;  3S4U A;  3ONJ A;  3WTL A;  5KDM C;  4YJ3 E;  4WV9 A;  2YDQ A;  3NRX A;  2NWB A;  3LK3 B;  5JQG E;  4ZHQ E;  4JI8 T;  2K9A A;  3F2E A;  3UU8 A;  2XM2 A;  1HX1 B;  4ZXL A;  4BJN A;  2XNV A;  1SUM B;  1IBK T;  3DJB A;  1Z8U A;  3UFG A;  3ZKR A;  3K8P C;  4ALX A;  5H6R B;  5TVC A;  1UCU A;  2VWA A;  2V6Y A;  2LT3 A;  3P4S A;  2Q9Q A;  4HFE A;  5JTG A;  3AE1 A;  3U78 A;  4HKA A;  3KDS E;  3ZMZ B;  2M6I A;  1ZP0 A;  3RIU C;  2LM2 A;  5C2T A;  3KFW X;  3FZF B;  3D0T A;  4E7S A;  2B1E A;  4OYJ A;  4LFA T;  3IHR A;  1ZEE A;  3UU4 A;  5AQM B;  2WDR A;  4X5T A;  5J1G A;  1US7 B;  5JME A;  4CI2 B;  5GON E;  1MND A;  2UUC T;  3N9L A;  3SQ9 A;  2VKH A;  2XAJ B;  3PUZ F;  1UV6 A;  5FY1 A;  3OBV E;  3QB5 A;  5LYJ E;  3CQG B;  1D1C A;  2KMF A;  3ZYM A;  4DR5 T;  2VKO A;  4CXX A;  1J5W A;  1V9D A;  4WYV A;  5LA6 E;  2VAS A;  5AFM A;  1BR2 A;  1Y64 B;  1LVK A;  2YN6 A;  4EED A;  2NTY A;  4XHE A;  2IAK A;  5AIN A;  2ZM2 A;  1WYB A;  2JRK A;  3T8O A;  4H9P C;  2YU2 A;  4O4L E;  4PFP A;  2WWV A;  4LML A;  5FKY A;  1IJ6 A;  2WNL A;  4JI5 T;  4FI5 A;  3U8M A;  4H9S E;  3O4X E;  2X9W A;  2IUB A;  2VVS A;  4J2C A;  5CO5 A;  5IUX A;  1HG2 A;  1WLX A;  5LXB A;  3RYH E;  3RI5 A;  3L8R A;  4DUZ T;  3HKC E;  5EK4 A;  3NBX X;  1XNR T;  4F8H A;  3Q9D A;  3FBZ A;  2UXD T;  1BR4 A;  4QH1 A;  3ONX A;  2Y56 A;  4IDZ A;  2J47 A;  2V7K A;  4P0B A;  3BQK A;  4UF0 A;  2Y8D A;  2F4V T;  4NPP A;  2ZLY A;  2KND A;  2BS4 A;  5HAX A;  3CML A;  2A2F X;  3AB3 B;  3CK6 A;  3LJC A;  4DMV A;  1T8B A;  3I9W A;  5ABG A;  4DV4 T;  1X79 A;  3A8Y C;  4QX7 B;  3ABV A;  3RF1 A;  1SHZ C;  5JDN A;  1B7T A;  3U8K A;  2XQA A;  5AQP B;  3ZPO A;  4QH4 A;  2X00 A;  2JMH A;  2W63 A;  4DV1 T;  4A97 A;  3MJX A;  3T1Y T;  2XQ4 A;  3BK9 A;  3UU3 A;  4UXU A;  2D2S A;  4QX8 B;  3KVB A;  2YME A;  3GUA A;  1H7C A;  4NIQ A;  4JEU B;  4HWC A;  3X1D A;  3O1J A;  4H9R C;  5A1L A;  1HTJ F;  2YMD A;  4JV5 T;  3ZCI A;  4UVA B;  2W62 A;  5JRC B;  2H88 A;  3OVU A;  4GYS A;  2I0M A;  2JQ9 A;  4D01 A;  3AA1 B;  2OLT A;  2IDO B;  4O4I E;  4TWH A;  4EAH A;  2XY8 B;  2W61 A;  3ZT7 A;  3KV9 A;  2C5K T;  3UUL A;  2VQF T;  2DI4 A;  1JNZ A;  2NR4 A;  4GOU A;  3VR9 A;  2IW5 B;  3WTO A;  4TNV A;  2IML A;  5L3E B;  2V1D B;  4CN4 A;  4IE6 A;  3SQ6 A;  3UU6 A;  2WZH A;  2C5J A;  4HWI B;  3M65 A;  4ZJT A;  2CWO A;  2XUE A;  1U4Q A;  2V7J A;  2LHN A;  4IE4 A;  4YTP A;  4L9I A;  2QRX A;  2K24 A;  2W2U A;  3PU8 A;  2VUR A;  4ZOL E;  1OXZ A;  3SS1 A;  5AFM B;  2BBH A;  5LGU B;  3AAI A;  3TLW A;  5LB7 B;  4Z90 A;  4TWF A;  2WBL A;  5AQF B;  4IGU A;  5HEJ A;  3KVA A;  3BQI A;  3UUB A;  2H7V C;  1BR0 A;  4UR9 A;  2LKH A;  3U3I A;  4MAL A;  1U5P A;  2QA7 A;  3AAE B;  2QGS A;  4CN6 A;  3SFD A;  4X64 T;  2XAH B;  1W09 A;  1W9R A;  4QWN B;  3HKE E;  3WTJ A;  2CMR A;  2W0G A;  1ZV4 X;  4JI7 T;  5L3B B;  3U8L A;  5HEG A;  5LHI B;  5FNV E;  5AQQ B;  2V7M A;  5LHG B;  5JR9 B;  2LLY A;  1KEY A;  4QAC A;  3AEF A;  2H89 A;  2HPJ A;  3ONL C;  3DTO A;  4B6X A;  2IIU A;  4V1A v;  2ZJV A;  5AQT B;  2J1D G;  4AIS A;  2I59 A;  1WRD A;  3N9Q A;  4CN1 A;  4QAB A;  1SA0 E;  4WBO A;  3RX6 A;  2YEV C;  3F31 A;  2JIW A;  2XAF B;  2XQ7 A;  4TV9 E;  3FZM B;  2ZMA A;  4UEM A;  3RIU A;  4YFS A;  4CI3 B;  4AKL A;  3FZL B;  3RLF F;  1UX4 A;  4HGA A;  2NOX A;  2X00 D;  2K5B B;  5AQI B;  5ABH A;  4I43 B;  5J2T E;  1HG5 A;  2PFV A;  4AFG A;  4AQF A;  1N36 T;  2XNT A;  1QUU A;  4XBF B;  3MZK B;  1D1B A;  1YQ4 A;  3TKL B;  3CQX C;  2LOP A;  3LFM A;  3KV6 A;  1T7S A;  4ANJ A;  2EHO C;  2MTQ A;  3OKQ A;  2WP9 A;  3W15 B;  2LM9 A;  4EYU A;  4JI3 T;  2DHR A;  5BR8 T;  4L5G A;  1CHU A;  3C4Z A;  4HEA A;  2DNX A;  2NW7 A;  2E9X A;  4UY2 A;  2LSG A;  3OJA A;  3VKG A;  4UV8 B;  4ZI3 C;  3C84 A;  3ZN1 B;  3JAD A;  4UM1 A;  3EVY A;  3JC6 D;  3U8N A;  2Q9Q C;  2WS3 A;  5FVK A;  2V6X A;  5H6Q B;  4NXN T;  1OWA A;  4X62 T;  4UVC B;  1XMQ T;  2X67 A;  2PH9 A;  3GWH A;  3ZJ1 A;  2BJ0 A;  5AQR B;  4IHJ E;  3V5S A;  5HXS A;  5AQO B;  5JDQ A;  3ZMV B;  2CBI A;  3G06 A;  3UUN A;  4NXM T;  4OX9 T;  4M1P A;  2CCQ A;  3ZT5 A;  3EHZ A;  4ZI7 E;  2LSK A;  2JMK A;  3P50 A;  3RGL A;  1AJ3 A;  3RKO A;  2VKJ A;  4IDN A;  4PJN A;  1OED E;  2Y48 B;  4H9Q C;  2LKG A;  1ZHC A;  3MXZ A;  2CBJ A;  2LRL A;  4U7I A;  4HFH A;  3EAM A;  5FMN A;  5FY7 A;  2PJQ A;  2X0Y A;  3CKD A;  3CX7 B;  3WI3 A;  4B3R T;  4YTN A;  3UU5 A;  4YSY A;  3PEO A;  3IBP A;  4U31 A;  3C98 B;  4O2A E;  4OFZ A;  4WZX A;  2HH7 A;  3SRZ A;  4ILU A;  5FVL A;  1W0A A;  2XAQ B;  1NEK A;  4KP3 C;  4PAG A;  5L4E A;  4YHH T;  3P4Q A;  3U8J A;  3N9P A;  2VVN A;  4UXN B;  3N9O A;  2WDQ A;  4PJL A;  4JI4 T;  2AE9 A;  2BKO A;  4JI2 T;  4PW8 A;  2BKP A;  5JVD E;  1IBM T;  5JRC A;  1N32 T;  4DR3 T;  4DBQ A;  3EDV A;  4ZEY A;  5DQW A;  2QC1 B;  3C4X A;  3AXJ A;  2R6G F;  1N34 T;  3QC9 A;  4LMK A;  3RKG A;  2PGZ A;  1DU2 A;  1HNZ T;  1O3X A;  4UM3 S;  2AXD S;  4I55 E;  4KMC A;  5L3F B;  4K0K T;  2SPC A;  4AXP A;  2GK9 A;  3PDY A;  3NZP A;  3SH1 A;  2XYT A;  4LF6 T;  3AE3 A;  3EAB A;  2YDR A;  2B76 A;  1LKX A;  3LG7 A;  2WWU A;  5CB4 E;  3JAE A;  1HX8 A;  4LFB T;  4IST A;  1KK7 A;  1FMW A;  4KHP T;  4EEB A;  4P09 A;  4UIG A;  2N9D A;  2ACX A;  2YIN A;  4QXH B;  2BYP A;  3GA8 A;  1M7K A;  2CA5 A;  3LBX A;  4UF0 B;  4YTM A;  2W8F A;  1MIY A;  3UQ4 A;  1SE7 A;  3VR8 A;  3VU7 H;  1UUS A;  3PUR A;  2EHO A;  4YY3 T;  2W4X A;  1L0V A;  2UU9 T;  2M6B A;  3UTK A;  2LEH A;  2LE8 A;  4GIW A;  2N1G A;  5BMV E;  2WU2 A;  5AQS B;  2E8I A;  2YU1 A;  4KHZ F;  3N2G E;  4DR1 T;  4BQT A;  2XJ7 A;  2NP9 A;  1YKH B;  4JI0 T;  2UXX B;  5HWX A;  5FP3 A;  4AKG A;  2LJL A;  5HXR A;  2LHR A;  3WTN A;  4ZR6 A;  2X0L B;  2BYS A;  4ZK1 A;  4BFQ A;  1XMO T;  2XM1 A;  4EOZ B;  5JDL A;  5HWY A;  1MMA A;  3C64 A;  3QK6 A;  2V7I A;  2FJE A;  2VK9 A;  2UUB T;  4B3M T;  4DR7 T;  3L3P A;  1VOM A;  3O1H A;  3PJA A;  4JI6 T;  2Y7Y A;  4EV6 A;  2WZI A;  3I1A A;  1HFA A;  2C9T A;  3Q5E A;  4U74 A;  3AE6 A;  2BDE A;  4EB6 E;  2CEA A;  4FJO A;  4ZI2 D;  3N2O A;  4AFT A;  3VRB A;  1XDP A;  2E9X D;  3FZK B;  3PU3 A;  3ZMS B;  3AEC A;  3O1I A;  2Z6E A;  4IT4 A;  3H3M A;  4HWF A;  1D0Z A;  2BVL A;  4X66 T;  2RA1 A;  2XHE B;  5DAB A;  4QHO A;  2E2A A;  4K0U A;  3K3O A;  2YOE A;  4O4J E;  2RPA A;  4Z91 A;  1G8X A;  2W8G A;  2NTX A;  3TLU A;  2BYN A;  3LSV A;  4E7Z A;  3AEB A;  4AFH A;  4TN7 B;  2E9X C;  4PNI A;  3QUJ A;  4ZI2 C;  4CXY A;  5LG4 A;  2UUA T;  4X20 E;  5EZY E;  2HHH T;  1HCI A;  2BYR A;  4ZZB A;  2KXP B;  4B3T T;  4PJJ A;  2HN1 A;  5HEO A;  4LF9 T;  2X9H A;  3Q5X A;  3EUH A;  5HEU A;  4JBW F;  3AE2 A;  3KIN B;  2XQ3 A;  3CPZ A;  4EXT A;  4HN9 A;  3AA6 B;  2BBJ A;  5J2U E;  3VRA A;  5L2L A;  3AAA B;  1XNQ T;  4DR6 T;  3C51 A;  2V8S V;  1HF8 A;  3LDQ B;  3GMI A;  3IF8 B;  3PUA A;  1NEN A;  3FBL A;  2WM9 A;  4ZZC A;  4JYA T;  2PBI A;  3J9X 1;  2PG8 A;  2XAG B;  3KBT A;  2LSJ A;  2ZJU A;  4LF8 T;  2YK0 A;  5HEH A;  4ZK4 A;  4DID B;  4HTE A;  4DV2 T;  4H9O C;  4MBQ A;  3AE5 A;  2WCA A;  5IWA T;  4QH5 A;  2L8K A;  5F5W A;  4CI1 B;  2OV9 A;  3AE8 A;  4DUY T;  3ZSS A;  2A3D A;  3N9N A;  5HXH A;  2XQ9 A;  3WAJ A;  2BVM A;  4I4T E;  3QOF A;  5FXV A;  5FXX A;  3PUW F;  1LVF A;  4NZB A;  2BR8 A;  2DL1 A;  4LF7 T;  3OYZ A;  4EZ4 A;  5ETW A;  5FXW A;  5LMN T;  2BYQ A;  2LSI A;  2X68 A;  3QNU A;  3RYI E;  4I0U A;  5HXE A;  2DLR A;  2KZ7 B;  2CXF A;  1YQ3 A;  3N9M A;  2LRK A;  2CE7 A;  1I6Z A;  3P4W A;  2MBG A;  2L3L A;  4OK0 A;  4U2Y A;  3P4P A;  4FRR A;  2BG9 C;  4X1K E;  2ACZ A;  5BRX A;  4UEL A;  5J5H A;  5LCY A;  4B3S T;  2BG9 B;  3GN5 A;  1UX2 A;  5KMG P;  3F57 A;  4EZ1 A;  1E7P A;  2P9B A;  5DJQ C;  4QXB B;  3Q2M A;  4PK4 A;  4IDO A;  2W00 A;  5J5I A;  4AQG A;  2UZ6 A;  3JAF A;  4XAX B;  4DO0 A;  2XNU A;  2MAW A;  1YW0 A;  2LSY A;  2WB5 A;  5L3G B;  4P0A A;  5LGN B;  4Z8X A;  3T4M A;  5AQL B;  4HQP A;  3RQU A;  4LFC T;  3PUX F;  2ODV A;  5ABF B;  3K1S A;  2VL0 A;  2CXL A;  1Y01 A;  1XDO A;  4TNW A;  3AEE A;  2KWH A;  4ISS A;  2JPF A;  2J4G A;  1BR1 A;  3ZYL A;  4XK9 A;  5LJN A;  1FIO A;  3AEG A;  1UUR A;  1GQE A;  2K48 A;  1IBL T;  2UXC T;  4ERR A;  1NWM X;  3PUV F;  3LK2 B;  2VKD A;  4IL9 A;  2H3R A;  5LBQ B;  3H37 A;  2XSB A;  4NUV A;  1UGO A;  5JR9 A;  3RYC E;  2WY2 A;  2H7O A;  4IIJ E;  4X1I E;  3MKD A;  5AFU L;  4H63 V;  1J1J A;  5LGT B;  4MLK A;  2Y58 A;  5LJM A;  3CVR A;  1WR6 A;  4GK0 E;  5JDM A;  3ETV A;  3AVS A;  3NVO A;  1YXR A;  4GKJ T;  5AQG B;  4ZS3 A;  1WYC A;  2XAS B;  3ZC1 A;  1VRB A;  4DR4 T;  1D1A A;  4U33 A;  4QXC B;  5AFK A;  1KNP A;  5HYA A;  4U2Z A;  1MIW A;  2MYS A;  4DMW A;  3B13 A;  4U3C A;  3N2K E;  2WNC A;  4DBR A;  1OED C;  4YSZ A;  4Q25 A;  2Q9Q D;  2XQ5 A;  3JC6 C;  1S35 A;  1OED B;  4AIU A;  5AQK B;  4O4H E;  3PUY F;  3IGQ A;  3AA7 B;  1E2A A;  4TUY E;  3K3N A;  2BZB A;  3H3A A;  4KI0 F;  2D0U A;  5CFB A;  4QKN A;  5ABF A;  4ADZ A;  3QB5 K;  3E0Z A;  3TLV A;  5AFH A;  2V5D A;  1XZY A;  2JQK A;  2QYW A;  3FXD B;  1HS7 A;  1W0B A;  1X9B A;  3Q5W A;  1JNR A;  5LMU T;  4X65 T;  3FHN A;  5AFJ A;  4KUM B;  2LOS A;  2IHR 1;  2WZY A;  1HR0 T;  2C5I T;  3CQC B;  5FYM A;  1HNW T;  2D5U A;  3RIA A;  1R8I A;  4O8S A;  3RHW A;  4XZC A;  2XZ5 A;  3LBX B;  5BW2 A;  4HFI A;  3PJA J;  3RRW A;  3C79 A;  2XZE A;  4BJM A;  2WMN A;  5LP6 E;  2X51 A;  2BG9 A;  3GN5 B;  3IA3 A;  4ZS2 A;  5FY0 A;  4DVD A;  4JI1 T;  2FJD A;  4WBN E;  4IE5 A;  3K3Q C;  4KBM B;  2OA5 A;  5JH7 E;  4UM3 P;  4DV5 T;  3FB2 A;  3UUX B;  1UW6 A;  2W67 A;  5KXJ A;  4BA9 A;  3BQL A;  3M3Z B;  3I0O A;  5JDF A;  3AE9 A;  1IAP A;  4ILC A;  1WCR A;  4C90 A;  3NZQ A;  2V5C A;  5AQU B;  4JLE A;  4PJM A;  3VKH A;  3WTH A;  4DV3 T;  4AKH A;  2CRB A;  4B5D A;  2VB6 A;  1I9B A;  4H9N C;  3IEE A;  3RRC A;  1WFD A;  4YT0 A;  5KE4 A;  5LXT E;  3AA0 B;  3PV0 F;  2JQH A;  2C0S A;  3T1H T;  3PUQ A;  2WN9 A;  1ZOY A;  4PIR A;  3N5L A;  1G73 A;  4DV0 T;  1MMD A;  3ZMT B;  5J5F A;  1XWM A;  2MPK A;  4GK5 E;  3WTK A;  2J62 A;  4MFR A;  2BS2 A;  4OHF A;  2ZM6 T;  4COF A;  4IL4 A;  2HN2 A;  4WNK A;  4U7Y A;  4L0R A;  3LK4 2;  2KSR A;  4G2A A;  3SFE A;  3ZN0 B;  5F8P A;  3NKZ A;  4YHJ A;  4TV8 E;  2NW8 A;  3PMZ A;  3HL6 A;  3WTM A;  2X0H A;  3NWI A;  3SIO A;  4DV6 T;  2WSS V;  5FL1 A;  4JUY A;  5M4Y A;  3UT5 E;  2V26 A;  2XZ6 A;  5TAO A;  1UK5 A;  4HFB A;  4EZH A;  3O9X A;  4CZZ B;  3L09 A;  2X66 A;  4ZRU A;  2XQY A;  3FZH B;  4IE7 A;  3B57 A;  4A5X A;  2KT9 A;  1D0Y A;  3RYF E;  5HXC A;  4HFD A;  1Z0P A;  4GYR A;  3I9Y A;  3ZCJ A;  5AFL A;  1KF6 A;  4I50 E;  3MK7 C;  4QAA A;  3UFE A;  2V7L A;  4HFV A;  5AFN A;  2PTF A;  4ZJS A;  4HWD A;  5KZU A;  2E9X B;  4IRE A;  5L47 A;  3ETU A;  4PFO A;  1ZKE A;  2Q9Q B;  3ZT6 A;  1WR0 A;  2XQ8 A;  3ZJ2 A;  5AQJ B;  2X9X A;  3CWZ B;  5EK2 A;  2V6Y B;  5AQH B;  3PUS A;  5DQV A;  4ZI3 D;  2BKN A;  1KFY A;  2ZM8 A;  4WW0 A;  2IC9 A;  4U72 A;  3AVR A;  2WNJ A;  1KNR A;  5JDG A;  4EGW A;  5FJV A;  3RC8 A;  2Y6X A;  1IJ5 A;  2DWG A;  4DBM A;  2YDS A;  4AKR B;  5L4H A;  5IHY A;  3MAC A;  4OYK A;  4CXW A;  4KX6 A;  2KLQ A;  5CA0 E;  2E5L T;  2UXB T;  4PK6 A;  4G63 A;  5J0Z A;  3Q5D A;  5C3J A;  4YJ2 E;  1MIV A;  3DP7 A;  4ILA A;  4ILB A;  1MNE A;  3P4R A;  2CPT A;  4UV9 B;  3RIF A;  3C4W A;  5EK3 A;  3CX8 B;  2K3W A;  4IDQ A;  4IE0 A;  1QLB A;  2D9D A;  3UQ7 A;  4LMJ A;  5CA1 E;  3HKD E;  3ZMU B;  4HWH A;  3KBU A;  2EHO B;  2CHN A;  3EI0 A;  3OYX A;  3P7I A;  4AI6 A;  1OED A;  5CJ5 A;  3RC3 A;  5L3D B;  2VL8 A;  1KNZ A;  3EDU A;  4YSX A;  2FJA A;  3J7Y q;  3WAK A;  2CLY C;  2IC6 A;  2CXD A;  4AQY T;  1D0X A;  4GKK T;  3E08 A;  5HCJ A;  1I94 T;  3I0Q A;  2VQE T;  1CUN A;  3HKB E;  3RQW A;  4F6R C;  1J5E T;  2WMO A;  2UXN B;  3ZC0 A;  4H63 H;  2N2N A;  4DV7 T;  3KV4 A;  3OTO T;  3L39 A;  1T98 A;  3PUG A;  3WIP A;  3R84 B;  1FEW A;  5LOV E;  4O2B E;  2CHO A;  2G0U A;  2HPL A;  3B5M A;  4LF4 T;  2JJ9 A;  2KIN B;  3AXJ B;  4JEH B;  3E22 E;  1N33 T;  2DWK A;  4AKI A;  1YKE B;  5AQN B;  5JR9 C;  4MHC A;  3RH3 A;  3MA9 A;  5ABE A;  2QVA A;  3NRY A;  5LBM A;  3ANW A;  5L3C B;  1IZN B;  3VHL A;  2WDV A;  1M62 A;  3FXE B;  1QSD A;  3V5U A;  2WU5 A;  3ANW B;  2XSA A;  5LG3 A;  2CLY B;  3AE4 A;  1MMN A;  1S94 A;  4HE8 A;  2FBW A;  2CM0 A;  1FMV A;  2A72 A;  3OPC A;  1UX5 A;  1VCS A;  1YD8 G;  5HCM A;  2YKS A;  1FJG T;  4EYY R;  4PK5 A;  2KWI B;  5KX5 E;  5JRE A;  4C91 A;  3UUM A;  5LHH B;  3AEA A;  3A5X A;  4IDP A;  4LF5 T;  3C50 A;  4UM3 A;  2WQY A;  2DCF A;  3KV5 A;  2Y57 A;  3ZLI A;  2ZM0 A;  1EZ3 A;  4CQI A;  4TX5 A;  4YXD A;  1VCT A;  3HI2 A;  2E5V A;  3CX6 B;  5JDH A;  4A98 A;  4NUU A;  2XTL A;  4A56 A;  5BP0 A;  3AE7 A;  3JCF A;  3R6N A;  3WTI A;  4TWD A;  1E1H B;  2WAU A;  2BR7 A;  5LNK A;  1HNX T;  5F3J A;  3ZST A;  5CGM A;  3ZEF B;  4AQF C;  4UVB B;  2BG9 E;  3AED A;  4ASK A;  4TZ4 C;  2JQQ A;  3TLT A;  1NAF A;  5ADX L;  3ESL A;  4HFC A;  4DR2 T;  3CIR A;  4DND A;  3A7M A;  3P8C D;  2Y54 A;  3SWH A;  5C8Y E;  4N78 D;  2I6H A;  2EHO D;  5SYO A;  2D0T A;  2ODU A;  5J5G A;  1LRZ A;  5FL0 A;  2ES0 A;  2M67 A;  4P1N A;  3RPU A;  5E0O A;  5FXZ A;  3ZDH A;  3SOL A;  3HA4 A;  3ZYK A;  2RP4 A;  4YLH A;  2XPK A;  5AQV B;  3PE0 A;  2A9U A;  3HR0 A;  2W66 A;  3ZDG A;  2NW9 A;  3PTR B;  2L9Q A;  5IYZ E;  2FJB A;  2BS3 A;  4EIW A;  4X1Y E;  1MMG A;  2CWY A;  2MOZ A;  3TLS A;  4BAY B; 
#chains in the Genus database with same CATH homology
 2X00 D;  4HFH A;  3EAM A;  2XQ3 A;  2XYS A;  3C79 A;  2XQ6 A;  2YN6 A;  2WNJ A;  3WTL A;  5FJV A;  4XHE A;  4EZ1 A;  5AIN A;  2Y7Y A;  4DBM A;  5AFM B;  4WV9 A;  2BG9 A;  5L4H A;  4UM3 A;  3U8K A;  3PMZ A;  2XQA A;  3JAE A;  4QH4 A;  2X00 A;  2Y57 A;  3WTM A;  3WIP A;  4AFG A;  3TLW A;  2C9T A;  2XNT A;  3UU5 A;  4Z90 A;  4A97 A;  2XQ4 A;  3UU8 A;  5J5I A;  3SIO A;  4TWF A;  3UU3 A;  2UZ6 A;  4LML A;  4ZZC A;  3JAF A;  1UX2 A;  4UXU A;  5J0Z A;  3PEO A;  2XNV A;  4AFT A;  5AFK A;  4UM3 P;  4A98 A;  2WNL A;  2XNU A;  2MAW A;  2BYP A;  2XZ6 A;  5HEJ A;  2YME A;  3U8M A;  5BP0 A;  2ZJU A;  4ZK4 A;  3UUB A;  5HEH A;  4HFB A;  4ILA A;  3GUA A;  2WNC A;  3WTI A;  3ZKR A;  1UW6 A;  2LKH A;  4ILB A;  4TWD A;  1OED C;  4ALX A;  5TVC A;  2BR7 A;  5CO5 A;  3RIF A;  5IUX A;  4ILC A;  4ZRU A;  2W8F A;  3T4M A;  5LXB A;  4QH5 A;  2YMD A;  4HQP A;  3RQU A;  2XQ9 A;  5L4E A;  3UQ4 A;  4HFE A;  2XQ5 A;  3U8J A;  3RI5 A;  4D01 A;  1OED B;  3WTJ A;  2BG9 E;  2VL0 A;  4UY2 A;  3U8L A;  5HEG A;  4TWH A;  3UQ7 A;  3TLT A;  4TNW A;  4LMJ A;  4HFD A;  3IGQ A;  2M6I A;  3C84 A;  2M6B A;  3JAD A;  4UM1 A;  4NZB A;  2LM2 A;  2BR8 A;  4F8H A;  3WTH A;  4HFC A;  3U8N A;  2LLY A;  5CFB A;  3EI0 A;  5AFL A;  2Y54 A;  4XK9 A;  2BYQ A;  4B5D A;  4QAC A;  1OED A;  1I9B A;  4QH1 A;  5SYO A;  2YOE A;  2PH9 A;  3TLV A;  2Y56 A;  4Z91 A;  2BJ0 A;  5AFH A;  5J5G A;  3UU4 A;  2W8G A;  3WTO A;  3TLU A;  4BQT A;  4QAA A;  4IL9 A;  4TNV A;  2BYN A;  3LSV A;  5KE4 A;  2ZJV A;  2QC1 B;  4X5T A;  4AFH A;  3ZDH A;  2WN9 A;  5LG3 A;  5AFN A;  4ZJS A;  4PIR A;  3SQ6 A;  5JME A;  4NPP A;  4LMK A;  4QAB A;  3UU6 A;  5AFJ A;  3P4W A;  2PGZ A;  3WTN A;  4ZR6 A;  5KZU A;  5J5F A;  4IRE A;  2BYS A;  2BYR A;  2WZY A;  5L47 A;  3SQ9 A;  4FRR A;  4ZZB A;  4ZJT A;  4ZK1 A;  3WTK A;  4UM3 S;  2XQ7 A;  2BG9 C;  3EHZ A;  1UV6 A;  3ZDG A;  4BFQ A;  2XQ8 A;  5HCJ A;  3P50 A;  5HCM A;  5HEO A;  5BRX A;  2YKS A;  3RIA A;  3RHW A;  4COF A;  1OED E;  4IL4 A;  5AFM A;  3SH1 A;  3RQW A;  2XYT A;  2Y58 A;  2XZ5 A;  5J5H A;  2BG9 B;  2KSR A;  2LKG A;  3TLS A;  5HEU A;  5BW2 A;  4HFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...