2XQ5A

Pentameric ligand gated ion channel glic in complex with tetraethylarsonium (teas)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
total genus 74
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq5A01
1UV6A 3WTHA 4ILAA 2WNLA 3ZKRA 3IGQA 3WTMA 4D01A 2LLYA 4X5TA 3RQWA 4DBMA 5SYOA 3ZDHA 4IL4A 5HEUA 2BR8A 2XNUA 3RQUA 4A97A 3PEOA 2WN9A 2XQAA 2UZ6A 5AFKA 4HFDA 2BYQA 4FRRA 4ALXA 5AFNA 5HEOA 2ZJVA 5KZUA 2XYSA 2Y54A 2WNJA 4ZZBA 5AFMB 2LKHA 4ILBA 4UM3A 3U8KA 2MAWA 5J5FA 5CO5A 3WTKA 2Y57A 2WZYA 4Z91A 4ZJSA 2BYNA 2YN6A 4WV9A 5HEGA 3SH1A 5L47A 4EZ1A 2XQ3A 2BG9E 5FJVA 4QH1A 3RI5A 3TLUA 3UU8A 3U8MA 2XQ8A 2XZ6A 4AFTA 3P4WA 5J5IA 4QAAA 5J0ZA 2X00D 2Y7YA 5J5HA 4QH5A 3WIPA 3WTIA 2BYRA 4ZK4A 2ZJUA 2YMEA 3U8LA 2XNVA 3U8JA 2BG9A 2KSRA 4A98A 2XQ9A 5L4HA 4AFHA 4PIRA 5HCMA 3SQ6A 4ZR6A 1OEDC 2XQ5A 3EAMA 2VL0A 3U8NA 4HFEA 2Y58A 4ZK1A 5AFLA 2QC1B 4TWHA 4UY2A 3RHWA 2XQ6A 3WTOA 3C84A 5TVCA 3LSVA 5L4EA 2X00A 4TWFA 3C79A 2XZ5A 4XHEA 1UX2A 2W8GA 3T4MA 5BW2A 5AFJA 4TNWA 4UM3P 5LG3A 4F8HA 3RIAA 3GUAA 3EHZA 2BYPA 3TLTA 1OEDB 3JAFA 3WTJA 2Y56A 4ZJTA 2YKSA 4QH4A 5HCJA 4QABA 2BR7A 3WTLA 4IL9A 4HFIA 3UU6A 4BFQA 5AFHA 2XQ4A 3SQ9A 5KE4A 4NZBA 4HFHA 2XNTA 2YMDA 4ZZCA 5BRXA 4TNVA 2W8FA 5IUXA 2PH9A 3JAEA 4Z90A 2XYTA 5J5GA 4B5DA 4AFGA 2M6BA 3UQ7A 2XQ7A 2M6IA 3UU3A 4COFA 3P50A 2BG9B 2BYSA 4IREA 4QACA 2PGZA 3JADA 4BQTA 2C9TA 2LM2A 5HEJA 5BP0A 4HQPA 4ILCA 5CFBA 2BJ0A 4HFCA 3UU4A 5AFMA 3TLVA 3TLWA 4UXUA 5JMEA 4LMKA 4TWDA 1OEDE 4LMLA 3PMZA 2BG9C 2YOEA 4ZRUA 4UM3S 3TLSA 5LXBA 3SIOA 5AINA 2LKGA 4NPPA 4HFBA 5HEHA 3EI0A 4UM1A 1I9BA 3RIFA 2WNCA 3UQ4A 3UU5A 3WTNA 3ZDGA 1UW6A 3UUBA 4XK9A 1OEDA 4LMJA
chains in the Genus database with same CATH superfamily
3ZEFB 1D1CA 4HFVA 3ZKRA 4IDNA 3RQWA 2BZBA 4QKNA 3NRXA 2DI4A 1G8XA 4DR6T 1HNWT 5H6RB 3UT5E 4JYAT 2BYQA 2YDRA 5HEOA 5KX5E 5LHIB 3OPCA 2CHOA 4MLKA 2K3WA 3ANWA 1XDPA 2OLTA 4GK0E 3N2OA 2WWVA 3KDSE 2RP4A 2DCFA 4WYVA 2BG9A 3ZCIA 2XAHB 2V6YA 3KBUA 4PK6A 1BR1A 2W2UA 4UY2A 4ANJA 3AEDA 2DNXA 2XZ5A 3BQIA 3F57A 3KV4A 4QXHB 2XM2A 2KLQA 1ZKEA 4CI2B 4EYUA 3WTLA 4AI6A 5L2LA 5DQVA 4DV6T 3P7IA 1T8BA 3OKQA 2XQ7A 3N9MA 3A5XA 4LFCT 3PJAA 4IGUA 1UUSA 1E2AA 4DR5T 3RC8A 3ZN0B 5LP6E 2LSJA 1OEDE 3CK6A 4YTMA 3RYFE 3V5UA 3RKOA 3WTNA 1HX1B 3FBLA 2NW7A 3OTOT 4JLEA 1J1JA 3IGQA 2NP9A 3AEAA 2CE7A 3RPUA 2NOXA 4IL4A 1T72A 5AQLB 2WS3A 5HWYA 5AFNA 2KINB 4IDZA 2PBIA 2JQ9A 1Y64B 3AE5A 1AJ3A 2JQKA 3U8MA 3UFGA 5A1LA 5J5IA 2UUBT 4JEHB 5LGTB 3WIPA 3UUXB 1WYCA 2ZJUA 3U8JA 5L4HA 2JQQA 3WI3A 5DABA 2QC1B 4JI0T 5ABEA 3KV9A 2ACXA 4QABA 5FXZA 3UU6A 5LMUT 4ZZCA 4EOZB 1UX4A 3WAKA 2A3DA 4X20E 3JAEA 3OVUA 3VKHA 5AQIB 2LHNA 2X9XA 4ILCA 2PJQA 3PUAA 3FZHB 4GYRA 4OX9T 2BJ0A 4LMKA 3AEGA 2CLYC 2IAKA 2BKOA 5E0OA 2Q9QA 4NPPA 5AFUL 3ABVA 3UU5A 4JI2T 2CPTA 2W62A 1JNRA 1ZV4X 2WQYA 4JV5T 2CLYB 3P4RA 4MALA 2C5KT 4IHJE 5LJNA 3PURA 4H9QC 1MIYA 5FXXA 1B7TA 4EEBA 5AQNB 2C0SA 1E7PA 3LG7A 2WCAA 3NVOA 2IC9A 3WAJA 5AQMB 3AE7A 2ODUA 3AE9A 1HNXT 2ACZA 2J4GA 2EHOC 3AE6A 5IHYA 3H3AA 4WV9A 1UCUA 2FBWA 1U4QA 5JR9A 5LBMA 2K5BB 1S35A 2EHOB 4KBMB 3KV6A 3UFEA 1S94A 3QC9A 4IE6A 1ZP0A 4ZR6A 2QGSA 4P09A 3RYIE 5HXEA 3ZYLA 5J2TE 2FJBA 1LVFA 3PUWF 4QX7B 4I55E 5JDQA 4XHEA 1YQ3A 5LG3A 1E1HB 4B3TT 3GUAA 2JMHA 1W09A 3WTJA 1L0VA 1U5PA 3PUXF 2IIUA 4ZJTA 3RF1A 3Q5WA 4AQGA 2CWYA 3ZMTB 2BS2A 4QXCB 3JC6C 1IAPA 3ZMVB 5IUXA 2X0HA 4NXMT 5JREA 4AKGA 3PJAJ 4UXNB 1G73A 4YFSA 5FY0A 4IE5A 5LHGB 3PV0F 5BP0A 3N5LA 1D1AA 1YQ4A 3UU4A 3QNUA 3RLFF 2X9HA 2OA5A 5HEHA 4EGWA 2UUAT 2X66A 2M67A 4DIDB 4X5TA 3O4XE 5EK2A 2XUEA 3CX7B 2YDSA 3PEOA 3LK2B 1W0AA 3AE8A 4EYYR 2MOZA 1KEYA 4TX5A 3I9YA 1I94T 4DR3T 4Z91A 2IHR1 3ZMUB 4L9IA 4HN9A 2VASA 2LSKA 5JRCA 3P4SA 4ASKA 4AKLA 5LYJE 3NZQA 2XZ6A 4JI5T 4UEMA 3P8CD 3X1DA 3RH3A 3N9LA 3I0QA 3J7Yq 3H3MA 3SQ6A 5GONE 2CBJA 3MJXA 3LBXB 3HA4A 4EXTA 2UXCT 4PK4A 4PJLA 5HXHA 2V7MA 2MPKA 5BRXA 2W8FA 3FZMB 4HWCA 4LF5T 2H3RA 4AFGA 2BBHA 2HPJA 3ZYKA 3VRAA 4LF7T 5FXVA 4QWNB 4B3RT 2XAGB 3L39A 1V9DA 1KNRA 4UM3S 4QX8B 2KZ7B 2EHOD 5J2UE 2ZM0A 3DJBA 2XAQB 3LK3B 1UW6A 4EAHA 4ILAA 4PNIA 3Q5EA 5FVKA 2WDVA 4GKJT 5AQKB 3AEFA 1LVKA 5JDFA 3HI2A 2E9XC 3HKEE 4X65T 4X66T 5EZYE 2LHRA 5CGMA 4HKAA 4DV2T 4U72A 4G2AA 4OYJA 3BK9A 4ISTA 2WZYA 3NBXX 3Q5DA 5M4YA 3KV5A 3EDUA 5F8PA 4V1Av 3ZMZB 2XQ8A 1MMDA 3NZPA 1W0BA 2XQ9A 4P1NA 3RC3A 4YT0A 5J1GA 3CQGB 1W9RA 1I6ZA 1XZYA 2WU2A 5TVCA 2H88A 2KWHA 2W8GA 5BW2A 3F31A 2UXNB 1HR0T 2V8SV 5FNVE 3RIAA 4TV8E 2D2SA 2LRKA 4AQFC 5CA1E 2BR7A 4TNVA 5LHHB 4Z90A 3HR0A 2M6IA 4YSXA 3EUHA 1H7CA 4OFZA 3JADA 2LM9A 3N9OA 3RRWA 4FI5A 3K8PC 3CQXC 2LSIA 5AFMA 3ONXA 3T1HT 3CIRA 4B3ST 3Q5XA 5ABFB 3C98B 4I4TE 2YU2A 3UUBA 4DO0A 1JNZA 5KE4A 1HCIA 3ETVA 2C5IT 5FVLA 4TUYE 4O4IE 3RX6A 2UXXB 2Y6XA 3AEEA 2BVLA 2BKNA 2XYSA 4KP3C 1CUNA 3N9NA 2BBJA 2XQYA 4CN4A 2VQFT 2YINA 2BYNA 2IW5B 5KXJA 2MBGA 2YN6A 3Q9DA 1KNZA 4HE8A 2B1EA 4UVCB 2E2AA 2YMEA 4CI3B 4WNKA 2LRLA 5FMNA 2W67A 3C84A 2X00A 4UIGA 5LNKA 3ZC1A 1IZNB 2W63A 4YSYA 3RKGA 1YW0A 2Y56A 1VOMA 5DQWA 4DUYT 4CXXA 5HXSA 3A8YC 2B76A 5AFHA 4NXNT 2VB6A 4DBQA 1NEKA 2XYTA 3MZKB 4C90A 3UQ7A 2UXDT 2J1DG 3B57A 2BYSA 2E9XD 4IREA 2C9TA 3ZSTA 2LOSA 1HS7A 1OWAA 1HFAA 4LMLA 5CJ5A 3T8OA 2BVMA 4HFBA 2UXBT 4ERRA 1I9BA 2JIWA 1CHUA 4XK9A 1UV6A 3WTHA 2XHEB 2WDRA 3N2GE 2ZM2A 5L3FB 3CKDA 1XNRT 2LT3A 3CMLA 5L3CB 4FRRA 3ZJ1A 5AQGB 3RIUC 1KFYA 5AQTB 1T98A 4I0UA 2WDQA 2Y57A 3SOLA 2NW8A 1YXRA 3OJAA 4DR1T 2K48A 3SH1A 5ADXL 2BG9E 2CMRA 3HKBE 1FJGT 4M1PA 1IBKT 4BJMA 5HYAA 2VKOA 5J5HA 5KMGP 2JMKA 2BYRA 2RA1A 4YHHT 3ZYMA 4A98A 2HN2A 2WMNA 2XY8B 2PTFA 3OYXA 1OEDC 3U8NA 3RHWA 2XQ6A 2FUPA 4UR9A 3FZLB 2QRXA 4X62T 4TWFA 1D0XA 1MIVA 4TNWA 4CZZB 4NUVA 2WMOA 3AVSA 2I0MA 3HKDE 1OEDB 1HG5A 1J5WA 2WAUA 4MHCA 1Y01A 3AEBA 1QSDA 1MMAA 3RRCA 4A5XA 2BG9B 2EHOA 1WYBA 2ODVA 5C3JA 3PUVF 3PUYF 5ABGA 1UURA 3H37A 2NW9A 2LKGA 2VKDA 1WR6A 4UF0A 4UM1A 3RIFA 4AIUA 4HWHA 5AQHB 3RGLA 2WNLA 1HNZT 2A2FX 3ZSSA 2LLYA 4DBMA 2I59A 3V5SA 5LXTE 4X64T 4AISA 1QUUA 1XMQT 3PDYA 3LJCA 4Z8XA 4LF9T 4E7SA 4YTPA 3CVRA 2DL1A 4N78D 2RPAA 4ILBA 2X9WA 2YDQA 4CN1A 3CQCB 3AAAB 4ZJSA 2VL8A 1D0YA 3E08A 4B6XA 3UU8A 2XSAA 2V26A 4HWFA 2X68A 2LE8A 1J5ET 1BR2A 3EAMA 3R6NA 3M65A 4EV6A 1N34T 5L4EA 3HKCE 3T4MA 4WW0A 2BYPA 4GYSA 5L3BB 3AA7B 3A7MA 1XWMA 2YMDA 2MTQA 2XJ7A 5DJQC 3G06A 4MFRA 4L5GA 2FJDA 5F3JA 3ZLIA 4O4JE 2D0UA 2PGZA 4BQTA 5LGUB 2YK0A 1O3XA 4I43B 4HFCA 3CX6B 2LSYA 1Z8UA 2Y48B 4TWDA 4U7YA 2CRBA 5AQUB 3UTKA 2WNCA 3AE1A 5J5FA 2ZMAA 4CXYA 4D01A 2VKHA 1N33T 4TV9E 3RQUA 3SWHA 4CN6A 4ALXA 2VQET 2ZJVA 4MBQA 1ZEEA 1IBLT 4H9RC 3P4QA 1IJ5A 2OV9A 4ZXLA 3SFDA 5LMNT 4HWDA 3PE0A 3AB3B 1M7KA 1KK7A 2BKPA 1WCRA 2IUBA 4ILUA 2CHNA 3AXJB 3PUZF 1FMVA 4QAAA 2DLRA 2ZM8A 3WTIA 3LK42 2W00A 2XNVA 2QVAA 4PFPA 4ZI3C 4H9NC 5AFLA 3I9WA 1UX2A 4UELA 5JR9C 2A72A 2KNDA 4YY3T 2CXLA 4ADZA 3EHZA 2JQHA 3AVRA 5HCJA 2SPCA 2PFVA 2D9DA 2H7OA 2E9XA 5JR9B 4B3MT 3E0ZA 1GQEA 2NWBA 2L9QA 2M6BA 5JTGA 3P50A 2X0LB 2ZLYA 5LJMA 3CX8B 3BQKA 3TLVA 5AQOB 3I1AA 4JUYA 3J9X1 5AINA 4DMVA 2KXPB 3ZDGA 2WBLA 4ISSA 5AQPB 2FJAA 1VRBA 1VCSA 2L3LA 2XSBA 3ZDHA 2JRKA 3B5MA 2E8IA 2IDOB 3FZFB 5JDGA 2A9UA 5AFKA 3R84B 4AQFA 1BR4A 4AKHA 3GMIA 3GA8A 4O2AE 5L3EB 3U8KA 2Z6EA 4KHZF 4JI7T 3CWZB 1Z0PA 3ONLC 4DBRA 5L47A 3KVAA 2XQ3A 5FJVA 3RI5A 2HN1A 5FY1A 4YJ3E 4WZXA 4Q25A 5JDNA 2Y7YA 3IEEA 4QH5A 3AE2A 3S4UA 1MNEA 4DR7T 5AQSB 2XZEA 5ABHA 2XQ5A 3PUQA 3AA1B 1OXZA 1HG2A 4U3CA 4LF6T 3MACA 2AXDS 4YXDA 5JRCB 4IL9A 3C4WA 4DR4T 3SQ9A 4NZBA 4H63V 2V5DA 4IE0A 5J5GA 1VCTA 5BMVE 1WFDA 2LM2A 3VRBA 2UU9T 4KX6A 3K3OA 2V7IA 3EI0A 2MYSA 2NTXA 2V1DB 3PUGA 3SS1A 1KNPA 3O1JA 2J62A 2I6HA 3IA3A 3L09A 3EABA 2X0YA 1N36T 3FHNA 4DVDA 5FXWA 4ZI3D 4DNDA 3GWHA 2X9YA 2Y8DA 3N9PA 3JCFA 1LRZA 4KMCA 2D0TA 5KZUA 4DV4T 4AQYT 3NKZA 4ZZBA 2N1GA 2CXFA 4IE7A 4CI1B 3LFMA 3ZT7A 4O4HE 3FXDB 5HEGA 3HL6A 1R8IA 3QB5A 4UV9B 4ZK4A 4C91A 4WBOA 4PK5A 2VL0A 4ZK1A 4HFEA 4EIWA 1NWMX 3LSVA 2H7VC 5BR8T 5EK3A 3AAIA 3IHRA 4DV1T 1ZOYA 2WZIA 4QH4A 1QLBA 2XQ4A 2AE9A 4FJOA 3KBTA 2HPLA 2PH9A 3RIUA 3O1IA 4HGAA 1FIOA 3Q2MA 4PJNA 5IWAT 3ESLA 3AA0B 3C51A 3U3IA 2LSGA 1LKXA 4EZ4A 3ZMSB 5CB4E 5IYZE 4ZOLE 2XM1A 1OEDA 1MMNA 4OHFA 4BA9A 3ZJ2A 5HEUA 2D5UA 2HHHT 1WRDA 2G0UA 4X1IE 4P0AA 2X67A 2N9DA 5JQGE 4JI8T 2WM9A 4DV0T 2WNJA 2Y54A 4GK5E 5AFMB 4DV7T 2LKHA 2MAWA 1X9BA 3OYZA 3VHLA 2IMLA 3FB2A 2NR4A 3AA6B 2F4VT 2LJLA 3U78A 3P4PA 5J0ZA 1M62A 1UGOA 3CPZA 3GN5B 2KSRA 4AFHA 4GOUA 4LF8T 2L8KA 4JI3T 4IDOA 2K24A 4UM3P 3JAFA 4L0RA 4DV3T 4KI0F 4JI4T 2WY2A 5JDLA 3NRYA 4YSZA 4COFA 3MK7C 5L3GB 4IE4A 4YHJA 2K9AA 4HWIB 2V6XA 2XTLA 2VVSA 4YLHA 4HQPA 4F6RC 4LFBT 5LB7B 3TLWA 4O8SA 3MA9A 5JMEA 2BG9C 5LG4A 3ANWB 1MMGA 1YKEB 2BS4A 1SUMB 1T7SA 2WP9A 1WLXA 4K0UA 2XAFB 2V6YB 4U2YA 1D0ZA 2GK9A 2ZM6T 4A56A 1SA0E 4XAXB 1ZHCA 5AQRB 2VK9A 4TN7B 4XZCA 1YD8G 3PU8A 4UM3A 4AKIA 3QB5K 3O1HA 2VKJA 3UULA 4ZHQE 2DWKA 5FP3A 3E22E 4AFTA 1YKHB 2IC6A 5FL1A 3ZT5A 2WSSV 3K1SA 3OBVE 5HCMA 2CCQA 3IF8B 2E5LT 4KUMB 4U2ZA 3FXEB 4LF4T 5ETWA 3C79A 4EZHA 3C64A 3ZC0A 1HF8A 4NUUA 3TLTA 2YEVC 4BFQA 4HFIA 2XAJB 4HFHA 3PUSA 3N2KE 5KDMC 4DR2T 4KHPT 3AXJA 4OYKA 3VU7H 3UU3A 2KWIB 4UV8B 3ZT6A 4QACA 2FJEA 3MXZA 2ES0A 1US7B 3KFWX 3MKDA 5CA0E 3C4ZA 5AQVB 5HXRA 1NENA 1IJ6A 2YOEA 3SIOA 4GKKT 4U7IA 3UQ4A 3D0TA 2CXDA 4ZS3A 5JDHA 5FY7A 2W4XA 3SRZA 4O2BE 4IIJE 4H9SE 1HTJF 3LBXA 1XMOT 4IT4A 1EZ3A 1XDOA 2CA5A 5EK4A 4AKRB 2E5VA 3DP7A 2CM0A 3WTKA 5AQJB 4CQIA 1BR0A 4UF0B 4JEUB 3ZCJA 5F5WA 3LDQB 4EZ1A 1HX8A 5FKYA 5C8YE 3P4WA 4TZ4C 2X00D 2Q9QC 4UVBB 2V7KA 3DTOA 4BAYB 4JBWF 2WB5A 3VR8A 2Q9QB 2WZHA 3PU3A 2XPKA 4DMWA 4PJJA 4K0KT 2LEHA 4P0BA 3VKGA 5FYMA 4JI6T 1KF6A 2WWUA 2XNTA 3F2EA 2PG8A 3UUNA 5LCYA 2KMFA 2QA7A 2YU1A 2XASB 2DWGA 2CEAA 3PTRB 2C5JA 4O4LE 5HEJA 3AECA 4DV5T 2QYWA 3PMZA 3QUJA 5LXBA 4I50E 5L3DB 3M3ZB 4H9OC 4X1YE 3IBPA 4U33A 4IDQA 3C50A 3WTMA 3N9QA 3O9XA 4ZI7E 2BR8A 3ONJA 2WN9A 4UVAB 2LOPA 3TKLB 4QXBB 3AE3A 2WU5A 4OK0A 1X79A 5AQFB 3QOFA 5JVDE 5CO5A 5H6QB 1SHZC 1DU2A 1IBMT 3RYHE 2X51A 2BDEA 4QH1A 3TLUA 3K3QC 5TAOA 4ZI2C 4G63A 3QK6A 3FBZA 4U31A 4PIRA 3AAEB 2R6GF 5HAXA 1XNQT 2Y58A 5HWXA 4TWHA 4ZS2A 3WTOA 4YTNA 3I0OA 3KINB 2VWAA 2KT9A 3UUMA 3AE4A 4PAGA 5ABFA 4EB6E 4LFAT 1NAFA 4NIQA 1UK5A 4U74A 4CXWA 2JPFA 2V7LA 5LBQB 1MIWA 2NTYA 2JJ9A 3KVBA 1WR0A 5C2TA 4YJ2E 4H9PC 2J47A 4UXUA 4ZRUA 3TLSA 4IDPA 1D1BA 4JI1T 4XBFB 2E9XB 3L8RA 4LMJA 5FL0A 2CWOA 4HEAA 2Q9QD 2UUCT 5AQQB 5SYOA 1FEWA 3JC6D 4BJNA 1UX5A 2XNUA 5JH7E 4A97A 2V7JA 2XQAA 2UZ6A 3K3NA 4HFDA 4X1KE 3BQLA 3ZN1B 5LGNB 2HH7A 3EDVA 5JDMA 4GIWA 3FZKB 4H63H 5LOVE 4E7ZA 2CBIA 2H89A 3T1YT 3U8LA 2BS3A 4AXPA 2W61A 3ZPOA 5AFJA 2W0GA 1N32T 2N2NA 4F8HA 3L3PA 3W15B 2YKSA 4PFOA 4J2CA 3SFEA 5LA6E 4QHOA 3B13A 5HXCA 4B5DA 3EVYA 1FMWA 2V5CA 4WBNE 3NWIA 3ETUA 3RYCE 4EEDA 2VVNA 2P9BA 3GN5A 4ZEYA 5CFBA 1SE7A 4DUZT 2DHRA 4PJMA 4PW8A 3C4XA 1MNDA 2W66A 2VURA 3VR9A 4HTEA 4ZI2D
chains in the Genus database with same CATH topology
1UV6A 3WTHA 4ILAA 2WNLA 3ZKRA 3IGQA 3WTMA 4D01A 2LLYA 4X5TA 3RQWA 4DBMA 5SYOA 3ZDHA 4IL4A 5HEUA 2BR8A 2XNUA 3RQUA 4A97A 3PEOA 2WN9A 2XQAA 2UZ6A 5AFKA 4HFDA 2BYQA 4FRRA 4ALXA 5AFNA 5HEOA 2ZJVA 5KZUA 2XYSA 2Y54A 2WNJA 4ZZBA 5AFMB 2LKHA 4ILBA 4UM3A 3U8KA 2MAWA 5J5FA 5CO5A 3WTKA 2Y57A 2WZYA 4Z91A 4ZJSA 2BYNA 2YN6A 4WV9A 5HEGA 3SH1A 5L47A 4EZ1A 2XQ3A 2BG9E 5FJVA 4QH1A 3RI5A 3TLUA 3UU8A 3U8MA 2XQ8A 2XZ6A 4AFTA 3P4WA 5J5IA 4QAAA 5J0ZA 2X00D 2Y7YA 5J5HA 4QH5A 3WIPA 3WTIA 2BYRA 4ZK4A 2ZJUA 2YMEA 3U8LA 2XNVA 3U8JA 2BG9A 2KSRA 4A98A 2XQ9A 5L4HA 4AFHA 4PIRA 5HCMA 3SQ6A 4ZR6A 1OEDC 2XQ5A 3EAMA 2VL0A 3U8NA 4HFEA 2Y58A 4ZK1A 5AFLA 2QC1B 4TWHA 4UY2A 3RHWA 2XQ6A 3WTOA 3C84A 5TVCA 3LSVA 5L4EA 2X00A 4TWFA 3C79A 2XZ5A 4XHEA 1UX2A 2W8GA 3T4MA 5BW2A 5AFJA 4TNWA 4UM3P 5LG3A 4F8HA 3RIAA 3GUAA 3EHZA 2BYPA 3TLTA 1OEDB 3JAFA 3WTJA 2Y56A 4ZJTA 2YKSA 4QH4A 5HCJA 4QABA 2BR7A 3WTLA 4IL9A 4HFIA 3UU6A 4BFQA 5AFHA 2XQ4A 3SQ9A 5KE4A 4NZBA 4HFHA 2XNTA 2YMDA 4ZZCA 5BRXA 4TNVA 2W8FA 5IUXA 2PH9A 3JAEA 4Z90A 2XYTA 5J5GA 4B5DA 4AFGA 2M6BA 3UQ7A 2XQ7A 2M6IA 3UU3A 4COFA 3P50A 2BG9B 2BYSA 4IREA 4QACA 2PGZA 3JADA 4BQTA 2C9TA 2LM2A 5HEJA 5BP0A 4HQPA 4ILCA 5CFBA 2BJ0A 4HFCA 3UU4A 5AFMA 3TLVA 3TLWA 4UXUA 5JMEA 4LMKA 4TWDA 1OEDE 4LMLA 3PMZA 2BG9C 2YOEA 4ZRUA 4UM3S 3TLSA 5LXBA 3SIOA 5AINA 2LKGA 4NPPA 4HFBA 5HEHA 3EI0A 4UM1A 1I9BA 3RIFA 2WNCA 3UQ4A 3UU5A 3WTNA 3ZDGA 1UW6A 3UUBA 4XK9A 1OEDA 4LMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UV6 A;  3WTH A;  4ILA A;  2WNL A;  3ZKR A;  3IGQ A;  3WTM A;  4D01 A;  2LLY A;  4X5T A;  3RQW A;  4DBM A;  5SYO A;  3ZDH A;  4IL4 A;  5HEU A;  2BR8 A;  2XNU A;  3RQU A;  4A97 A;  3PEO A;  2WN9 A;  2XQA A;  2UZ6 A;  5AFK A;  4HFD A;  2BYQ A;  4FRR A;  4ALX A;  5AFN A;  5HEO A;  2ZJV A;  5KZU A;  2XYS A;  2Y54 A;  2WNJ A;  4ZZB A;  5AFM B;  2LKH A;  4ILB A;  4UM3 A;  3U8K A;  2MAW A;  5J5F A;  5CO5 A;  3WTK A;  2Y57 A;  2WZY A;  4Z91 A;  4ZJS A;  2BYN A;  2YN6 A;  4WV9 A;  5HEG A;  3SH1 A;  5L47 A;  4EZ1 A;  2XQ3 A;  2BG9 E;  5FJV A;  4QH1 A;  3RI5 A;  3TLU A;  3UU8 A;  3U8M A;  2XQ8 A;  2XZ6 A;  4AFT A;  3P4W A;  5J5I A;  4QAA A;  5J0Z A;  2X00 D;  2Y7Y A;  5J5H A;  4QH5 A;  3WIP A;  3WTI A;  2BYR A;  4ZK4 A;  2ZJU A;  2YME A;  3U8L A;  2XNV A;  3U8J A;  2BG9 A;  2KSR A;  4A98 A;  2XQ9 A;  5L4H A;  4AFH A;  4PIR A;  5HCM A;  3SQ6 A;  4ZR6 A;  1OED C;  2XQ5 A;  3EAM A;  2VL0 A;  3U8N A;  4HFE A;  2Y58 A;  4ZK1 A;  5AFL A;  2QC1 B;  4TWH A;  4UY2 A;  3RHW A;  2XQ6 A;  3WTO A;  3C84 A;  5TVC A;  3LSV A;  5L4E A;  2X00 A;  4TWF A;  3C79 A;  2XZ5 A;  4XHE A;  1UX2 A;  2W8G A;  3T4M A;  5BW2 A;  5AFJ A;  4TNW A;  4UM3 P;  5LG3 A;  4F8H A;  3RIA A;  3GUA A;  3EHZ A;  2BYP A;  3TLT A;  1OED B;  3JAF A;  3WTJ A;  2Y56 A;  4ZJT A;  2YKS A;  4QH4 A;  5HCJ A;  4QAB A;  2BR7 A;  3WTL A;  4IL9 A;  4HFI A;  3UU6 A;  4BFQ A;  5AFH A;  2XQ4 A;  3SQ9 A;  5KE4 A;  4NZB A;  4HFH A;  2XNT A;  2YMD A;  4ZZC A;  5BRX A;  4TNV A;  2W8F A;  5IUX A;  2PH9 A;  3JAE A;  4Z90 A;  2XYT A;  5J5G A;  4B5D A;  4AFG A;  2M6B A;  3UQ7 A;  2XQ7 A;  2M6I A;  3UU3 A;  4COF A;  3P50 A;  2BG9 B;  2BYS A;  4IRE A;  4QAC A;  2PGZ A;  3JAD A;  4BQT A;  2C9T A;  2LM2 A;  5HEJ A;  5BP0 A;  4HQP A;  4ILC A;  5CFB A;  2BJ0 A;  4HFC A;  3UU4 A;  5AFM A;  3TLV A;  3TLW A;  4UXU A;  5JME A;  4LMK A;  4TWD A;  1OED E;  4LML A;  3PMZ A;  2BG9 C;  2YOE A;  4ZRU A;  4UM3 S;  3TLS A;  5LXB A;  3SIO A;  5AIN A;  2LKG A;  4NPP A;  4HFB A;  5HEH A;  3EI0 A;  4UM1 A;  1I9B A;  3RIF A;  2WNC A;  3UQ4 A;  3UU5 A;  3WTN A;  3ZDG A;  1UW6 A;  3UUB A;  4XK9 A;  1OED A;  4LMJ A; 
#chains in the Genus database with same CATH topology
 3ZEF B;  1D1C A;  4HFV A;  3ZKR A;  4IDN A;  3RQW A;  2BZB A;  4QKN A;  3NRX A;  2DI4 A;  1G8X A;  4DR6 T;  1HNW T;  5H6R B;  3UT5 E;  4JYA T;  2BYQ A;  2YDR A;  5HEO A;  5KX5 E;  5LHI B;  3OPC A;  2CHO A;  4MLK A;  2K3W A;  3ANW A;  1XDP A;  2OLT A;  4GK0 E;  3N2O A;  2WWV A;  3KDS E;  2RP4 A;  2DCF A;  4WYV A;  2BG9 A;  3ZCI A;  2XAH B;  2V6Y A;  3KBU A;  4PK6 A;  1BR1 A;  2W2U A;  4UY2 A;  4ANJ A;  3AED A;  2DNX A;  2XZ5 A;  3BQI A;  3F57 A;  3KV4 A;  4QXH B;  2XM2 A;  2KLQ A;  1ZKE A;  4CI2 B;  4EYU A;  3WTL A;  4AI6 A;  5L2L A;  5DQV A;  4DV6 T;  3P7I A;  1T8B A;  3OKQ A;  2XQ7 A;  3N9M A;  3A5X A;  4LFC T;  3PJA A;  4IGU A;  1UUS A;  1E2A A;  4DR5 T;  3RC8 A;  3ZN0 B;  5LP6 E;  2LSJ A;  1OED E;  3CK6 A;  4YTM A;  3RYF E;  3V5U A;  3RKO A;  3WTN A;  1HX1 B;  3FBL A;  2NW7 A;  3OTO T;  4JLE A;  1J1J A;  3IGQ A;  2NP9 A;  3AEA A;  2CE7 A;  3RPU A;  2NOX A;  4IL4 A;  1T72 A;  5AQL B;  2WS3 A;  5HWY A;  5AFN A;  2KIN B;  4IDZ A;  2PBI A;  2JQ9 A;  1Y64 B;  3AE5 A;  1AJ3 A;  2JQK A;  3U8M A;  3UFG A;  5A1L A;  5J5I A;  2UUB T;  4JEH B;  5LGT B;  3WIP A;  3UUX B;  1WYC A;  2ZJU A;  3U8J A;  5L4H A;  2JQQ A;  3WI3 A;  5DAB A;  2QC1 B;  4JI0 T;  5ABE A;  3KV9 A;  2ACX A;  4QAB A;  5FXZ A;  3UU6 A;  5LMU T;  4ZZC A;  4EOZ B;  1UX4 A;  3WAK A;  2A3D A;  4X20 E;  3JAE A;  3OVU A;  3VKH A;  5AQI B;  2LHN A;  2X9X A;  4ILC A;  2PJQ A;  3PUA A;  3FZH B;  4GYR A;  4OX9 T;  2BJ0 A;  4LMK A;  3AEG A;  2CLY C;  2IAK A;  2BKO A;  5E0O A;  2Q9Q A;  4NPP A;  5AFU L;  3ABV A;  3UU5 A;  4JI2 T;  2CPT A;  2W62 A;  1JNR A;  1ZV4 X;  2WQY A;  4JV5 T;  2CLY B;  3P4R A;  4MAL A;  2C5K T;  4IHJ E;  5LJN A;  3PUR A;  4H9Q C;  1MIY A;  5FXX A;  1B7T A;  4EEB A;  5AQN B;  2C0S A;  1E7P A;  3LG7 A;  2WCA A;  3NVO A;  2IC9 A;  3WAJ A;  5AQM B;  3AE7 A;  2ODU A;  3AE9 A;  1HNX T;  2ACZ A;  2J4G A;  2EHO C;  3AE6 A;  5IHY A;  3H3A A;  4WV9 A;  1UCU A;  2FBW A;  1U4Q A;  5JR9 A;  5LBM A;  2K5B B;  1S35 A;  2EHO B;  4KBM B;  3KV6 A;  3UFE A;  1S94 A;  3QC9 A;  4IE6 A;  1ZP0 A;  4ZR6 A;  2QGS A;  4P09 A;  3RYI E;  5HXE A;  3ZYL A;  5J2T E;  2FJB A;  1LVF A;  3PUW F;  4QX7 B;  4I55 E;  5JDQ A;  4XHE A;  1YQ3 A;  5LG3 A;  1E1H B;  4B3T T;  3GUA A;  2JMH A;  1W09 A;  3WTJ A;  1L0V A;  1U5P A;  3PUX F;  2IIU A;  4ZJT A;  3RF1 A;  3Q5W A;  4AQG A;  2CWY A;  3ZMT B;  2BS2 A;  4QXC B;  3JC6 C;  1IAP A;  3ZMV B;  5IUX A;  2X0H A;  4NXM T;  5JRE A;  4AKG A;  3PJA J;  4UXN B;  1G73 A;  4YFS A;  5FY0 A;  4IE5 A;  5LHG B;  3PV0 F;  5BP0 A;  3N5L A;  1D1A A;  1YQ4 A;  3UU4 A;  3QNU A;  3RLF F;  2X9H A;  2OA5 A;  5HEH A;  4EGW A;  2UUA T;  2X66 A;  2M67 A;  4DID B;  4X5T A;  3O4X E;  5EK2 A;  2XUE A;  3CX7 B;  2YDS A;  3PEO A;  3LK2 B;  1W0A A;  3AE8 A;  4EYY R;  2MOZ A;  1KEY A;  4TX5 A;  3I9Y A;  1I94 T;  4DR3 T;  4Z91 A;  2IHR 1;  3ZMU B;  4L9I A;  4HN9 A;  2VAS A;  2LSK A;  5JRC A;  3P4S A;  4ASK A;  4AKL A;  5LYJ E;  3NZQ A;  2XZ6 A;  4JI5 T;  4UEM A;  3P8C D;  3X1D A;  3RH3 A;  3N9L A;  3I0Q A;  3J7Y q;  3H3M A;  3SQ6 A;  5GON E;  2CBJ A;  3MJX A;  3LBX B;  3HA4 A;  4EXT A;  2UXC T;  4PK4 A;  4PJL A;  5HXH A;  2V7M A;  2MPK A;  5BRX A;  2W8F A;  3FZM B;  4HWC A;  4LF5 T;  2H3R A;  4AFG A;  2BBH A;  2HPJ A;  3ZYK A;  3VRA A;  4LF7 T;  5FXV A;  4QWN B;  4B3R T;  2XAG B;  3L39 A;  1V9D A;  1KNR A;  4UM3 S;  4QX8 B;  2KZ7 B;  2EHO D;  5J2U E;  2ZM0 A;  3DJB A;  2XAQ B;  3LK3 B;  1UW6 A;  4EAH A;  4ILA A;  4PNI A;  3Q5E A;  5FVK A;  2WDV A;  4GKJ T;  5AQK B;  3AEF A;  1LVK A;  5JDF A;  3HI2 A;  2E9X C;  3HKE E;  4X65 T;  4X66 T;  5EZY E;  2LHR A;  5CGM A;  4HKA A;  4DV2 T;  4U72 A;  4G2A A;  4OYJ A;  3BK9 A;  4IST A;  2WZY A;  3NBX X;  3Q5D A;  5M4Y A;  3KV5 A;  3EDU A;  5F8P A;  4V1A v;  3ZMZ B;  2XQ8 A;  1MMD A;  3NZP A;  1W0B A;  2XQ9 A;  4P1N A;  3RC3 A;  4YT0 A;  5J1G A;  3CQG B;  1W9R A;  1I6Z A;  1XZY A;  2WU2 A;  5TVC A;  2H88 A;  2KWH A;  2W8G A;  5BW2 A;  3F31 A;  2UXN B;  1HR0 T;  2V8S V;  5FNV E;  3RIA A;  4TV8 E;  2D2S A;  2LRK A;  4AQF C;  5CA1 E;  2BR7 A;  4TNV A;  5LHH B;  4Z90 A;  3HR0 A;  2M6I A;  4YSX A;  3EUH A;  1H7C A;  4OFZ A;  3JAD A;  2LM9 A;  3N9O A;  3RRW A;  4FI5 A;  3K8P C;  3CQX C;  2LSI A;  5AFM A;  3ONX A;  3T1H T;  3CIR A;  4B3S T;  3Q5X A;  5ABF B;  3C98 B;  4I4T E;  2YU2 A;  3UUB A;  4DO0 A;  1JNZ A;  5KE4 A;  1HCI A;  3ETV A;  2C5I T;  5FVL A;  4TUY E;  4O4I E;  3RX6 A;  2UXX B;  2Y6X A;  3AEE A;  2BVL A;  2BKN A;  2XYS A;  4KP3 C;  1CUN A;  3N9N A;  2BBJ A;  2XQY A;  4CN4 A;  2VQF T;  2YIN A;  2BYN A;  2IW5 B;  5KXJ A;  2MBG A;  2YN6 A;  3Q9D A;  1KNZ A;  4HE8 A;  2B1E A;  4UVC B;  2E2A A;  2YME A;  4CI3 B;  4WNK A;  2LRL A;  5FMN A;  2W67 A;  3C84 A;  2X00 A;  4UIG A;  5LNK A;  3ZC1 A;  1IZN B;  2W63 A;  4YSY A;  3RKG A;  1YW0 A;  2Y56 A;  1VOM A;  5DQW A;  4DUY T;  4CXX A;  5HXS A;  3A8Y C;  2B76 A;  5AFH A;  4NXN T;  2VB6 A;  4DBQ A;  1NEK A;  2XYT A;  3MZK B;  4C90 A;  3UQ7 A;  2UXD T;  2J1D G;  3B57 A;  2BYS A;  2E9X D;  4IRE A;  2C9T A;  3ZST A;  2LOS A;  1HS7 A;  1OWA A;  1HFA A;  4LML A;  5CJ5 A;  3T8O A;  2BVM A;  4HFB A;  2UXB T;  4ERR A;  1I9B A;  2JIW A;  1CHU A;  4XK9 A;  1UV6 A;  3WTH A;  2XHE B;  2WDR A;  3N2G E;  2ZM2 A;  5L3F B;  3CKD A;  1XNR T;  2LT3 A;  3CML A;  5L3C B;  4FRR A;  3ZJ1 A;  5AQG B;  3RIU C;  1KFY A;  5AQT B;  1T98 A;  4I0U A;  2WDQ A;  2Y57 A;  3SOL A;  2NW8 A;  1YXR A;  3OJA A;  4DR1 T;  2K48 A;  3SH1 A;  5ADX L;  2BG9 E;  2CMR A;  3HKB E;  1FJG T;  4M1P A;  1IBK T;  4BJM A;  5HYA A;  2VKO A;  5J5H A;  5KMG P;  2JMK A;  2BYR A;  2RA1 A;  4YHH T;  3ZYM A;  4A98 A;  2HN2 A;  2WMN A;  2XY8 B;  2PTF A;  3OYX A;  1OED C;  3U8N A;  3RHW A;  2XQ6 A;  2FUP A;  4UR9 A;  3FZL B;  2QRX A;  4X62 T;  4TWF A;  1D0X A;  1MIV A;  4TNW A;  4CZZ B;  4NUV A;  2WMO A;  3AVS A;  2I0M A;  3HKD E;  1OED B;  1HG5 A;  1J5W A;  2WAU A;  4MHC A;  1Y01 A;  3AEB A;  1QSD A;  1MMA A;  3RRC A;  4A5X A;  2BG9 B;  2EHO A;  1WYB A;  2ODV A;  5C3J A;  3PUV F;  3PUY F;  5ABG A;  1UUR A;  3H37 A;  2NW9 A;  2LKG A;  2VKD A;  1WR6 A;  4UF0 A;  4UM1 A;  3RIF A;  4AIU A;  4HWH A;  5AQH B;  3RGL A;  2WNL A;  1HNZ T;  2A2F X;  3ZSS A;  2LLY A;  4DBM A;  2I59 A;  3V5S A;  5LXT E;  4X64 T;  4AIS A;  1QUU A;  1XMQ T;  3PDY A;  3LJC A;  4Z8X A;  4LF9 T;  4E7S A;  4YTP A;  3CVR A;  2DL1 A;  4N78 D;  2RPA A;  4ILB A;  2X9W A;  2YDQ A;  4CN1 A;  3CQC B;  3AAA B;  4ZJS A;  2VL8 A;  1D0Y A;  3E08 A;  4B6X A;  3UU8 A;  2XSA A;  2V26 A;  4HWF A;  2X68 A;  2LE8 A;  1J5E T;  1BR2 A;  3EAM A;  3R6N A;  3M65 A;  4EV6 A;  1N34 T;  5L4E A;  3HKC E;  3T4M A;  4WW0 A;  2BYP A;  4GYS A;  5L3B B;  3AA7 B;  3A7M A;  1XWM A;  2YMD A;  2MTQ A;  2XJ7 A;  5DJQ C;  3G06 A;  4MFR A;  4L5G A;  2FJD A;  5F3J A;  3ZLI A;  4O4J E;  2D0U A;  2PGZ A;  4BQT A;  5LGU B;  2YK0 A;  1O3X A;  4I43 B;  4HFC A;  3CX6 B;  2LSY A;  1Z8U A;  2Y48 B;  4TWD A;  4U7Y A;  2CRB A;  5AQU B;  3UTK A;  2WNC A;  3AE1 A;  5J5F A;  2ZMA A;  4CXY A;  4D01 A;  2VKH A;  1N33 T;  4TV9 E;  3RQU A;  3SWH A;  4CN6 A;  4ALX A;  2VQE T;  2ZJV A;  4MBQ A;  1ZEE A;  1IBL T;  4H9R C;  3P4Q A;  1IJ5 A;  2OV9 A;  4ZXL A;  3SFD A;  5LMN T;  4HWD A;  3PE0 A;  3AB3 B;  1M7K A;  1KK7 A;  2BKP A;  1WCR A;  2IUB A;  4ILU A;  2CHN A;  3AXJ B;  3PUZ F;  1FMV A;  4QAA A;  2DLR A;  2ZM8 A;  3WTI A;  3LK4 2;  2W00 A;  2XNV A;  2QVA A;  4PFP A;  4ZI3 C;  4H9N C;  5AFL A;  3I9W A;  1UX2 A;  4UEL A;  5JR9 C;  2A72 A;  2KND A;  4YY3 T;  2CXL A;  4ADZ A;  3EHZ A;  2JQH A;  3AVR A;  5HCJ A;  2SPC A;  2PFV A;  2D9D A;  2H7O A;  2E9X A;  5JR9 B;  4B3M T;  3E0Z A;  1GQE A;  2NWB A;  2L9Q A;  2M6B A;  5JTG A;  3P50 A;  2X0L B;  2ZLY A;  5LJM A;  3CX8 B;  3BQK A;  3TLV A;  5AQO B;  3I1A A;  4JUY A;  3J9X 1;  5AIN A;  4DMV A;  2KXP B;  3ZDG A;  2WBL A;  4ISS A;  5AQP B;  2FJA A;  1VRB A;  1VCS A;  2L3L A;  2XSB A;  3ZDH A;  2JRK A;  3B5M A;  2E8I A;  2IDO B;  3FZF B;  5JDG A;  2A9U A;  5AFK A;  3R84 B;  4AQF A;  1BR4 A;  4AKH A;  3GMI A;  3GA8 A;  4O2A E;  5L3E B;  3U8K A;  2Z6E A;  4KHZ F;  4JI7 T;  3CWZ B;  1Z0P A;  3ONL C;  4DBR A;  5L47 A;  3KVA A;  2XQ3 A;  5FJV A;  3RI5 A;  2HN1 A;  5FY1 A;  4YJ3 E;  4WZX A;  4Q25 A;  5JDN A;  2Y7Y A;  3IEE A;  4QH5 A;  3AE2 A;  3S4U A;  1MNE A;  4DR7 T;  5AQS B;  2XZE A;  5ABH A;  2XQ5 A;  3PUQ A;  3AA1 B;  1OXZ A;  1HG2 A;  4U3C A;  4LF6 T;  3MAC A;  2AXD S;  4YXD A;  5JRC B;  4IL9 A;  3C4W A;  4DR4 T;  3SQ9 A;  4NZB A;  4H63 V;  2V5D A;  4IE0 A;  5J5G A;  1VCT A;  5BMV E;  1WFD A;  2LM2 A;  3VRB A;  2UU9 T;  4KX6 A;  3K3O A;  2V7I A;  3EI0 A;  2MYS A;  2NTX A;  2V1D B;  3PUG A;  3SS1 A;  1KNP A;  3O1J A;  2J62 A;  2I6H A;  3IA3 A;  3L09 A;  3EAB A;  2X0Y A;  1N36 T;  3FHN A;  4DVD A;  5FXW A;  4ZI3 D;  4DND A;  3GWH A;  2X9Y A;  2Y8D A;  3N9P A;  3JCF A;  1LRZ A;  4KMC A;  2D0T A;  5KZU A;  4DV4 T;  4AQY T;  3NKZ A;  4ZZB A;  2N1G A;  2CXF A;  4IE7 A;  4CI1 B;  3LFM A;  3ZT7 A;  4O4H E;  3FXD B;  5HEG A;  3HL6 A;  1R8I A;  3QB5 A;  4UV9 B;  4ZK4 A;  4C91 A;  4WBO A;  4PK5 A;  2VL0 A;  4ZK1 A;  4HFE A;  4EIW A;  1NWM X;  3LSV A;  2H7V C;  5BR8 T;  5EK3 A;  3AAI A;  3IHR A;  4DV1 T;  1ZOY A;  2WZI A;  4QH4 A;  1QLB A;  2XQ4 A;  2AE9 A;  4FJO A;  3KBT A;  2HPL A;  2PH9 A;  3RIU A;  3O1I A;  4HGA A;  1FIO A;  3Q2M A;  4PJN A;  5IWA T;  3ESL A;  3AA0 B;  3C51 A;  3U3I A;  2LSG A;  1LKX A;  4EZ4 A;  3ZMS B;  5CB4 E;  5IYZ E;  4ZOL E;  2XM1 A;  1OED A;  1MMN A;  4OHF A;  4BA9 A;  3ZJ2 A;  5HEU A;  2D5U A;  2HHH T;  1WRD A;  2G0U A;  4X1I E;  4P0A A;  2X67 A;  2N9D A;  5JQG E;  4JI8 T;  2WM9 A;  4DV0 T;  2WNJ A;  2Y54 A;  4GK5 E;  5AFM B;  4DV7 T;  2LKH A;  2MAW A;  1X9B A;  3OYZ A;  3VHL A;  2IML A;  3FB2 A;  2NR4 A;  3AA6 B;  2F4V T;  2LJL A;  3U78 A;  3P4P A;  5J0Z A;  1M62 A;  1UGO A;  3CPZ A;  3GN5 B;  2KSR A;  4AFH A;  4GOU A;  4LF8 T;  2L8K A;  4JI3 T;  4IDO A;  2K24 A;  4UM3 P;  3JAF A;  4L0R A;  4DV3 T;  4KI0 F;  4JI4 T;  2WY2 A;  5JDL A;  3NRY A;  4YSZ A;  4COF A;  3MK7 C;  5L3G B;  4IE4 A;  4YHJ A;  2K9A A;  4HWI B;  2V6X A;  2XTL A;  2VVS A;  4YLH A;  4HQP A;  4F6R C;  4LFB T;  5LB7 B;  3TLW A;  4O8S A;  3MA9 A;  5JME A;  2BG9 C;  5LG4 A;  3ANW B;  1MMG A;  1YKE B;  2BS4 A;  1SUM B;  1T7S A;  2WP9 A;  1WLX A;  4K0U A;  2XAF B;  2V6Y B;  4U2Y A;  1D0Z A;  2GK9 A;  2ZM6 T;  4A56 A;  1SA0 E;  4XAX B;  1ZHC A;  5AQR B;  2VK9 A;  4TN7 B;  4XZC A;  1YD8 G;  3PU8 A;  4UM3 A;  4AKI A;  3QB5 K;  3O1H A;  2VKJ A;  3UUL A;  4ZHQ E;  2DWK A;  5FP3 A;  3E22 E;  4AFT A;  1YKH B;  2IC6 A;  5FL1 A;  3ZT5 A;  2WSS V;  3K1S A;  3OBV E;  5HCM A;  2CCQ A;  3IF8 B;  2E5L T;  4KUM B;  4U2Z A;  3FXE B;  4LF4 T;  5ETW A;  3C79 A;  4EZH A;  3C64 A;  3ZC0 A;  1HF8 A;  4NUU A;  3TLT A;  2YEV C;  4BFQ A;  4HFI A;  2XAJ B;  4HFH A;  3PUS A;  3N2K E;  5KDM C;  4DR2 T;  4KHP T;  3AXJ A;  4OYK A;  3VU7 H;  3UU3 A;  2KWI B;  4UV8 B;  3ZT6 A;  4QAC A;  2FJE A;  3MXZ A;  2ES0 A;  1US7 B;  3KFW X;  3MKD A;  5CA0 E;  3C4Z A;  5AQV B;  5HXR A;  1NEN A;  1IJ6 A;  2YOE A;  3SIO A;  4GKK T;  4U7I A;  3UQ4 A;  3D0T A;  2CXD A;  4ZS3 A;  5JDH A;  5FY7 A;  2W4X A;  3SRZ A;  4O2B E;  4IIJ E;  4H9S E;  1HTJ F;  3LBX A;  1XMO T;  4IT4 A;  1EZ3 A;  1XDO A;  2CA5 A;  5EK4 A;  4AKR B;  2E5V A;  3DP7 A;  2CM0 A;  3WTK A;  5AQJ B;  4CQI A;  1BR0 A;  4UF0 B;  4JEU B;  3ZCJ A;  5F5W A;  3LDQ B;  4EZ1 A;  1HX8 A;  5FKY A;  5C8Y E;  3P4W A;  4TZ4 C;  2X00 D;  2Q9Q C;  4UVB B;  2V7K A;  3DTO A;  4BAY B;  4JBW F;  2WB5 A;  3VR8 A;  2Q9Q B;  2WZH A;  3PU3 A;  2XPK A;  4DMW A;  4PJJ A;  4K0K T;  2LEH A;  4P0B A;  3VKG A;  5FYM A;  4JI6 T;  1KF6 A;  2WWU A;  2XNT A;  3F2E A;  2PG8 A;  3UUN A;  5LCY A;  2KMF A;  2QA7 A;  2YU1 A;  2XAS B;  2DWG A;  2CEA A;  3PTR B;  2C5J A;  4O4L E;  5HEJ A;  3AEC A;  4DV5 T;  2QYW A;  3PMZ A;  3QUJ A;  5LXB A;  4I50 E;  5L3D B;  3M3Z B;  4H9O C;  4X1Y E;  3IBP A;  4U33 A;  4IDQ A;  3C50 A;  3WTM A;  3N9Q A;  3O9X A;  4ZI7 E;  2BR8 A;  3ONJ A;  2WN9 A;  4UVA B;  2LOP A;  3TKL B;  4QXB B;  3AE3 A;  2WU5 A;  4OK0 A;  1X79 A;  5AQF B;  3QOF A;  5JVD E;  5CO5 A;  5H6Q B;  1SHZ C;  1DU2 A;  1IBM T;  3RYH E;  2X51 A;  2BDE A;  4QH1 A;  3TLU A;  3K3Q C;  5TAO A;  4ZI2 C;  4G63 A;  3QK6 A;  3FBZ A;  4U31 A;  4PIR A;  3AAE B;  2R6G F;  5HAX A;  1XNQ T;  2Y58 A;  5HWX A;  4TWH A;  4ZS2 A;  3WTO A;  4YTN A;  3I0O A;  3KIN B;  2VWA A;  2KT9 A;  3UUM A;  3AE4 A;  4PAG A;  5ABF A;  4EB6 E;  4LFA T;  1NAF A;  4NIQ A;  1UK5 A;  4U74 A;  4CXW A;  2JPF A;  2V7L A;  5LBQ B;  1MIW A;  2NTY A;  2JJ9 A;  3KVB A;  1WR0 A;  5C2T A;  4YJ2 E;  4H9P C;  2J47 A;  4UXU A;  4ZRU A;  3TLS A;  4IDP A;  1D1B A;  4JI1 T;  4XBF B;  2E9X B;  3L8R A;  4LMJ A;  5FL0 A;  2CWO A;  4HEA A;  2Q9Q D;  2UUC T;  5AQQ B;  5SYO A;  1FEW A;  3JC6 D;  4BJN A;  1UX5 A;  2XNU A;  5JH7 E;  4A97 A;  2V7J A;  2XQA A;  2UZ6 A;  3K3N A;  4HFD A;  4X1K E;  3BQL A;  3ZN1 B;  5LGN B;  2HH7 A;  3EDV A;  5JDM A;  4GIW A;  3FZK B;  4H63 H;  5LOV E;  4E7Z A;  2CBI A;  2H89 A;  3T1Y T;  3U8L A;  2BS3 A;  4AXP A;  2W61 A;  3ZPO A;  5AFJ A;  2W0G A;  1N32 T;  2N2N A;  4F8H A;  3L3P A;  3W15 B;  2YKS A;  4PFO A;  4J2C A;  3SFE A;  5LA6 E;  4QHO A;  3B13 A;  5HXC A;  4B5D A;  3EVY A;  1FMW A;  2V5C A;  4WBN E;  3NWI A;  3ETU A;  3RYC E;  4EED A;  2VVN A;  2P9B A;  3GN5 A;  4ZEY A;  5CFB A;  1SE7 A;  4DUZ T;  2DHR A;  4PJM A;  4PW8 A;  3C4X A;  1MND A;  2W66 A;  2VUR A;  3VR9 A;  4HTE A;  4ZI2 D; 
#chains in the Genus database with same CATH homology
 1UV6 A;  3WTH A;  4ILA A;  2WNL A;  3ZKR A;  3IGQ A;  3WTM A;  4D01 A;  2LLY A;  4X5T A;  3RQW A;  4DBM A;  5SYO A;  3ZDH A;  4IL4 A;  5HEU A;  2BR8 A;  2XNU A;  3RQU A;  4A97 A;  3PEO A;  2WN9 A;  2XQA A;  2UZ6 A;  5AFK A;  4HFD A;  2BYQ A;  4FRR A;  4ALX A;  5AFN A;  5HEO A;  2ZJV A;  5KZU A;  2XYS A;  2Y54 A;  2WNJ A;  4ZZB A;  5AFM B;  2LKH A;  4ILB A;  4UM3 A;  3U8K A;  2MAW A;  5J5F A;  5CO5 A;  3WTK A;  2Y57 A;  2WZY A;  4Z91 A;  4ZJS A;  2BYN A;  2YN6 A;  4WV9 A;  5HEG A;  3SH1 A;  5L47 A;  4EZ1 A;  2XQ3 A;  2BG9 E;  5FJV A;  4QH1 A;  3RI5 A;  3TLU A;  3UU8 A;  3U8M A;  2XQ8 A;  2XZ6 A;  4AFT A;  3P4W A;  5J5I A;  4QAA A;  5J0Z A;  2X00 D;  2Y7Y A;  5J5H A;  4QH5 A;  3WIP A;  3WTI A;  2BYR A;  4ZK4 A;  2ZJU A;  2YME A;  3U8L A;  2XNV A;  3U8J A;  2BG9 A;  2KSR A;  4A98 A;  2XQ9 A;  5L4H A;  4AFH A;  4PIR A;  5HCM A;  3SQ6 A;  4ZR6 A;  1OED C;  2XQ5 A;  3EAM A;  2VL0 A;  3U8N A;  4HFE A;  2Y58 A;  4ZK1 A;  5AFL A;  2QC1 B;  4TWH A;  4UY2 A;  3RHW A;  2XQ6 A;  3WTO A;  3C84 A;  5TVC A;  3LSV A;  5L4E A;  2X00 A;  4TWF A;  3C79 A;  2XZ5 A;  4XHE A;  1UX2 A;  2W8G A;  3T4M A;  5BW2 A;  5AFJ A;  4TNW A;  4UM3 P;  5LG3 A;  4F8H A;  3RIA A;  3GUA A;  3EHZ A;  2BYP A;  3TLT A;  1OED B;  3JAF A;  3WTJ A;  2Y56 A;  4ZJT A;  2YKS A;  4QH4 A;  5HCJ A;  4QAB A;  2BR7 A;  3WTL A;  4IL9 A;  4HFI A;  3UU6 A;  4BFQ A;  5AFH A;  2XQ4 A;  3SQ9 A;  5KE4 A;  4NZB A;  4HFH A;  2XNT A;  2YMD A;  4ZZC A;  5BRX A;  4TNV A;  2W8F A;  5IUX A;  2PH9 A;  3JAE A;  4Z90 A;  2XYT A;  5J5G A;  4B5D A;  4AFG A;  2M6B A;  3UQ7 A;  2XQ7 A;  2M6I A;  3UU3 A;  4COF A;  3P50 A;  2BG9 B;  2BYS A;  4IRE A;  4QAC A;  2PGZ A;  3JAD A;  4BQT A;  2C9T A;  2LM2 A;  5HEJ A;  5BP0 A;  4HQP A;  4ILC A;  5CFB A;  2BJ0 A;  4HFC A;  3UU4 A;  5AFM A;  3TLV A;  3TLW A;  4UXU A;  5JME A;  4LMK A;  4TWD A;  1OED E;  4LML A;  3PMZ A;  2BG9 C;  2YOE A;  4ZRU A;  4UM3 S;  3TLS A;  5LXB A;  3SIO A;  5AIN A;  2LKG A;  4NPP A;  4HFB A;  5HEH A;  3EI0 A;  4UM1 A;  1I9B A;  3RIF A;  2WNC A;  3UQ4 A;  3UU5 A;  3WTN A;  3ZDG A;  1UW6 A;  3UUB A;  4XK9 A;  1OED A;  4LMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...