2XQ5A

Pentameric ligand gated ion channel glic in complex with tetraethylarsonium (teas)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 74
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq5A01
4D01A 4Z91A 3WTKA 5J0ZA 4TNWA 4ZR6A 3U8JA 2XQ4A 4IL9A 3WTNA 2X00A 2WN9A 2MAWA 2XQ5A 4NPPA 1OEDE 4IREA 5TVCA 5J5HA 3RI5A 3TLWA 2W8FA 2Y56A 4NZBA 2WZYA 4UM3P 5J5IA 2WNJA 4HFEA 1OEDB 3ZKRA 3RQWA 4QH4A 3UQ7A 4IL4A 4ILCA 4TWFA 2BYQA 5J5GA 5AFJA 3PMZA 3UU4A 2ZJUA 4UY2A 3U8KA 5HCMA 3TLTA 4ZK1A 4QABA 5FJVA 5L4EA 3SH1A 3TLSA 5HEJA 1UX2A 3C79A 5L4HA 4ZJSA 4BQTA 2Y54A 4TNVA 3LSVA 5BRXA 3RIFA 1OEDA 4TWHA 4X5TA 2YMEA 3WTJA 4UM1A 3UU3A 4HQPA 3EI0A 4TWDA 5BP0A 5AFKA 3WTOA 5J5FA 4HFBA 5AFHA 3U8NA 2XQ6A 4A97A 2Y58A 4ILAA 4COFA 4HFHA 2Y57A 1UV6A 2C9TA 2XYTA 3SQ9A 4XK9A 5AFMB 3TLVA 3EAMA 2XNTA 2ZJVA 4HFCA 3WTLA 2BG9C 4QAAA 5KE4A 3SQ6A 4ZK4A 4QH5A 3WTMA 4AFTA 2LM2A 4UM3S 4LMJA 4A98A 5AFLA 3U8LA 2XNUA 4HFDA 3IGQA 3T4MA 4AFHA 5HEOA 4LMLA 5HEUA 5AFNA 3UU6A 2BR8A 2LKGA 5AFMA 2VL0A 3RQUA 2BJ0A 4ZJTA 2LLYA 2XQ9A 3TLUA 4XHEA 4ALXA 2YN6A 3C84A 4AFGA 4F8HA 2YMDA 4EZ1A 2YOEA 4QACA 4HFIA 5IUXA 2XNVA 3WIPA 3PEOA 3WTIA 3ZDGA 2BR7A 2W8GA 4ZZBA 3JAFA 3P4WA 3UUBA 2BYSA 3JADA 5L47A 2XQ8A 2WNLA 2XYSA 2UZ6A 2XZ5A 3JAEA 2BG9B 3UQ4A 5LXBA 3SIOA 2X00D 3EHZA 4BFQA 5KZUA 2BYPA 4FRRA 5LG3A 2XQ3A 2PGZA 3UU5A 3RIAA 4UM3A 2YKSA 3WTHA 2BYRA 3UU8A 4QH1A 5BW2A 2LKHA 2XZ6A 3ZDHA 1OEDC 2XQ7A 5HEGA 5CFBA 3GUAA 2M6BA 2BG9A 2XQAA 2WNCA 5CO5A 2M6IA 1I9BA 4WV9A 5JMEA 4ZZCA 1UW6A 2Y7YA 4PIRA 3RHWA 5SYOA 4B5DA 2BG9E 5HEHA 2QC1B 4Z90A 5HCJA 5AINA 4DBMA 4ILBA 4LMKA 4UXUA 2BYNA 3P50A 2PH9A 2KSRA 3U8MA 4ZRUA
chains in the Genus database with same CATH superfamily
2HPLA 2M67A 2ODVA 4KHZF 2IIUA 3H37A 1MNEA 2IUBA 4E7ZA 3M65A 1FEWA 3ZKRA 4X1IE 2DWGA 4JI2T 3PMZA 2ZJUA 1QLBA 3Q5XA 3F2EA 4IE5A 4TWHA 2UU9T 4N78D 2UXCT 3ZJ1A 2V8SV 1YXRA 4OHFA 3AEAA 2YU2A 2K3WA 4U7YA 4AXPA 3RRWA 2WY2A 4K0KT 3CQCB 4JEHB 3DTOA 3T4MA 4Q25A 3N5LA 2D9DA 5M4YA 5KXJA 3NZPA 2VQET 3G06A 3ZMUB 1XWMA 3AE4A 4FJOA 3QB5A 2W0GA 3ZCJA 4EOZB 2XYSA 4AKRB 4YHJA 2DI4A 2PTFA 2J4GA 4GKKT 4X62T 5C2TA 2XUEA 3HA4A 2JPFA 3C4WA 5L2LA 4JI1T 4LFAT 4DBRA 1MIWA 1U4QA 4Z90A 5AINA 4DBMA 4B3MT 1UURA 2KSRA 3AB3B 3AE3A 2PG8A 4KUMB 3CQXC 3HKCE 3I9YA 3RC8A 2XQ4A 2N2NA 2W4XA 3I9WA 3RYIE 5AQIB 2Z6EA 5AQOB 2Y56A 4JI6T 3BQIA 2W62A 3RQWA 5JDGA 4DV2T 4GK5E 3ZPOA 4EB6E 2Q9QC 2BVMA 3C79A 3KV9A 1I94T 4BQTA 4H63H 1HG5A 3HR0A 5BRXA 4B3ST 4EYUA 2V6XA 2IHR1 4WZXA 2E9XC 3DP7A 4U2YA 3UTKA 4HFCA 5AQKB 4GIWA 4PK6A 2LRKA 3P4RA 1X9BA 5AFLA 2IC9A 4WYVA 1WFDA 4JBWF 2Q9QB 2C5JA 4OFZA 5AFMA 4WBOA 4XHEA 2YMDA 2YK0A 4P1NA 1E1HB 4ISTA 3WTIA 3LJCA 3KBTA 1XDOA 2V5DA 3UFEA 4ZOLE 4YTPA 2CXFA 2E9XB 3N9MA 5LMNT 3QOFA 4TUYE 3A7MA 3RIUA 4HE8A 3CKDA 3O1HA 3FZLB 2CHNA 2D0TA 1UW6A 3OYZA 5CA0E 5SYOA 3P50A 2QVAA 3P4QA 1X79A 2XTLA 1N32T 4OYJA 5LOVE 2I6HA 3C98B 4AQGA 5JDNA 2VQFT 3RF1A 3LBXA 3EDVA 4HFEA 1FIOA 1WLXA 1QUUA 3AAEB 3R6NA 4L5GA 4M1PA 3SS1A 5ABEA 3FZHB 1Z0PA 2LSGA 5JH7E 3ZEFB 5JDQA 2N9DA 1HR0T 3LK2B 4TWDA 4IE0A 4PW8A 3SQ9A 2Q9QA 1W09A 3OBVE 3QNUA 5AFNA 4U2ZA 3R84B 5LHHB 4UV9B 3O4XE 1JNRA 4EZ1A 1J1JA 2PBIA 2H7OA 3JAFA 4U31A 2BYSA 2WNLA 3MA9A 2OV9A 3IA3A 4ISSA 5LXBA 3RKGA 1HNWT 1YKEB 3VHLA 1BR1A 1ZEEA 3F31A 5AQFB 4CI2B 1OEDC 3LDQB 2KWHA 2C0SA 1I9BA 3NRXA 4PK5A 5LGUB 2NWBA 5ETWA 3U8JA 1VRBA 4O2BE 2A72A 3FZKB 4HKAA 4PJMA 3WTNA 2FJBA 3NRYA 2MAWA 2EHOD 4UM3P 2WM9A 1ZOYA 4MBQA 2JMHA 1OEDB 3KVBA 4AQYT 2WDRA 2CM0A 4YXDA 3AEDA 2KLQA 1IJ6A 3I1AA 3KV6A 4HQPA 5AQGB 5AFHA 5ABFB 2LSYA 4TN7B 3OVUA 2BG9C 2V7KA 4AKLA 4A98A 3U8LA 2K5BB 4AQFC 3NKZA 1UK5A 3AE9A 4I43B 4HWCA 5DJQC 3TLUA 1OXZA 1XDPA 1UX4A 3A8YC 2LHNA 3Q5DA 4I55E 2XNVA 2LM9A 2CWOA 2W00A 2WMNA 5EK3A 3OTOT 3ETVA 1FMWA 4MHCA 5EK4A 2BG9B 5ADXL 2L9QA 4X64T 3B57A 3L3PA 4AISA 2K24A 3L09A 4KP3C 4G2AA 2XQ7A 3EABA 2W63A 2M6IA 2KMFA 3FHNA 4CI1B 2BYNA 2PH9A 4OYKA 2EHOC 4U74A 4KX6A 5H6RB 4WBNE 1OWAA 4PAGA 5TAOA 4CXWA 3SRZA 1ZHCA 2IMLA 4TV8E 5FY1A 3FZFB 1IBMT 5AFJA 5BR8T 2CCQA 3LFMA 3QB5K 3PURA 3SH1A 3K3OA 3K3QC 2VASA 2EHOB 3AA7B 3LSVA 2FUPA 1MNDA 1LRZA 3AEFA 2V7MA 3AA6B 4ZEYA 3UUMA 1XZYA 4COFA 4H9NC 2WB5A 2XNTA 4DR1T 3BK9A 2LOPA 5L3EB 4O2AE 3AAIA 2WU5A 4F6RC 1UGOA 3HKBE 5HXHA 2XQ9A 4P0AA 2BS2A 4ALXA 2YN6A 4F8HA 5LA6E 2YOEA 5AQTB 2X67A 1BR4A 3VR8A 4QXBB 2W8GA 4UV8B 3ZT7A 5HXRA 2LSJA 2UZ6A 1D0ZA 3V5SA 3P4SA 3RIAA 5AQSB 3WTHA 3IHRA 1T8BA 1UCUA 3AA0B 2J47A 3OJAA 2NW8A 2UUCT 4LF6T 2V6YB 3PU3A 2BBJA 3FB2A 2KXPB 2BKNA 4WNKA 3K1SA 2X00A 2LSKA 3KFWX 3VRAA 5JRCB 4FI5A 3J7Yq 2MOZA 4MALA 4TWFA 3ZYKA 4CQIA 1US7B 2X0HA 3SFDA 3UU4A 2YDSA 2XQYA 4IHJE 3PUWF 4IE7A 5L4HA 4TNVA 1HS7A 3WTJA 5LBQB 3EI0A 3AVRA 3U8NA 3RRCA 2Y58A 2D5UA 5KX5E 3TLVA 4JI5T 2LRLA 3SQ6A 3AE6A 1MMDA 3VKGA 2LHRA 4O4LE 5LHGB 5DQVA 2LKGA 3QUJA 2HPJA 3VR9A 2YDRA 4HWIB 5F5WA 2E5LT 3K8PC 2N1GA 3RPUA 3U78A 1Y01A 2I0MA 3RX6A 3V5UA 3JAEA 4TX5A 2PFVA 3FBLA 3PUZF 2OLTA 3CPZA 4H9RC 3UU5A 3ZN0B 5C8YE 2Y8DA 5E0OA 1WRDA 2DNXA 5JMEA 2IC6A 4I0UA 5JR9C 4GYRA 4EV6A 4YLHA 3MACA 3CWZB 2X9XA 4KBMB 4TV9E 5JRCA 3HKDE 4ANJA 2KINB 2FJAA 3B13A 2ZLYA 4NXMT 4DR7T 4H9SE 1LVKA 3KBUA 3JCFA 4QH4A 1M62A 3UFGA 4CI3B 5JR9B 2XAGB 3MJXA 2KT9A 3A5XA 3PUGA 5LP6E 4U3CA 5L3GB 2XSAA 5J5FA 3ZYLA 3SFEA 4L9IA 1NEKA 3H3AA 4DR3T 3N9OA 3EAMA 2WS3A 1KK7A 4UR9A 5FVKA 4TZ4C 2X68A 3UULA 2JMKA 4CN4A 1HNZT 2XPKA 4JI4T 4EGWA 3RQUA 4QKNA 5FP3A 4LFCT 2JQQA 1W9RA 3LK3B 5IUXA 3ZJ2A 1WCRA 2UXXB 2XZEA 3AA1B 4JYAT 4DV6T 2XM2A 1IZNB 4AI6A 2LSIA 1HX8A 2WWUA 4H9OC 2WDQA 2LKHA 2L8KA 3CX6B 4IIJE 1R8IA 4HFVA 1YKHB 1SE7A 1D0XA 3ZMVB 5J5IA 5AQHB 4KI0F 4TNWA 3BQLA 5HWYA 2DLRA 5FYMA 4ASKA 4IREA 3ZN1B 2HN2A 4HN9A 4ZHQE 1E2AA 4IL4A 5EZYE 4DNDA 2BBHA 2X9HA 2BYQA 5BMVE 3U8KA 5FY7A 1S94A 2YEVC 3TLSA 2NTYA 3AEGA 2Y54A 3ZSTA 4IE4A 3EVYA 3QC9A 4A97A 5L3FB 2J1DG 4ADZA 5JTGA 3NVOA 4QXHB 5KE4A 4DMWA 4UIGA 1N34T 4LMLA 1J5ET 1KNRA 3AXJB 2VL0A 5IYZE 2LE8A 3C50A 1UX5A 2I59A 5IWAT 1T7SA 4DMVA 3ONLC 3H3MA 3LK42 5HXEA 2WQYA 4XBFB 2NR4A 1KEYA 4EIWA 3W15B 5KZUA 4EEDA 2RA1A 4I4TE 2PGZA 3SWHA 3T8OA 2Y6XA 5DQWA 5LMUT 2E9XA 3PDYA 1KNZA 4YSYA 2V1DB 2F4VT 2LT3A 2PJQA 1DU2A 5HCJA 2X9WA 5FKYA 2GK9A 3MKDA 2P9BA 2NTXA 5F8PA 1BR2A 2DL1A 3ZMSB 4QX7B 5L3DB 5FVLA 3E0ZA 2VB6A 4UELA 4EZ4A 3VRBA 2ZM2A 2W2UA 3I0QA 4ILCA 4X1KE 4UY2A 4IDQA 2ACZA 1D1AA 4YJ2E 2X66A 2YMEA 3OKQA 5LNKA 4B3RT 5FY0A 5AQUB 5J1GA 2MTQA 1SHZC 4A5XA 3PTRB 4ZS3A 3P4PA 3Q5WA 4IDZA 3ANWB 5LGNB 4UVAB 3RGLA 4A56A 1HTJF 2IDOB 3UUNA 5L3CB 3IGQA 5HEOA 3PUAA 5IHYA 4BJNA 4EZHA 4ZJTA 3C84A 4AFGA 3FBZA 4AKHA 4PJJA 5EK2A 4JI8T 4EXTA 2J62A 2BR7A 1CHUA 1UUSA 4YY3T 2A9UA 4ZI7E 4FRRA 2YU1A 4QX8B 2A3DA 2XAFB 5BW2A 5HEGA 2CBJA 3LG7A 4CXXA 2BKPA 4ZZCA 1EZ3A 4B5DA 5HEHA 2UXNB 4UXUA 2IAKA 3ONJA 4PK4A 5LYJE 4D01A 1J5WA 1ZKEA 4G63A 2LJLA 4QWNB 4IDNA 1MMGA 2CXLA 2LEHA 5JVDE 1WR6A 3EUHA 5HXCA 4YSZA 5AQRB 4GKJT 1HNXT 4CZZB 3AE5A 4IGUA 5JQGE 4KMCA 3TLTA 4ZK1A 5FJVA 2VL8A 1IBKT 3CX7B 3L8RA 2XASB 1MMAA 3PUYF 1OEDA 2CE7A 2H3RA 1YQ4A 4O4JE 2Y57A 4ZXLA 2C9TA 3ESLA 1MMNA 5LBMA 4B3TT 4IDOA 2H88A 2QGSA 3J9X1 1HFAA 4ERRA 2XNUA 5ABFA 4UF0B 3ETUA 5AQQB 2ZMAA 2CXDA 3AE2A 4P0BA 5AQMB 2XAJB 1CUNA 2FJEA 4IE6A 1D1BA 1W0BA 3CK6A 5GONE 3HL6A 4U72A 3GN5B 2YDQA 4DV0T 3OYXA 5LJNA 3UQ4A 5LG3A 3GMIA 3Q5EA 2VKJA 2BYRA 5JDFA 5JDHA 2BG9A 4JI7T 2Y7YA 2WSSV 4PFOA 4AQFA 4ILBA 5AQPB 1ZV4X 5LXTE 4Z91A 3RYHE 1YW0A 2K9AA 4IT4A 2WN9A 1Y64B 1OEDE 5TVCA 5J5HA 3PUQA 3ONXA 5FL0A 2YINA 3PUSA 3E22E 3S4UA 3M3ZB 4PFPA 2JJ9A 4HWHA 3MXZA 1XMOT 3I0OA 1NAFA 2XQ6A 3L39A 4YSXA 4UF0A 3UUXB 4DV3T 2ZJVA 2EHOA 2W66A 1S35A 4PJLA 4QH5A 3WTMA 4QHOA 2UUBT 1VCSA 2ZM0A 1D0YA 2K48A 5HEUA 4DR4T 3GN5A 3C4ZA 4X1YE 4QACA 2CMRA 5ABHA 3O1IA 2NP9A 4ZZBA 3AAAB 3UUBA 4UVCB 2WWVA 3OPCA 3DJBA 1G8XA 3N2KE 4AKIA 1SA0E 4DO0A 3RYFE 3QK6A 1G73A 4BJMA 3PUVF 3GUAA 2CPTA 2WNCA 2VVSA 4GK0E 3AEBA 2BKOA 2V5CA 4PIRA 4MFRA 2H7VC 1BR0A 3SOLA 4HTEA 2X9YA 3UT5E 3ZCIA 2ACXA 4ZRUA 3WTKA 2WMOA 3MK7C 3O1JA 2DHRA 3AVSA 2Q9QD 4ZS2A 5F3JA 3T1HT 1XNQT 3RI5A 2WP9A 2V6YA 2BDEA 2R6GF 5FXWA 5HCMA 4ILUA 4GOUA 5L4EA 2E9XD 2V7LA 2V7IA 3RIFA 1FJGT 2XAHB 3UU3A 3AE8A 3PE0A 3RIUC 5AFKA 3Q9DA 4WW0A 3AE7A 3E08A 4JLEA 1UV6A 2XYTA 5AFMB 3WTLA 5FL1A 2KNDA 3GWHA 2FJDA 5FXZA 1XNRT 1O3XA 2BJ0A 2W67A 2VURA 2JRKA 1SUMB 5CA1E 2XHEB 3KVAA 5L3BB 3WIPA 2RPAA 5L47A 2XQ8A 4XZCA 3BQKA 4P09A 3C64A 3PJAA 4NXNT 3SIOA 3EHZA 3RKOA 3WAKA 5CGMA 4DV4T 2XAQB 2NW7A 4HWDA 2BVLA 2XZ6A 2BS4A 3N2OA 5LCYA 4Z8XA 2H89A 2V7JA 3RC3A 2QYWA 3RHWA 4DIDB 3PJAJ 1D1CA 2QC1B 3FXDB 4HEAA 2HHHT 1Z8UA 4UXNB 2UXBT 3LBXB 1IBLT 3ZC0A 1QSDA 2HN1A 2CHOA 4BAYB 4JI0T 2CRBA 1FMVA 3KV5A 3TLWA 4NZBA 3ABVA 4YTNA 2E8IA 1MIVA 5FNVE 2OA5A 4JEUB 3ZMZB 4DVDA 4GYSA 2VVNA 3X1DA 4QABA 5HEJA 3WI3A 2LOSA 5DABA 1HG2A 4AIUA 4UM1A 2WBLA 5H6QB 4JV5T 3N9QA 4HFBA 5JR9A 3RLFF 5HYAA 4X20E 5HAXA 1KF6A 2Y48B 3HKEE 2LM2A 4ZI2D 4UM3S 4LMJA 3P7IA 2XY8B 3ZC1A 4QXCB 5AFUL 1NWMX 4UVBB 2IW5B 3AEEA 3PEOA 4OX9T 2V26A 1YQ3A 3P4WA 2WZIA 3IBPA 3KV4A 2XJ7A 2VK9A 2BYPA 2G0UA 4DR2T 4UM3A 3PUXF 1WYCA 2RP4A 2XQAA 3VU7H 1WYBA 3N9PA 2MYSA 4DUYT 4JI3T 4O4HE 4YTMA 2MPKA 2AXDS 2X51A 4DV5T 3N9NA 4C90A 4NPPA 1IJ5A 4MLKA 2WZYA 2QA7A 2C5IT 3UQ7A 3RH3A 2X0LB 4E7SA 1U5PA 1UX2A 2CLYC 1E7PA 5LJMA 1ZP0A 5FMNA 5JREA 2CWYA 3P8CD 2L3LA 4V1Av 4ZI2C 2VWAA 2WZHA 5CB4E 3CVRA 5LB7B 2XM1A 4YT0A 4U7IA 3UU6A 4HGAA 2CLYB 4LF8T 2LLYA 2JIWA 5JDLA 2DCFA 4DR6T 5A1LA 4CN6A 1XMQT 5C3JA 3AXJA 3CX8B 3D0TA 1NENA 3HI2A 4ZI3D 4LF4T 4DV1T 4J2CA 3K3NA 5LG4A 2VKHA 2X00D 2KWIB 5ABGA 4NUUA 4X65T 4H9PC 4NUVA 2YKSA 4AKGA 2ZM6T 4HWFA 3Q2MA 1IAPA 5AQJB 3UU8A 3NBXX 2M6BA 5CO5A 5AQVB 3KDSE 2JQKA 5HWXA 2DWKA 5KDMC 5CJ5A 4EEBA 1VCTA 4YFSA 3N9LA 4IL9A 2BS3A 2XQ5A 3MZKB 2ZM8A 2W8FA 3PU8A 5AQLB 4LF9T 4XAXB 4UEMA 3ZT6A 3O9XA 5J5GA 1GQEA 2XSBA 4JUYA 4DUZT 2D2SA 4C91A 4ZJSA 4LF5T 4LF7T 4YHHT 2FBWA 3JC6D 4X5TA 1N33T 3N2GE 3TKLB 2HH7A 1W0AA 3PV0F 2VKDA 4X66T 2UXDT 5LHIB 4QAAA 2JQ9A 4LFBT 4ZK4A 1I6ZA 5AQNB 5KMGP 4AFTA 3RYCE 2E2AA 2UUAT 4NIQA 1V9DA 4BA9A 3ZYMA 4ZI3C 2AE9A 3ANWA 3AECA 3ZMTB 3ZDGA 3ZT5A 3U3IA 4L0RA 4CXYA 2XZ5A 5HXSA 2CEAA 4DV7T 4KHPT 4BFQA 2KZ7B 2WDVA 2XQ3A 1VOMA 3T1YT 2CBIA 1KFYA 4H63V 3ZDHA 2B76A 3FZMB 2QRXA 2CA5A 1HCIA 3ZLIA 2A2FX 2BZBA 2X0YA 1LKXA 1MIYA 4U33A 4LMKA 2WU2A 3U8MA 4OK0A 5J0ZA 4ZR6A 2D0UA 3C51A 5FXVA 3GA8A 2VKOA 3C4XA 1HX1B 2NOXA 4EYYR 2WNJA 2WAUA 3JC6C 4DR5T 3WAJA 4DBQA 4EAHA 3EDUA 4PNIA 4IDPA 4O4IE 5BP0A 3WTOA 1B7TA 3IF8B 5J2TE 4ILAA 4HFHA 5JDMA 4YJ3E 3CIRA 3NZQA 1AJ3A 5J2UE 4I50E 3CMLA 2SPCA 4B6XA 4HFDA 1N36T 4AFHA 2W61A 2BR8A 3AE1A 3CQGB 5LGTB 4CN1A 2NW9A 3NWIA 2B1EA 1H7CA 3KINB 5FXXA 4HFIA 4PJNA 1WR0A 2WCAA 1T98A 1M7KA 3JADA 3ZSSA 1KNPA 4K0UA 3F57A 3FXEB 2ES0A 2C5KT 3VKHA 1JNZA 2ODUA 2E5VA 4QH1A 2MBGA 3IEEA 4O8SA 5CFBA 1L0VA 3B5MA 2JQHA 4WV9A 1HF8A 2BG9E 1T72A 1LVFA 1YD8G 4XK9A 4H9QC
chains in the Genus database with same CATH topology
4D01A 4Z91A 3WTKA 5J0ZA 4TNWA 4ZR6A 3U8JA 2XQ4A 4IL9A 3WTNA 2X00A 2WN9A 2MAWA 2XQ5A 4NPPA 1OEDE 4IREA 5TVCA 5J5HA 3RI5A 3TLWA 2W8FA 2Y56A 4NZBA 2WZYA 4UM3P 5J5IA 2WNJA 4HFEA 1OEDB 3ZKRA 3RQWA 4QH4A 3UQ7A 4IL4A 4ILCA 4TWFA 2BYQA 5J5GA 5AFJA 3PMZA 3UU4A 2ZJUA 4UY2A 3U8KA 5HCMA 3TLTA 4ZK1A 4QABA 5FJVA 5L4EA 3SH1A 3TLSA 5HEJA 1UX2A 3C79A 5L4HA 4ZJSA 4BQTA 2Y54A 4TNVA 3LSVA 5BRXA 3RIFA 1OEDA 4TWHA 4X5TA 2YMEA 3WTJA 4UM1A 3UU3A 4HQPA 3EI0A 4TWDA 5BP0A 5AFKA 3WTOA 5J5FA 4HFBA 5AFHA 3U8NA 2XQ6A 4A97A 2Y58A 4ILAA 4COFA 4HFHA 2Y57A 1UV6A 2C9TA 2XYTA 3SQ9A 4XK9A 5AFMB 3TLVA 3EAMA 2XNTA 2ZJVA 4HFCA 3WTLA 2BG9C 4QAAA 5KE4A 3SQ6A 4ZK4A 4QH5A 3WTMA 4AFTA 2LM2A 4UM3S 4LMJA 4A98A 5AFLA 3U8LA 2XNUA 4HFDA 3IGQA 3T4MA 4AFHA 5HEOA 4LMLA 5HEUA 5AFNA 3UU6A 2BR8A 2LKGA 5AFMA 2VL0A 3RQUA 2BJ0A 4ZJTA 2LLYA 2XQ9A 3TLUA 4XHEA 4ALXA 2YN6A 3C84A 4AFGA 4F8HA 2YMDA 4EZ1A 2YOEA 4QACA 4HFIA 5IUXA 2XNVA 3WIPA 3PEOA 3WTIA 3ZDGA 2BR7A 2W8GA 4ZZBA 3JAFA 3P4WA 3UUBA 2BYSA 3JADA 5L47A 2XQ8A 2WNLA 2XYSA 2UZ6A 2XZ5A 3JAEA 2BG9B 3UQ4A 5LXBA 3SIOA 2X00D 3EHZA 4BFQA 5KZUA 2BYPA 4FRRA 5LG3A 2XQ3A 2PGZA 3UU5A 3RIAA 4UM3A 2YKSA 3WTHA 2BYRA 3UU8A 4QH1A 5BW2A 2LKHA 2XZ6A 3ZDHA 1OEDC 2XQ7A 5HEGA 5CFBA 3GUAA 2M6BA 2BG9A 2XQAA 2WNCA 5CO5A 2M6IA 1I9BA 4WV9A 5JMEA 4ZZCA 1UW6A 2Y7YA 4PIRA 3RHWA 5SYOA 4B5DA 2BG9E 5HEHA 2QC1B 4Z90A 5HCJA 5AINA 4DBMA 4ILBA 4LMKA 4UXUA 2BYNA 3P50A 2PH9A 2KSRA 3U8MA 4ZRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D01 A;  4Z91 A;  3WTK A;  5J0Z A;  4TNW A;  4ZR6 A;  3U8J A;  2XQ4 A;  4IL9 A;  3WTN A;  2X00 A;  2WN9 A;  2MAW A;  2XQ5 A;  4NPP A;  1OED E;  4IRE A;  5TVC A;  5J5H A;  3RI5 A;  3TLW A;  2W8F A;  2Y56 A;  4NZB A;  2WZY A;  4UM3 P;  5J5I A;  2WNJ A;  4HFE A;  1OED B;  3ZKR A;  3RQW A;  4QH4 A;  3UQ7 A;  4IL4 A;  4ILC A;  4TWF A;  2BYQ A;  5J5G A;  5AFJ A;  3PMZ A;  3UU4 A;  2ZJU A;  4UY2 A;  3U8K A;  5HCM A;  3TLT A;  4ZK1 A;  4QAB A;  5FJV A;  5L4E A;  3SH1 A;  3TLS A;  5HEJ A;  1UX2 A;  3C79 A;  5L4H A;  4ZJS A;  4BQT A;  2Y54 A;  4TNV A;  3LSV A;  5BRX A;  3RIF A;  1OED A;  4TWH A;  4X5T A;  2YME A;  3WTJ A;  4UM1 A;  3UU3 A;  4HQP A;  3EI0 A;  4TWD A;  5BP0 A;  5AFK A;  3WTO A;  5J5F A;  4HFB A;  5AFH A;  3U8N A;  2XQ6 A;  4A97 A;  2Y58 A;  4ILA A;  4COF A;  4HFH A;  2Y57 A;  1UV6 A;  2C9T A;  2XYT A;  3SQ9 A;  4XK9 A;  5AFM B;  3TLV A;  3EAM A;  2XNT A;  2ZJV A;  4HFC A;  3WTL A;  2BG9 C;  4QAA A;  5KE4 A;  3SQ6 A;  4ZK4 A;  4QH5 A;  3WTM A;  4AFT A;  2LM2 A;  4UM3 S;  4LMJ A;  4A98 A;  5AFL A;  3U8L A;  2XNU A;  4HFD A;  3IGQ A;  3T4M A;  4AFH A;  5HEO A;  4LML A;  5HEU A;  5AFN A;  3UU6 A;  2BR8 A;  2LKG A;  5AFM A;  2VL0 A;  3RQU A;  2BJ0 A;  4ZJT A;  2LLY A;  2XQ9 A;  3TLU A;  4XHE A;  4ALX A;  2YN6 A;  3C84 A;  4AFG A;  4F8H A;  2YMD A;  4EZ1 A;  2YOE A;  4QAC A;  4HFI A;  5IUX A;  2XNV A;  3WIP A;  3PEO A;  3WTI A;  3ZDG A;  2BR7 A;  2W8G A;  4ZZB A;  3JAF A;  3P4W A;  3UUB A;  2BYS A;  3JAD A;  5L47 A;  2XQ8 A;  2WNL A;  2XYS A;  2UZ6 A;  2XZ5 A;  3JAE A;  2BG9 B;  3UQ4 A;  5LXB A;  3SIO A;  2X00 D;  3EHZ A;  4BFQ A;  5KZU A;  2BYP A;  4FRR A;  5LG3 A;  2XQ3 A;  2PGZ A;  3UU5 A;  3RIA A;  4UM3 A;  2YKS A;  3WTH A;  2BYR A;  3UU8 A;  4QH1 A;  5BW2 A;  2LKH A;  2XZ6 A;  3ZDH A;  1OED C;  2XQ7 A;  5HEG A;  5CFB A;  3GUA A;  2M6B A;  2BG9 A;  2XQA A;  2WNC A;  5CO5 A;  2M6I A;  1I9B A;  4WV9 A;  5JME A;  4ZZC A;  1UW6 A;  2Y7Y A;  4PIR A;  3RHW A;  5SYO A;  4B5D A;  2BG9 E;  5HEH A;  2QC1 B;  4Z90 A;  5HCJ A;  5AIN A;  4DBM A;  4ILB A;  4LMK A;  4UXU A;  2BYN A;  3P50 A;  2PH9 A;  2KSR A;  3U8M A;  4ZRU A; 
#chains in the Genus database with same CATH topology
 2HPL A;  2M67 A;  2ODV A;  4KHZ F;  2IIU A;  3H37 A;  1MNE A;  2IUB A;  4E7Z A;  3M65 A;  1FEW A;  3ZKR A;  4X1I E;  2DWG A;  4JI2 T;  3PMZ A;  2ZJU A;  1QLB A;  3Q5X A;  3F2E A;  4IE5 A;  4TWH A;  2UU9 T;  4N78 D;  2UXC T;  3ZJ1 A;  2V8S V;  1YXR A;  4OHF A;  3AEA A;  2YU2 A;  2K3W A;  4U7Y A;  4AXP A;  3RRW A;  2WY2 A;  4K0K T;  3CQC B;  4JEH B;  3DTO A;  3T4M A;  4Q25 A;  3N5L A;  2D9D A;  5M4Y A;  5KXJ A;  3NZP A;  2VQE T;  3G06 A;  3ZMU B;  1XWM A;  3AE4 A;  4FJO A;  3QB5 A;  2W0G A;  3ZCJ A;  4EOZ B;  2XYS A;  4AKR B;  4YHJ A;  2DI4 A;  2PTF A;  2J4G A;  4GKK T;  4X62 T;  5C2T A;  2XUE A;  3HA4 A;  2JPF A;  3C4W A;  5L2L A;  4JI1 T;  4LFA T;  4DBR A;  1MIW A;  1U4Q A;  4Z90 A;  5AIN A;  4DBM A;  4B3M T;  1UUR A;  2KSR A;  3AB3 B;  3AE3 A;  2PG8 A;  4KUM B;  3CQX C;  3HKC E;  3I9Y A;  3RC8 A;  2XQ4 A;  2N2N A;  2W4X A;  3I9W A;  3RYI E;  5AQI B;  2Z6E A;  5AQO B;  2Y56 A;  4JI6 T;  3BQI A;  2W62 A;  3RQW A;  5JDG A;  4DV2 T;  4GK5 E;  3ZPO A;  4EB6 E;  2Q9Q C;  2BVM A;  3C79 A;  3KV9 A;  1I94 T;  4BQT A;  4H63 H;  1HG5 A;  3HR0 A;  5BRX A;  4B3S T;  4EYU A;  2V6X A;  2IHR 1;  4WZX A;  2E9X C;  3DP7 A;  4U2Y A;  3UTK A;  4HFC A;  5AQK B;  4GIW A;  4PK6 A;  2LRK A;  3P4R A;  1X9B A;  5AFL A;  2IC9 A;  4WYV A;  1WFD A;  4JBW F;  2Q9Q B;  2C5J A;  4OFZ A;  5AFM A;  4WBO A;  4XHE A;  2YMD A;  2YK0 A;  4P1N A;  1E1H B;  4IST A;  3WTI A;  3LJC A;  3KBT A;  1XDO A;  2V5D A;  3UFE A;  4ZOL E;  4YTP A;  2CXF A;  2E9X B;  3N9M A;  5LMN T;  3QOF A;  4TUY E;  3A7M A;  3RIU A;  4HE8 A;  3CKD A;  3O1H A;  3FZL B;  2CHN A;  2D0T A;  1UW6 A;  3OYZ A;  5CA0 E;  5SYO A;  3P50 A;  2QVA A;  3P4Q A;  1X79 A;  2XTL A;  1N32 T;  4OYJ A;  5LOV E;  2I6H A;  3C98 B;  4AQG A;  5JDN A;  2VQF T;  3RF1 A;  3LBX A;  3EDV A;  4HFE A;  1FIO A;  1WLX A;  1QUU A;  3AAE B;  3R6N A;  4L5G A;  4M1P A;  3SS1 A;  5ABE A;  3FZH B;  1Z0P A;  2LSG A;  5JH7 E;  3ZEF B;  5JDQ A;  2N9D A;  1HR0 T;  3LK2 B;  4TWD A;  4IE0 A;  4PW8 A;  3SQ9 A;  2Q9Q A;  1W09 A;  3OBV E;  3QNU A;  5AFN A;  4U2Z A;  3R84 B;  5LHH B;  4UV9 B;  3O4X E;  1JNR A;  4EZ1 A;  1J1J A;  2PBI A;  2H7O A;  3JAF A;  4U31 A;  2BYS A;  2WNL A;  3MA9 A;  2OV9 A;  3IA3 A;  4ISS A;  5LXB A;  3RKG A;  1HNW T;  1YKE B;  3VHL A;  1BR1 A;  1ZEE A;  3F31 A;  5AQF B;  4CI2 B;  1OED C;  3LDQ B;  2KWH A;  2C0S A;  1I9B A;  3NRX A;  4PK5 A;  5LGU B;  2NWB A;  5ETW A;  3U8J A;  1VRB A;  4O2B E;  2A72 A;  3FZK B;  4HKA A;  4PJM A;  3WTN A;  2FJB A;  3NRY A;  2MAW A;  2EHO D;  4UM3 P;  2WM9 A;  1ZOY A;  4MBQ A;  2JMH A;  1OED B;  3KVB A;  4AQY T;  2WDR A;  2CM0 A;  4YXD A;  3AED A;  2KLQ A;  1IJ6 A;  3I1A A;  3KV6 A;  4HQP A;  5AQG B;  5AFH A;  5ABF B;  2LSY A;  4TN7 B;  3OVU A;  2BG9 C;  2V7K A;  4AKL A;  4A98 A;  3U8L A;  2K5B B;  4AQF C;  3NKZ A;  1UK5 A;  3AE9 A;  4I43 B;  4HWC A;  5DJQ C;  3TLU A;  1OXZ A;  1XDP A;  1UX4 A;  3A8Y C;  2LHN A;  3Q5D A;  4I55 E;  2XNV A;  2LM9 A;  2CWO A;  2W00 A;  2WMN A;  5EK3 A;  3OTO T;  3ETV A;  1FMW A;  4MHC A;  5EK4 A;  2BG9 B;  5ADX L;  2L9Q A;  4X64 T;  3B57 A;  3L3P A;  4AIS A;  2K24 A;  3L09 A;  4KP3 C;  4G2A A;  2XQ7 A;  3EAB A;  2W63 A;  2M6I A;  2KMF A;  3FHN A;  4CI1 B;  2BYN A;  2PH9 A;  4OYK A;  2EHO C;  4U74 A;  4KX6 A;  5H6R B;  4WBN E;  1OWA A;  4PAG A;  5TAO A;  4CXW A;  3SRZ A;  1ZHC A;  2IML A;  4TV8 E;  5FY1 A;  3FZF B;  1IBM T;  5AFJ A;  5BR8 T;  2CCQ A;  3LFM A;  3QB5 K;  3PUR A;  3SH1 A;  3K3O A;  3K3Q C;  2VAS A;  2EHO B;  3AA7 B;  3LSV A;  2FUP A;  1MND A;  1LRZ A;  3AEF A;  2V7M A;  3AA6 B;  4ZEY A;  3UUM A;  1XZY A;  4COF A;  4H9N C;  2WB5 A;  2XNT A;  4DR1 T;  3BK9 A;  2LOP A;  5L3E B;  4O2A E;  3AAI A;  2WU5 A;  4F6R C;  1UGO A;  3HKB E;  5HXH A;  2XQ9 A;  4P0A A;  2BS2 A;  4ALX A;  2YN6 A;  4F8H A;  5LA6 E;  2YOE A;  5AQT B;  2X67 A;  1BR4 A;  3VR8 A;  4QXB B;  2W8G A;  4UV8 B;  3ZT7 A;  5HXR A;  2LSJ A;  2UZ6 A;  1D0Z A;  3V5S A;  3P4S A;  3RIA A;  5AQS B;  3WTH A;  3IHR A;  1T8B A;  1UCU A;  3AA0 B;  2J47 A;  3OJA A;  2NW8 A;  2UUC T;  4LF6 T;  2V6Y B;  3PU3 A;  2BBJ A;  3FB2 A;  2KXP B;  2BKN A;  4WNK A;  3K1S A;  2X00 A;  2LSK A;  3KFW X;  3VRA A;  5JRC B;  4FI5 A;  3J7Y q;  2MOZ A;  4MAL A;  4TWF A;  3ZYK A;  4CQI A;  1US7 B;  2X0H A;  3SFD A;  3UU4 A;  2YDS A;  2XQY A;  4IHJ E;  3PUW F;  4IE7 A;  5L4H A;  4TNV A;  1HS7 A;  3WTJ A;  5LBQ B;  3EI0 A;  3AVR A;  3U8N A;  3RRC A;  2Y58 A;  2D5U A;  5KX5 E;  3TLV A;  4JI5 T;  2LRL A;  3SQ6 A;  3AE6 A;  1MMD A;  3VKG A;  2LHR A;  4O4L E;  5LHG B;  5DQV A;  2LKG A;  3QUJ A;  2HPJ A;  3VR9 A;  2YDR A;  4HWI B;  5F5W A;  2E5L T;  3K8P C;  2N1G A;  3RPU A;  3U78 A;  1Y01 A;  2I0M A;  3RX6 A;  3V5U A;  3JAE A;  4TX5 A;  2PFV A;  3FBL A;  3PUZ F;  2OLT A;  3CPZ A;  4H9R C;  3UU5 A;  3ZN0 B;  5C8Y E;  2Y8D A;  5E0O A;  1WRD A;  2DNX A;  5JME A;  2IC6 A;  4I0U A;  5JR9 C;  4GYR A;  4EV6 A;  4YLH A;  3MAC A;  3CWZ B;  2X9X A;  4KBM B;  4TV9 E;  5JRC A;  3HKD E;  4ANJ A;  2KIN B;  2FJA A;  3B13 A;  2ZLY A;  4NXM T;  4DR7 T;  4H9S E;  1LVK A;  3KBU A;  3JCF A;  4QH4 A;  1M62 A;  3UFG A;  4CI3 B;  5JR9 B;  2XAG B;  3MJX A;  2KT9 A;  3A5X A;  3PUG A;  5LP6 E;  4U3C A;  5L3G B;  2XSA A;  5J5F A;  3ZYL A;  3SFE A;  4L9I A;  1NEK A;  3H3A A;  4DR3 T;  3N9O A;  3EAM A;  2WS3 A;  1KK7 A;  4UR9 A;  5FVK A;  4TZ4 C;  2X68 A;  3UUL A;  2JMK A;  4CN4 A;  1HNZ T;  2XPK A;  4JI4 T;  4EGW A;  3RQU A;  4QKN A;  5FP3 A;  4LFC T;  2JQQ A;  1W9R A;  3LK3 B;  5IUX A;  3ZJ2 A;  1WCR A;  2UXX B;  2XZE A;  3AA1 B;  4JYA T;  4DV6 T;  2XM2 A;  1IZN B;  4AI6 A;  2LSI A;  1HX8 A;  2WWU A;  4H9O C;  2WDQ A;  2LKH A;  2L8K A;  3CX6 B;  4IIJ E;  1R8I A;  4HFV A;  1YKH B;  1SE7 A;  1D0X A;  3ZMV B;  5J5I A;  5AQH B;  4KI0 F;  4TNW A;  3BQL A;  5HWY A;  2DLR A;  5FYM A;  4ASK A;  4IRE A;  3ZN1 B;  2HN2 A;  4HN9 A;  4ZHQ E;  1E2A A;  4IL4 A;  5EZY E;  4DND A;  2BBH A;  2X9H A;  2BYQ A;  5BMV E;  3U8K A;  5FY7 A;  1S94 A;  2YEV C;  3TLS A;  2NTY A;  3AEG A;  2Y54 A;  3ZST A;  4IE4 A;  3EVY A;  3QC9 A;  4A97 A;  5L3F B;  2J1D G;  4ADZ A;  5JTG A;  3NVO A;  4QXH B;  5KE4 A;  4DMW A;  4UIG A;  1N34 T;  4LML A;  1J5E T;  1KNR A;  3AXJ B;  2VL0 A;  5IYZ E;  2LE8 A;  3C50 A;  1UX5 A;  2I59 A;  5IWA T;  1T7S A;  4DMV A;  3ONL C;  3H3M A;  3LK4 2;  5HXE A;  2WQY A;  4XBF B;  2NR4 A;  1KEY A;  4EIW A;  3W15 B;  5KZU A;  4EED A;  2RA1 A;  4I4T E;  2PGZ A;  3SWH A;  3T8O A;  2Y6X A;  5DQW A;  5LMU T;  2E9X A;  3PDY A;  1KNZ A;  4YSY A;  2V1D B;  2F4V T;  2LT3 A;  2PJQ A;  1DU2 A;  5HCJ A;  2X9W A;  5FKY A;  2GK9 A;  3MKD A;  2P9B A;  2NTX A;  5F8P A;  1BR2 A;  2DL1 A;  3ZMS B;  4QX7 B;  5L3D B;  5FVL A;  3E0Z A;  2VB6 A;  4UEL A;  4EZ4 A;  3VRB A;  2ZM2 A;  2W2U A;  3I0Q A;  4ILC A;  4X1K E;  4UY2 A;  4IDQ A;  2ACZ A;  1D1A A;  4YJ2 E;  2X66 A;  2YME A;  3OKQ A;  5LNK A;  4B3R T;  5FY0 A;  5AQU B;  5J1G A;  2MTQ A;  1SHZ C;  4A5X A;  3PTR B;  4ZS3 A;  3P4P A;  3Q5W A;  4IDZ A;  3ANW B;  5LGN B;  4UVA B;  3RGL A;  4A56 A;  1HTJ F;  2IDO B;  3UUN A;  5L3C B;  3IGQ A;  5HEO A;  3PUA A;  5IHY A;  4BJN A;  4EZH A;  4ZJT A;  3C84 A;  4AFG A;  3FBZ A;  4AKH A;  4PJJ A;  5EK2 A;  4JI8 T;  4EXT A;  2J62 A;  2BR7 A;  1CHU A;  1UUS A;  4YY3 T;  2A9U A;  4ZI7 E;  4FRR A;  2YU1 A;  4QX8 B;  2A3D A;  2XAF B;  5BW2 A;  5HEG A;  2CBJ A;  3LG7 A;  4CXX A;  2BKP A;  4ZZC A;  1EZ3 A;  4B5D A;  5HEH A;  2UXN B;  4UXU A;  2IAK A;  3ONJ A;  4PK4 A;  5LYJ E;  4D01 A;  1J5W A;  1ZKE A;  4G63 A;  2LJL A;  4QWN B;  4IDN A;  1MMG A;  2CXL A;  2LEH A;  5JVD E;  1WR6 A;  3EUH A;  5HXC A;  4YSZ A;  5AQR B;  4GKJ T;  1HNX T;  4CZZ B;  3AE5 A;  4IGU A;  5JQG E;  4KMC A;  3TLT A;  4ZK1 A;  5FJV A;  2VL8 A;  1IBK T;  3CX7 B;  3L8R A;  2XAS B;  1MMA A;  3PUY F;  1OED A;  2CE7 A;  2H3R A;  1YQ4 A;  4O4J E;  2Y57 A;  4ZXL A;  2C9T A;  3ESL A;  1MMN A;  5LBM A;  4B3T T;  4IDO A;  2H88 A;  2QGS A;  3J9X 1;  1HFA A;  4ERR A;  2XNU A;  5ABF A;  4UF0 B;  3ETU A;  5AQQ B;  2ZMA A;  2CXD A;  3AE2 A;  4P0B A;  5AQM B;  2XAJ B;  1CUN A;  2FJE A;  4IE6 A;  1D1B A;  1W0B A;  3CK6 A;  5GON E;  3HL6 A;  4U72 A;  3GN5 B;  2YDQ A;  4DV0 T;  3OYX A;  5LJN A;  3UQ4 A;  5LG3 A;  3GMI A;  3Q5E A;  2VKJ A;  2BYR A;  5JDF A;  5JDH A;  2BG9 A;  4JI7 T;  2Y7Y A;  2WSS V;  4PFO A;  4AQF A;  4ILB A;  5AQP B;  1ZV4 X;  5LXT E;  4Z91 A;  3RYH E;  1YW0 A;  2K9A A;  4IT4 A;  2WN9 A;  1Y64 B;  1OED E;  5TVC A;  5J5H A;  3PUQ A;  3ONX A;  5FL0 A;  2YIN A;  3PUS A;  3E22 E;  3S4U A;  3M3Z B;  4PFP A;  2JJ9 A;  4HWH A;  3MXZ A;  1XMO T;  3I0O A;  1NAF A;  2XQ6 A;  3L39 A;  4YSX A;  4UF0 A;  3UUX B;  4DV3 T;  2ZJV A;  2EHO A;  2W66 A;  1S35 A;  4PJL A;  4QH5 A;  3WTM A;  4QHO A;  2UUB T;  1VCS A;  2ZM0 A;  1D0Y A;  2K48 A;  5HEU A;  4DR4 T;  3GN5 A;  3C4Z A;  4X1Y E;  4QAC A;  2CMR A;  5ABH A;  3O1I A;  2NP9 A;  4ZZB A;  3AAA B;  3UUB A;  4UVC B;  2WWV A;  3OPC A;  3DJB A;  1G8X A;  3N2K E;  4AKI A;  1SA0 E;  4DO0 A;  3RYF E;  3QK6 A;  1G73 A;  4BJM A;  3PUV F;  3GUA A;  2CPT A;  2WNC A;  2VVS A;  4GK0 E;  3AEB A;  2BKO A;  2V5C A;  4PIR A;  4MFR A;  2H7V C;  1BR0 A;  3SOL A;  4HTE A;  2X9Y A;  3UT5 E;  3ZCI A;  2ACX A;  4ZRU A;  3WTK A;  2WMO A;  3MK7 C;  3O1J A;  2DHR A;  3AVS A;  2Q9Q D;  4ZS2 A;  5F3J A;  3T1H T;  1XNQ T;  3RI5 A;  2WP9 A;  2V6Y A;  2BDE A;  2R6G F;  5FXW A;  5HCM A;  4ILU A;  4GOU A;  5L4E A;  2E9X D;  2V7L A;  2V7I A;  3RIF A;  1FJG T;  2XAH B;  3UU3 A;  3AE8 A;  3PE0 A;  3RIU C;  5AFK A;  3Q9D A;  4WW0 A;  3AE7 A;  3E08 A;  4JLE A;  1UV6 A;  2XYT A;  5AFM B;  3WTL A;  5FL1 A;  2KND A;  3GWH A;  2FJD A;  5FXZ A;  1XNR T;  1O3X A;  2BJ0 A;  2W67 A;  2VUR A;  2JRK A;  1SUM B;  5CA1 E;  2XHE B;  3KVA A;  5L3B B;  3WIP A;  2RPA A;  5L47 A;  2XQ8 A;  4XZC A;  3BQK A;  4P09 A;  3C64 A;  3PJA A;  4NXN T;  3SIO A;  3EHZ A;  3RKO A;  3WAK A;  5CGM A;  4DV4 T;  2XAQ B;  2NW7 A;  4HWD A;  2BVL A;  2XZ6 A;  2BS4 A;  3N2O A;  5LCY A;  4Z8X A;  2H89 A;  2V7J A;  3RC3 A;  2QYW A;  3RHW A;  4DID B;  3PJA J;  1D1C A;  2QC1 B;  3FXD B;  4HEA A;  2HHH T;  1Z8U A;  4UXN B;  2UXB T;  3LBX B;  1IBL T;  3ZC0 A;  1QSD A;  2HN1 A;  2CHO A;  4BAY B;  4JI0 T;  2CRB A;  1FMV A;  3KV5 A;  3TLW A;  4NZB A;  3ABV A;  4YTN A;  2E8I A;  1MIV A;  5FNV E;  2OA5 A;  4JEU B;  3ZMZ B;  4DVD A;  4GYS A;  2VVN A;  3X1D A;  4QAB A;  5HEJ A;  3WI3 A;  2LOS A;  5DAB A;  1HG2 A;  4AIU A;  4UM1 A;  2WBL A;  5H6Q B;  4JV5 T;  3N9Q A;  4HFB A;  5JR9 A;  3RLF F;  5HYA A;  4X20 E;  5HAX A;  1KF6 A;  2Y48 B;  3HKE E;  2LM2 A;  4ZI2 D;  4UM3 S;  4LMJ A;  3P7I A;  2XY8 B;  3ZC1 A;  4QXC B;  5AFU L;  1NWM X;  4UVB B;  2IW5 B;  3AEE A;  3PEO A;  4OX9 T;  2V26 A;  1YQ3 A;  3P4W A;  2WZI A;  3IBP A;  3KV4 A;  2XJ7 A;  2VK9 A;  2BYP A;  2G0U A;  4DR2 T;  4UM3 A;  3PUX F;  1WYC A;  2RP4 A;  2XQA A;  3VU7 H;  1WYB A;  3N9P A;  2MYS A;  4DUY T;  4JI3 T;  4O4H E;  4YTM A;  2MPK A;  2AXD S;  2X51 A;  4DV5 T;  3N9N A;  4C90 A;  4NPP A;  1IJ5 A;  4MLK A;  2WZY A;  2QA7 A;  2C5I T;  3UQ7 A;  3RH3 A;  2X0L B;  4E7S A;  1U5P A;  1UX2 A;  2CLY C;  1E7P A;  5LJM A;  1ZP0 A;  5FMN A;  5JRE A;  2CWY A;  3P8C D;  2L3L A;  4V1A v;  4ZI2 C;  2VWA A;  2WZH A;  5CB4 E;  3CVR A;  5LB7 B;  2XM1 A;  4YT0 A;  4U7I A;  3UU6 A;  4HGA A;  2CLY B;  4LF8 T;  2LLY A;  2JIW A;  5JDL A;  2DCF A;  4DR6 T;  5A1L A;  4CN6 A;  1XMQ T;  5C3J A;  3AXJ A;  3CX8 B;  3D0T A;  1NEN A;  3HI2 A;  4ZI3 D;  4LF4 T;  4DV1 T;  4J2C A;  3K3N A;  5LG4 A;  2VKH A;  2X00 D;  2KWI B;  5ABG A;  4NUU A;  4X65 T;  4H9P C;  4NUV A;  2YKS A;  4AKG A;  2ZM6 T;  4HWF A;  3Q2M A;  1IAP A;  5AQJ B;  3UU8 A;  3NBX X;  2M6B A;  5CO5 A;  5AQV B;  3KDS E;  2JQK A;  5HWX A;  2DWK A;  5KDM C;  5CJ5 A;  4EEB A;  1VCT A;  4YFS A;  3N9L A;  4IL9 A;  2BS3 A;  2XQ5 A;  3MZK B;  2ZM8 A;  2W8F A;  3PU8 A;  5AQL B;  4LF9 T;  4XAX B;  4UEM A;  3ZT6 A;  3O9X A;  5J5G A;  1GQE A;  2XSB A;  4JUY A;  4DUZ T;  2D2S A;  4C91 A;  4ZJS A;  4LF5 T;  4LF7 T;  4YHH T;  2FBW A;  3JC6 D;  4X5T A;  1N33 T;  3N2G E;  3TKL B;  2HH7 A;  1W0A A;  3PV0 F;  2VKD A;  4X66 T;  2UXD T;  5LHI B;  4QAA A;  2JQ9 A;  4LFB T;  4ZK4 A;  1I6Z A;  5AQN B;  5KMG P;  4AFT A;  3RYC E;  2E2A A;  2UUA T;  4NIQ A;  1V9D A;  4BA9 A;  3ZYM A;  4ZI3 C;  2AE9 A;  3ANW A;  3AEC A;  3ZMT B;  3ZDG A;  3ZT5 A;  3U3I A;  4L0R A;  4CXY A;  2XZ5 A;  5HXS A;  2CEA A;  4DV7 T;  4KHP T;  4BFQ A;  2KZ7 B;  2WDV A;  2XQ3 A;  1VOM A;  3T1Y T;  2CBI A;  1KFY A;  4H63 V;  3ZDH A;  2B76 A;  3FZM B;  2QRX A;  2CA5 A;  1HCI A;  3ZLI A;  2A2F X;  2BZB A;  2X0Y A;  1LKX A;  1MIY A;  4U33 A;  4LMK A;  2WU2 A;  3U8M A;  4OK0 A;  5J0Z A;  4ZR6 A;  2D0U A;  3C51 A;  5FXV A;  3GA8 A;  2VKO A;  3C4X A;  1HX1 B;  2NOX A;  4EYY R;  2WNJ A;  2WAU A;  3JC6 C;  4DR5 T;  3WAJ A;  4DBQ A;  4EAH A;  3EDU A;  4PNI A;  4IDP A;  4O4I E;  5BP0 A;  3WTO A;  1B7T A;  3IF8 B;  5J2T E;  4ILA A;  4HFH A;  5JDM A;  4YJ3 E;  3CIR A;  3NZQ A;  1AJ3 A;  5J2U E;  4I50 E;  3CML A;  2SPC A;  4B6X A;  4HFD A;  1N36 T;  4AFH A;  2W61 A;  2BR8 A;  3AE1 A;  3CQG B;  5LGT B;  4CN1 A;  2NW9 A;  3NWI A;  2B1E A;  1H7C A;  3KIN B;  5FXX A;  4HFI A;  4PJN A;  1WR0 A;  2WCA A;  1T98 A;  1M7K A;  3JAD A;  3ZSS A;  1KNP A;  4K0U A;  3F57 A;  3FXE B;  2ES0 A;  2C5K T;  3VKH A;  1JNZ A;  2ODU A;  2E5V A;  4QH1 A;  2MBG A;  3IEE A;  4O8S A;  5CFB A;  1L0V A;  3B5M A;  2JQH A;  4WV9 A;  1HF8 A;  2BG9 E;  1T72 A;  1LVF A;  1YD8 G;  4XK9 A;  4H9Q C; 
#chains in the Genus database with same CATH homology
 4D01 A;  4Z91 A;  3WTK A;  5J0Z A;  4TNW A;  4ZR6 A;  3U8J A;  2XQ4 A;  4IL9 A;  3WTN A;  2X00 A;  2WN9 A;  2MAW A;  2XQ5 A;  4NPP A;  1OED E;  4IRE A;  5TVC A;  5J5H A;  3RI5 A;  3TLW A;  2W8F A;  2Y56 A;  4NZB A;  2WZY A;  4UM3 P;  5J5I A;  2WNJ A;  4HFE A;  1OED B;  3ZKR A;  3RQW A;  4QH4 A;  3UQ7 A;  4IL4 A;  4ILC A;  4TWF A;  2BYQ A;  5J5G A;  5AFJ A;  3PMZ A;  3UU4 A;  2ZJU A;  4UY2 A;  3U8K A;  5HCM A;  3TLT A;  4ZK1 A;  4QAB A;  5FJV A;  5L4E A;  3SH1 A;  3TLS A;  5HEJ A;  1UX2 A;  3C79 A;  5L4H A;  4ZJS A;  4BQT A;  2Y54 A;  4TNV A;  3LSV A;  5BRX A;  3RIF A;  1OED A;  4TWH A;  4X5T A;  2YME A;  3WTJ A;  4UM1 A;  3UU3 A;  4HQP A;  3EI0 A;  4TWD A;  5BP0 A;  5AFK A;  3WTO A;  5J5F A;  4HFB A;  5AFH A;  3U8N A;  2XQ6 A;  4A97 A;  2Y58 A;  4ILA A;  4COF A;  4HFH A;  2Y57 A;  1UV6 A;  2C9T A;  2XYT A;  3SQ9 A;  4XK9 A;  5AFM B;  3TLV A;  3EAM A;  2XNT A;  2ZJV A;  4HFC A;  3WTL A;  2BG9 C;  4QAA A;  5KE4 A;  3SQ6 A;  4ZK4 A;  4QH5 A;  3WTM A;  4AFT A;  2LM2 A;  4UM3 S;  4LMJ A;  4A98 A;  5AFL A;  3U8L A;  2XNU A;  4HFD A;  3IGQ A;  3T4M A;  4AFH A;  5HEO A;  4LML A;  5HEU A;  5AFN A;  3UU6 A;  2BR8 A;  2LKG A;  5AFM A;  2VL0 A;  3RQU A;  2BJ0 A;  4ZJT A;  2LLY A;  2XQ9 A;  3TLU A;  4XHE A;  4ALX A;  2YN6 A;  3C84 A;  4AFG A;  4F8H A;  2YMD A;  4EZ1 A;  2YOE A;  4QAC A;  4HFI A;  5IUX A;  2XNV A;  3WIP A;  3PEO A;  3WTI A;  3ZDG A;  2BR7 A;  2W8G A;  4ZZB A;  3JAF A;  3P4W A;  3UUB A;  2BYS A;  3JAD A;  5L47 A;  2XQ8 A;  2WNL A;  2XYS A;  2UZ6 A;  2XZ5 A;  3JAE A;  2BG9 B;  3UQ4 A;  5LXB A;  3SIO A;  2X00 D;  3EHZ A;  4BFQ A;  5KZU A;  2BYP A;  4FRR A;  5LG3 A;  2XQ3 A;  2PGZ A;  3UU5 A;  3RIA A;  4UM3 A;  2YKS A;  3WTH A;  2BYR A;  3UU8 A;  4QH1 A;  5BW2 A;  2LKH A;  2XZ6 A;  3ZDH A;  1OED C;  2XQ7 A;  5HEG A;  5CFB A;  3GUA A;  2M6B A;  2BG9 A;  2XQA A;  2WNC A;  5CO5 A;  2M6I A;  1I9B A;  4WV9 A;  5JME A;  4ZZC A;  1UW6 A;  2Y7Y A;  4PIR A;  3RHW A;  5SYO A;  4B5D A;  2BG9 E;  5HEH A;  2QC1 B;  4Z90 A;  5HCJ A;  5AIN A;  4DBM A;  4ILB A;  4LMK A;  4UXU A;  2BYN A;  3P50 A;  2PH9 A;  2KSR A;  3U8M A;  4ZRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...