2XQ5A

Pentameric ligand gated ion channel glic in complex with tetraethylarsonium (teas)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 74
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq5A01
2BYQA 4WV9A 5L4EA 3WTOA 4TNWA 2YMDA 5BW2A 4HFCA 5HEHA 2Y58A 2YMEA 3WTJA 2BYNA 2UZ6A 2W8GA 2XQ9A 4UM1A 2XNVA 3TLUA 4X5TA 2Y7YA 5AFJA 3SH1A 4DBMA 4UXUA 3UU8A 5IUXA 4QACA 5J0ZA 2X00D 5HEOA 5L4HA 1OEDC 1OEDA 2XNUA 3WTIA 4ZK4A 5J5IA 3EHZA 5HCJA 2M6BA 5CO5A 3UUBA 4TNVA 5AFKA 2PGZA 4QH4A 5L47A 3WTHA 3P4WA 3SQ9A 2XQ5A 5JMEA 2MAWA 2XQ7A 4Z91A 2LKGA 3EI0A 4QH1A 3WTKA 4TWDA 2ZJUA 4QAAA 3IGQA 4Z90A 4ZR6A 3WTMA 5KE4A 5HCMA 4UM3P 1I9BA 5J5HA 4AFHA 3WTLA 4ZK1A 2YKSA 3PMZA 4ZJSA 3JAFA 2LKHA 2Y56A 5AFHA 4ZZCA 3U8NA 3RHWA 2WNLA 3ZDGA 3U8LA 1OEDB 3UU6A 3WIPA 2XYSA 4TWFA 4HFBA 5AFLA 4F8HA 4QABA 3RI5A 3RIAA 5AINA 2ZJVA 3GUAA 3UQ4A 4LMKA 4BFQA 5BP0A 4ZZBA 1UV6A 4XK9A 4HFHA 3UU3A 4ILAA 3RQWA 4AFGA 5FJVA 3U8KA 2X00A 5LG3A 2Y54A 2W8FA 2Y57A 4BQTA 2BG9E 1UW6A 4NPPA 2XZ6A 4ILCA 3C79A 4D01A 4EZ1A 4QH5A 4TWHA 3RIFA 2LLYA 2XQ3A 4HQPA 5KZUA 3P50A 2XQAA 3WTNA 4UM3A 5LXBA 3JAEA 3LSVA 2WZYA 3UQ7A 4ILBA 3UU5A 2BYRA 5SYOA 2BJ0A 5AFNA 4HFIA 2BG9C 2BG9A 4IREA 3TLSA 3TLTA 4ZJTA 4A98A 4PIRA 5TVCA 2PH9A 4ALXA 3TLWA 5HEUA 4IL4A 2BR8A 2YOEA 5J5FA 5HEGA 3JADA 2WNCA 4UM3S 4LMLA 2XNTA 5BRXA 4AFTA 4COFA 1OEDE 3SQ6A 3ZDHA 2KSRA 2M6IA 3PEOA 3T4MA 2XYTA 3U8MA 5J5GA 2XZ5A 4XHEA 3U8JA 2WNJA 5CFBA 2XQ6A 3TLVA 4ZRUA 2XQ8A 2BYSA 4FRRA 4HFDA 3EAMA 4A97A 4NZBA 4B5DA 1UX2A 2YN6A 2XQ4A 2BR7A 5AFMA 2QC1B 4UY2A 2VL0A 5AFMB 2LM2A 4LMJA 2BG9B 3UU4A 3SIOA 2BYPA 5HEJA 2C9TA 4IL9A 3ZKRA 3C84A 2WN9A 3RQUA 4HFEA
chains in the Genus database with same CATH superfamily
2V7IA 3C50A 3R6NA 3SH1A 1YD8G 5J5IA 4UV8B 1W0BA 3QNUA 3AE7A 2LE8A 4WBNE 5KE4A 3M3ZB 2W0GA 4GIWA 3IA3A 4ZK1A 4PJMA 3E0ZA 4DVDA 3RKOA 1Y64B 3LDQB 1GQEA 5LBQB 3UQ4A 2W00A 1KEYA 2I59A 2J4GA 5HYAA 4I50E 3H37A 2BDEA 2ZM0A 2UXCT 2D5UA 4YY3T 5AQLB 2E5LT 4HEAA 5TVCA 3P4RA 1M62A 3KV6A 4QXHB 2IHR1 5HEUA 4IL4A 4AIUA 1T8BA 4U2ZA 2BS2A 4EYUA 3RYFE 2UXNB 2CRBA 3AAAB 4DV3T 4CN1A 5AQIB 5L3DB 1XWMA 2WP9A 3ZCIA 1V9DA 5AFMB 2ZLYA 4DV0T 2HHHT 2W4XA 3UULA 2V26A 2VKJA 2FBWA 2IIUA 4MALA 1YQ4A 1I94T 2MBGA 2UZ6A 2W8GA 4IE5A 2FJAA 2XZEA 3RPUA 2OA5A 1HFAA 4JI2T 1OEDA 3ZYKA 2C5IT 5CO5A 2L8KA 3F2EA 3E22E 3UTKA 4TV9E 3CX7B 3EI0A 3WTKA 4CI1B 2GK9A 5AQPB 1NENA 5KX5E 2LT3A 4PJLA 2LKHA 2CHNA 5IYZE 2JIWA 4X1YE 4F8HA 3A7MA 3FXDB 5LXTE 5FXWA 4XZCA 4JYAT 2PJQA 2X9HA 4H9OC 4AFGA 1D0YA 2CWOA 4BQTA 1UCUA 4NPPA 2X9WA 1W0AA 4GKKT 2XQAA 2E9XD 5LXBA 4FJOA 3AVSA 2UXBT 4ILBA 4DV7T 2RPAA 3PUWF 2CLYC 3I9WA 4NUUA 2BKPA 2E9XC 3UUXB 2I6HA 5J5FA 3MK7C 2HN1A 3KDSE 3ZC1A 3QK6A 2JJ9A 2J1DG 3ZDHA 3LK3B 2C0SA 3T4MA 2NWBA 1FIOA 4P0AA 3FZLB 4LF9T 4YSXA 3PDYA 4G63A 1IBMT 2DCFA 5KDMC 2KMFA 1D0XA 3FBZA 4IDQA 3FBLA 5AQSB 2X0HA 4UEMA 5JH7E 2LM9A 2X0YA 4HWFA 5LB7B 5J0ZA 5L3BB 2WS3A 2M6BA 3AEEA 5AFKA 4QH4A 3P4WA 3L8RA 3Q9DA 1HS7A 4X1KE 5FY0A 2K3WA 2KXPB 2FJDA 2QGSA 4ZJSA 3GN5A 3T1YT 1NEKA 1UK5A 3BQIA 5ETWA 4NUVA 5FKYA 3UT5E 3V5UA 4PAGA 1IBKT 3RI5A 5ABFA 2P9BA 4LMKA 4ISSA 4IHJE 3ZJ1A 3RQWA 1KNPA 3U8KA 1VOMA 5LG3A 4K0UA 1MMDA 3L09A 2BG9E 4EOZB 3AA0B 2XAHB 3Q5DA 4IE4A 4P09A 3CX8B 5IWAT 1E7PA 2ZMAA 5LP6E 3ONLC 3SS1A 4ERRA 2IUBA 4J2CA 4L0RA 4AFTA 4AKGA 3M65A 3C64A 5LJMA 3N9MA 2XYTA 4I55E 1HNZT 4QKNA 5CFBA 1HCIA 4DMVA 2VASA 4DV1T 4CZZB 5AFUL 3SIOA 5FL0A 1IBLT 3Q2MA 4U74A 4YXDA 2YMDA 5ADXL 1WCRA 1FMWA 5JDGA 3DJBA 4LFAT 4DMWA 3ZT6A 1O3XA 1SHZC 5L3GB 1ZKEA 1HNWT 2LJLA 4CXXA 1XMOT 3AEAA 2MYSA 4BA9A 4PK6A 1L0VA 2IDOB 4HFBA 4UF0B 4WBOA 3HL6A 5BP0A 1UV6A 3U78A 5AQJB 2SPCA 5AQTB 4JI5T 3RIFA 3P50A 4I43B 2WQYA 4GK5E 3UQ7A 4B3ST 2V6XA 2DL1A 4XBFB 3PV0F 1VCTA 2XNTA 1OEDE 2CXLA 5LCYA 1MMAA 3VHLA 5J5GA 2VL8A 4AKRB 2XPKA 3G06A 1YKHB 2XQ4A 3KFWX 4JI0T 2HPLA 2PG8A 2W62A 2WY2A 5JR9C 3AAEB 5BW2A 3NRXA 3QC9A 4E7ZA 2BBJA 3KV4A 3KV9A 4O4HE 3K3QC 3OBVE 5L47A 2WDQA 4TX5A 2WU5A 3RIUC 4PNIA 2OV9A 1IAPA 3CQCB 3NZQA 2CPTA 3PU3A 2A9UA 4DNDA 5DJQC 4MHCA 3UU6A 1OWAA 4TWFA 5AINA 3GUAA 1ZV4X 3KBTA 4ISTA 1QSDA 4ZZBA 2CBIA 2IC6A 3RIUA 4CN6A 3IBPA 4K0KT 5CGMA 1Z8UA 4DR7T 4CQIA 3WTNA 4GYSA 1HX8A 3U3IA 3JAEA 4LF4T 1M7KA 4ALXA 3I1AA 2E5VA 2MPKA 3CQXC 3LFMA 3QB5K 5HAXA 2EHOD 3UFGA 1G73A 2NTYA 3JC6D 4CI2B 3PUZF 1UX2A 2BR7A 3EDUA 2YINA 4JLEA 5L2LA 2EHOC 3FZKB 5F5WA 2ODUA 3EUHA 4ZI2D 3RH3A 3JC6C 1LVFA 4QXBB 4BJNA 4TN7B 2YK0A 4ZI2C 3T1HT 3EVYA 2V5CA 2YDQA 3KBUA 3MJXA 3PUXF 2XTLA 4GYRA 3CX6B 2HPJA 3C4XA 2XUEA 3PUYF 3HA4A 3PJAJ 4EZHA 1H7CA 2XSAA 1NWMX 5HWYA 3ZDGA 3U8LA 5AFLA 2ACXA 4QABA 3OYXA 5EK4A 1KNRA 1MIYA 2V5DA 4CN4A 4EXTA 2C5KT 4HWDA 4YLHA 3KVBA 3H3MA 2K5BB 2LOSA 4XAXB 4ZJTA 3O1IA 4X62T 4H63V 2ES0A 3PUGA 4F6RC 5HWXA 3I0OA 5LA6E 1HG2A 1MIVA 2NW9A 3RRCA 2X68A 2HN2A 4PW8A 4ZXLA 2WZHA 1MMNA 4LF8T 4NZBA 2JQQA 3EAMA 1WYCA 2WMOA 3CQGB 4DIDB 3OPCA 1N33T 2C9TA 1KK7A 3CK6A 5H6QB 4EZ4A 2WN9A 4YSYA 3QOFA 2VK9A 4WZXA 2JQKA 5HEHA 2C5JA 1T98A 3N9NA 2BYNA 1D1BA 4OYJA 5HXRA 3RRWA 4DV6T 2NW7A 4TV8E 5AQGB 5FVKA 1OEDC 3VR9A 4UF0A 3JCFA 4QX7B 3CWZB 2YDRA 2BKOA 3B13A 5AQVB 2XQ7A 4UR9A 3ZEFB 4JI3T 2LOPA 3K3NA 2VKHA 2WSSV 4KMCA 5AQHB 1WR6A 5LMUT 4TZ4C 4ILAA 2BS4A 5AQQB 2CMRA 5J2UE 3LJCA 4EZ1A 4EEDA 3AE4A 3HR0A 4ADZA 4O4LE 2Y6XA 5AFNA 3D0TA 4HFIA 3TLTA 2KINB 2G0UA 4X20E 3N9LA 3ZSSA 4BJMA 2ZM8A 3W15B 4EGWA 5LHGB 3AXJB 3OJAA 5FMNA 5DABA 2VQFT 1HR0T 4B5DA 2Q9QD 2CXDA 1UUSA 4UXNB 2BBHA 1E2AA 1LVKA 2VB6A 2Q9QC 2V6YB 4TNWA 4HFCA 2K48A 4EEBA 3ZCJA 2AE9A 3TLUA 5AFJA 2KZ7B 4DR5T 5IUXA 3RC3A 4JI6T 3C51A 2X00D 3SFEA 2CCQA 3N2GE 3NRYA 4EYYR 5J2TE 3O1HA 5L3FB 2FJEA 3UUNA 4KI0F 4P1NA 2Q9QA 4ZR6A 2VURA 3N2OA 1UX5A 3SOLA 4IIJE 2LHRA 3SFDA 1FMVA 4DR1T 4L5GA 5AFHA 3FB2A 3WIPA 1MNEA 5CA0E 2PBIA 3L3PA 2YEVC 4YSZA 4BFQA 1G8XA 5JRCA 4HFHA 3NZPA 1J1JA 2LSIA 2X00A 2IAKA 3CPZA 1UW6A 5FVLA 2CHOA 2JQHA 4QH5A 2XHEB 2PFVA 2CEAA 4UM3A 1HF8A 3LSVA 2K24A 2VVSA 2D0TA 4IT4A 4IREA 2LSJA 2JRKA 4U3CA 3RLFF 3MZKB 2ZM6T 5F8PA 5LYJE 4H9QC 5BRXA 5L3CB 2LEHA 2WM9A 4ASKA 5L3EB 4EB6E 1NAFA 1XDPA 1Y01A 4XHEA 3H3AA 4PFOA 4KUMB 2WZIA 2LM2A 2BG9B 4DBRA 2KT9A 3UU4A 4YJ3E 2UXXB 2V7KA 5JDHA 4IL9A 2XQYA 3TKLB 3RQUA 4I4TE 5AQNB 4U31A 5LHHB 2XQ9A 3RYCE 4LF6T 4DBMA 3ZC0A 4CXYA 3OKQA 2DWGA 4IDNA 2XNUA 4O8SA 1R8IA 4HTEA 4YT0A 3WTHA 3BK9A 2X9XA 5JDQA 1N32T 1UX4A 3C98B 5FY1A 3FHNA 4IE6A 3CKDA 2X67A 2V7LA 4H63H 4AFHA 2YKSA 2JPFA 2NTXA 1KNZA 4TUYE 5IHYA 3ZMVB 3ZMZB 2UXDT 3MACA 3N9QA 5FJVA 1LKXA 2XZ6A 4M1PA 2X9YA 4ILCA 2V7JA 3IEEA 1I6ZA 3N9OA 3P8CD 4A98A 4PJNA 3VKGA 5HXSA 4U33A 2YOEA 3J7Yq 5HEGA 4ZOLE 2JMHA 5HXEA 3ONJA 1WFDA 3U8JA 2WNJA 3PU8A 4EV6A 4QX8B 3VRAA 3B5MA 3FZHB 5AFMA 2W66A 2A72A 1US7B 3V5SA 2N1GA 5FYMA 2H89A 4AKLA 1ZOYA 2M6IA 4EAHA 2F4VT 4L9IA 3WTOA 2H7VC 2Y58A 2I0MA 2BKNA 3RYIE 3ZPOA 2DHRA 4AKIA 2YU2A 4OFZA 1YXRA 4YHJA 2UUBT 2HH7A 3UUBA 4PK5A 4DR4T 4TNVA 2B76A 2CXFA 4DV5T 2XQ5A 4ANJA 4B3TT 2WBLA 3IGQA 2W63A 1YW0A 4HWHA 5M4YA 3PUSA 4HWIB 1WR0A 5AQFB 1J5ET 3ZJ2A 3I9YA 3O9XA 4ZHQE 1SE7A 4U7IA 3PJAA 2Y56A 2LHNA 1JNZA 3WAKA 3RIAA 5CB4E 4BAYB 1X9BA 4XK9A 3UU3A 4UELA 5A1LA 3LG7A 5JTGA 4YTNA 4QHOA 1X79A 3C79A 3MA9A 2XQ3A 4HQPA 2XAGB 1LRZA 5SYOA 2K9AA 1XMQT 2ODVA 1HG5A 4ZS3A 3N9PA 5AQMB 5LBMA 4HFVA 2QYWA 4LMLA 5LHIB 4PFPA 2V6YA 3SQ6A 3HKCE 2KSRA 3NKZA 3QUJA 1KF6A 4JV5T 3ZT5A 2XZ5A 4Q25A 3OYZA 4H9RC 4ZRUA 1J5WA 4A97A 2YN6A 3RX6A 4LMJA 4WW0A 3FZFB 2NR4A 4HN9A 2PTFA 3PURA 2CLYB 4P0BA 1DU2A 4WNKA 2DNXA 2YDSA 2E9XB 3Q5XA 2WDRA 5L4EA 3GMIA 3AA6B 3RKGA 2Y7YA 1XNQT 2LSKA 3Q5WA 3L39A 5FL1A 4QACA 4GK0E 5F3JA 4YFSA 4ZK4A 2ACZA 4DR6T 4JBWF 2PGZA 3ETUA 3K8PC 4Z91A 4YTPA 3AE5A 2LRLA 5HCMA 2VVNA 4H9SE 3WTLA 3GN5B 3JAFA 4OX9T 2XM1A 1HX1B 1QUUA 3X1DA 3A8YC 5KZUA 4MLKA 3AECA 2Y48B 4X1IE 3UU5A 5AQUB 2BG9A 4PIRA 3T8OA 3C4WA 1ZEEA 3TLWA 5CA1E 2BR8A 1BR1A 3AEDA 3N5LA 4COFA 3SRZA 4QXCB 4DBQA 2WCAA 2W2UA 4MFRA 1MMGA 2XQ8A 4FRRA 4YTMA 4ZEYA 5EZYE 4DV4T 2UU9T 2WU2A 5HEJA 5LNKA 4AQFA 3AE1A 2IW5B 3C84A 3VRBA 3R84B 2YMEA 4HWCA 4X5TA 4ILUA 3IF8B 1SUMB 4UVCB 4X64T 2L9QA 2M67A 3ABVA 5FXVA 5KXJA 2V8SV 5ABEA 5H6RB 2LKGA 4ZS2A 3A5XA 2MTQA 3AE8A 2VQET 4YJ2E 3PMZA 2AXDS 5HXCA 1IJ6A 1W9RA 2L3LA 4JEUB 4H9PC 2ZJVA 4UIGA 4GKJT 5C3JA 2XJ7A 4JI7T 4JEHB 3P7IA 3K1SA 2W8FA 3EABA 3ZN0B 2CE7A 4TWHA 4ZI3D 3LBXB 2CA5A 4PJJA 5DQWA 4A5XA 4IE0A 2CWYA 2XASB 4IDZA 3E08A 1S94A 4ZI3C 2WNCA 4Z8XA 2XAJB 2BVMA 2W67A 4AQGA 2FUPA 2V1DB 2LRKA 3ZT7A 5JDNA 3DTOA 3ONXA 1W09A 1MIWA 3ZKRA 3CMLA 5LGTB 2XNVA 2KWHA 2XM2A 5HEOA 3WTIA 5EK3A 3AB3B 5HCJA 3VU7H 3ZMTB 4E7SA 5JMEA 5EK2A 2QRXA 5ABGA 3AE9A 5JR9B 4FI5A 2DLRA 2Y8DA 1FJGT 4DR3T 4ZZCA 5LJNA 2WNLA 4AKHA 1KFYA 1XNRT 2XYSA 1CUNA 1UGOA 1VCSA 5FXZA 1WRDA 2KWIB 3ZMUB 1HNXT 4KHZF 1B7TA 5AQKB 1U5PA 4OHFA 4G2AA 3RF1A 2E2AA 3MXZA 3EDVA 4NXNT 3PUAA 4DUYT 4V1Av 3LK2B 2WZYA 3RC8A 4B3MT 5TAOA 3WAJA 3MKDA 2E9XA 5GONE 3NBXX 4H9NC 3PEOA 1CHUA 4IE7A 1JNRA 5KMGP 2J47A 2XQ6A 3TLVA 2BYSA 1EZ3A 3UUMA 2BVLA 4MBQA 2D2SA 4IGUA 2VKDA 4C90A 3AA1B 4UV9B 2WWVA 5ABHA 3GWHA 4WV9A 5JVDE 5JQGE 3DP7A 4EIWA 5BR8T 3WTJA 2NOXA 5J1GA 4X66T 3PUQA 3UU8A 3P4QA 3ANWB 2D0UA 5AQOB 4JUYA 4U2YA 2EHOB 5JREA 1WYBA 4CI3B 1SA0E 2IMLA 5LOVE 4O2BE 2NP9A 1D1AA 3HKBE 3AEFA 4NXMT 4DUZT 2ZJUA 4HKAA 4ZI7E 4UM3P 1I9BA 3NWIA 2J62A 3RGLA 4LF7T 3FXEB 3N2KE 5FY7A 3U8NA 3RHWA 2XAQB 4U72A 3ZSTA 3NVOA 3S4UA 2QVAA 3AEBA 2QA7A 2NW8A 2RP4A 4UVBB 5JDMA 3ZYLA 4D01A 1ZHCA 3O1JA 3BQKA 2W61A 3KV5A 2V7MA 2WDVA 3AE2A 2X66A 3AEGA 2FJBA 5FNVE 2R6GF 4DO0A 3QB5A 2UUCT 5LG4A 3WI3A 2CBJA 3BQLA 1D1CA 1OXZA 3F31A 4OYKA 2DWKA 2B1EA 4GOUA 1VRBA 2UUAT 5JDFA 3I0QA 2OLTA 3J9X1 5LGUB 4X65T 2ZM2A 2KNDA 3B57A 2JMKA 1YQ3A 5LGNB 4JI1T 4UM1A 4QWNB 5JDLA 1UURA 4B6XA 5DQVA 1QLBA 3VR8A 4QH1A 4TWDA 5C8YE 4QAAA 4Z90A 3WTMA 1HTJF 2E8IA 3LBXA 3VKHA 3ZLIA 2N2NA 4B3RT 1OEDB 1YKEB 1WLXA 2WWUA 5FXXA 3OTOT 2Z6EA 4O2AE 3KINB 2WAUA 2VKOA 4DV2T 2X0LB 3PUVF 3AE6A 5FP3A 5CJ5A 2BZBA 3SWHA 5HXHA 4A56A 2BYRA 3P4SA 3TLSA 1N36T 1IZNB 1MNDA 4JI8T 4I0UA 4PK4A 3JADA 4UM3S 3AVRA 1T7SA 3Q5EA 2LSGA 1D0ZA 3AXJA 4AISA 4LFCT 3AE3A 2CM0A 3PTRB 1E1HB 3HKDE 3ESLA 3U8MA 4LFBT 1XZYA 3GA8A 4LF5T 4AI6A 3HI2A 3HKEE 4AXPA 4JI4T 4O4IE 2JQ9A 3PE0A 4WYVA 2DI4A 2BYQA 3OVUA 5JR9A 1AJ3A 1Z0PA 3RYHE 5AQRB 4KX6A 1N34T 4UXUA 2MOZA 4O4JE 5L4HA 3EHZA 4YHHT 2X51A 2IC9A 3SQ9A 4HGAA 2KLQA 5C2TA 2MAWA 2Q9QB 1XDOA 3CVRA 2XY8B 2RA1A 5J5HA 1IJ5A 4IDPA 4AQYT 3CIRA 2D9DA 3ZYMA 4U7YA 3C4ZA 4KP3C 2YU1A 4OK0A 2H3RA 1BR2A 4DR2T 1U4QA 5JRCB 3O4XE 4KBMB 1T72A 3ZMSB 2WMNA 2Y54A 2Y57A 4UVAB 2H7OA 5BMVE 3LK42 4NIQA 2A3DA 2LLYA 4CXWA 2BJ0A 2BG9C 4KHPT 2PH9A 1BR0A 1BR4A 5ABFB 3IHRA 2WB5A 3AAIA 4N78D 2LSYA 2BS3A 4C91A 3F57A 2H88A 2VWAA 5LMNT 3ZN1B 3K3OA 3FZMB 4HE8A 2A2FX 3ANWA 4HFDA 3UFEA 2QC1B 1FEWA 2VL0A 4UY2A 2EHOA 3ETVA 2N9DA 2BYPA 2XSBA 1S35A 3P4PA 3AA7B 4AQFC 2XAFB 4IDOA 3KVAA 5E0OA 1ZP0A 4HFEA
chains in the Genus database with same CATH topology
2BYQA 4WV9A 5L4EA 3WTOA 4TNWA 2YMDA 5BW2A 4HFCA 5HEHA 2Y58A 2YMEA 3WTJA 2BYNA 2UZ6A 2W8GA 2XQ9A 4UM1A 2XNVA 3TLUA 4X5TA 2Y7YA 5AFJA 3SH1A 4DBMA 4UXUA 3UU8A 5IUXA 4QACA 5J0ZA 2X00D 5HEOA 5L4HA 1OEDC 1OEDA 2XNUA 3WTIA 4ZK4A 5J5IA 3EHZA 5HCJA 2M6BA 5CO5A 3UUBA 4TNVA 5AFKA 2PGZA 4QH4A 5L47A 3WTHA 3P4WA 3SQ9A 2XQ5A 5JMEA 2MAWA 2XQ7A 4Z91A 2LKGA 3EI0A 4QH1A 3WTKA 4TWDA 2ZJUA 4QAAA 3IGQA 4Z90A 4ZR6A 3WTMA 5KE4A 5HCMA 4UM3P 1I9BA 5J5HA 4AFHA 3WTLA 4ZK1A 2YKSA 3PMZA 4ZJSA 3JAFA 2LKHA 2Y56A 5AFHA 4ZZCA 3U8NA 3RHWA 2WNLA 3ZDGA 3U8LA 1OEDB 3UU6A 3WIPA 2XYSA 4TWFA 4HFBA 5AFLA 4F8HA 4QABA 3RI5A 3RIAA 5AINA 2ZJVA 3GUAA 3UQ4A 4LMKA 4BFQA 5BP0A 4ZZBA 1UV6A 4XK9A 4HFHA 3UU3A 4ILAA 3RQWA 4AFGA 5FJVA 3U8KA 2X00A 5LG3A 2Y54A 2W8FA 2Y57A 4BQTA 2BG9E 1UW6A 4NPPA 2XZ6A 4ILCA 3C79A 4D01A 4EZ1A 4QH5A 4TWHA 3RIFA 2LLYA 2XQ3A 4HQPA 5KZUA 3P50A 2XQAA 3WTNA 4UM3A 5LXBA 3JAEA 3LSVA 2WZYA 3UQ7A 4ILBA 3UU5A 2BYRA 5SYOA 2BJ0A 5AFNA 4HFIA 2BG9C 2BG9A 4IREA 3TLSA 3TLTA 4ZJTA 4A98A 4PIRA 5TVCA 2PH9A 4ALXA 3TLWA 5HEUA 4IL4A 2BR8A 2YOEA 5J5FA 5HEGA 3JADA 2WNCA 4UM3S 4LMLA 2XNTA 5BRXA 4AFTA 4COFA 1OEDE 3SQ6A 3ZDHA 2KSRA 2M6IA 3PEOA 3T4MA 2XYTA 3U8MA 5J5GA 2XZ5A 4XHEA 3U8JA 2WNJA 5CFBA 2XQ6A 3TLVA 4ZRUA 2XQ8A 2BYSA 4FRRA 4HFDA 3EAMA 4A97A 4NZBA 4B5DA 1UX2A 2YN6A 2XQ4A 2BR7A 5AFMA 2QC1B 4UY2A 2VL0A 5AFMB 2LM2A 4LMJA 2BG9B 3UU4A 3SIOA 2BYPA 5HEJA 2C9TA 4IL9A 3ZKRA 3C84A 2WN9A 3RQUA 4HFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYQ A;  4WV9 A;  5L4E A;  3WTO A;  4TNW A;  2YMD A;  5BW2 A;  4HFC A;  5HEH A;  2Y58 A;  2YME A;  3WTJ A;  2BYN A;  2UZ6 A;  2W8G A;  2XQ9 A;  4UM1 A;  2XNV A;  3TLU A;  4X5T A;  2Y7Y A;  5AFJ A;  3SH1 A;  4DBM A;  4UXU A;  3UU8 A;  5IUX A;  4QAC A;  5J0Z A;  2X00 D;  5HEO A;  5L4H A;  1OED C;  1OED A;  2XNU A;  3WTI A;  4ZK4 A;  5J5I A;  3EHZ A;  5HCJ A;  2M6B A;  5CO5 A;  3UUB A;  4TNV A;  5AFK A;  2PGZ A;  4QH4 A;  5L47 A;  3WTH A;  3P4W A;  3SQ9 A;  2XQ5 A;  5JME A;  2MAW A;  2XQ7 A;  4Z91 A;  2LKG A;  3EI0 A;  4QH1 A;  3WTK A;  4TWD A;  2ZJU A;  4QAA A;  3IGQ A;  4Z90 A;  4ZR6 A;  3WTM A;  5KE4 A;  5HCM A;  4UM3 P;  1I9B A;  5J5H A;  4AFH A;  3WTL A;  4ZK1 A;  2YKS A;  3PMZ A;  4ZJS A;  3JAF A;  2LKH A;  2Y56 A;  5AFH A;  4ZZC A;  3U8N A;  3RHW A;  2WNL A;  3ZDG A;  3U8L A;  1OED B;  3UU6 A;  3WIP A;  2XYS A;  4TWF A;  4HFB A;  5AFL A;  4F8H A;  4QAB A;  3RI5 A;  3RIA A;  5AIN A;  2ZJV A;  3GUA A;  3UQ4 A;  4LMK A;  4BFQ A;  5BP0 A;  4ZZB A;  1UV6 A;  4XK9 A;  4HFH A;  3UU3 A;  4ILA A;  3RQW A;  4AFG A;  5FJV A;  3U8K A;  2X00 A;  5LG3 A;  2Y54 A;  2W8F A;  2Y57 A;  4BQT A;  2BG9 E;  1UW6 A;  4NPP A;  2XZ6 A;  4ILC A;  3C79 A;  4D01 A;  4EZ1 A;  4QH5 A;  4TWH A;  3RIF A;  2LLY A;  2XQ3 A;  4HQP A;  5KZU A;  3P50 A;  2XQA A;  3WTN A;  4UM3 A;  5LXB A;  3JAE A;  3LSV A;  2WZY A;  3UQ7 A;  4ILB A;  3UU5 A;  2BYR A;  5SYO A;  2BJ0 A;  5AFN A;  4HFI A;  2BG9 C;  2BG9 A;  4IRE A;  3TLS A;  3TLT A;  4ZJT A;  4A98 A;  4PIR A;  5TVC A;  2PH9 A;  4ALX A;  3TLW A;  5HEU A;  4IL4 A;  2BR8 A;  2YOE A;  5J5F A;  5HEG A;  3JAD A;  2WNC A;  4UM3 S;  4LML A;  2XNT A;  5BRX A;  4AFT A;  4COF A;  1OED E;  3SQ6 A;  3ZDH A;  2KSR A;  2M6I A;  3PEO A;  3T4M A;  2XYT A;  3U8M A;  5J5G A;  2XZ5 A;  4XHE A;  3U8J A;  2WNJ A;  5CFB A;  2XQ6 A;  3TLV A;  4ZRU A;  2XQ8 A;  2BYS A;  4FRR A;  4HFD A;  3EAM A;  4A97 A;  4NZB A;  4B5D A;  1UX2 A;  2YN6 A;  2XQ4 A;  2BR7 A;  5AFM A;  2QC1 B;  4UY2 A;  2VL0 A;  5AFM B;  2LM2 A;  4LMJ A;  2BG9 B;  3UU4 A;  3SIO A;  2BYP A;  5HEJ A;  2C9T A;  4IL9 A;  3ZKR A;  3C84 A;  2WN9 A;  3RQU A;  4HFE A; 
#chains in the Genus database with same CATH topology
 2V7I A;  3C50 A;  3R6N A;  3SH1 A;  1YD8 G;  5J5I A;  4UV8 B;  1W0B A;  3QNU A;  3AE7 A;  2LE8 A;  4WBN E;  5KE4 A;  3M3Z B;  2W0G A;  4GIW A;  3IA3 A;  4ZK1 A;  4PJM A;  3E0Z A;  4DVD A;  3RKO A;  1Y64 B;  3LDQ B;  1GQE A;  5LBQ B;  3UQ4 A;  2W00 A;  1KEY A;  2I59 A;  2J4G A;  5HYA A;  4I50 E;  3H37 A;  2BDE A;  2ZM0 A;  2UXC T;  2D5U A;  4YY3 T;  5AQL B;  2E5L T;  4HEA A;  5TVC A;  3P4R A;  1M62 A;  3KV6 A;  4QXH B;  2IHR 1;  5HEU A;  4IL4 A;  4AIU A;  1T8B A;  4U2Z A;  2BS2 A;  4EYU A;  3RYF E;  2UXN B;  2CRB A;  3AAA B;  4DV3 T;  4CN1 A;  5AQI B;  5L3D B;  1XWM A;  2WP9 A;  3ZCI A;  1V9D A;  5AFM B;  2ZLY A;  4DV0 T;  2HHH T;  2W4X A;  3UUL A;  2V26 A;  2VKJ A;  2FBW A;  2IIU A;  4MAL A;  1YQ4 A;  1I94 T;  2MBG A;  2UZ6 A;  2W8G A;  4IE5 A;  2FJA A;  2XZE A;  3RPU A;  2OA5 A;  1HFA A;  4JI2 T;  1OED A;  3ZYK A;  2C5I T;  5CO5 A;  2L8K A;  3F2E A;  3E22 E;  3UTK A;  4TV9 E;  3CX7 B;  3EI0 A;  3WTK A;  4CI1 B;  2GK9 A;  5AQP B;  1NEN A;  5KX5 E;  2LT3 A;  4PJL A;  2LKH A;  2CHN A;  5IYZ E;  2JIW A;  4X1Y E;  4F8H A;  3A7M A;  3FXD B;  5LXT E;  5FXW A;  4XZC A;  4JYA T;  2PJQ A;  2X9H A;  4H9O C;  4AFG A;  1D0Y A;  2CWO A;  4BQT A;  1UCU A;  4NPP A;  2X9W A;  1W0A A;  4GKK T;  2XQA A;  2E9X D;  5LXB A;  4FJO A;  3AVS A;  2UXB T;  4ILB A;  4DV7 T;  2RPA A;  3PUW F;  2CLY C;  3I9W A;  4NUU A;  2BKP A;  2E9X C;  3UUX B;  2I6H A;  5J5F A;  3MK7 C;  2HN1 A;  3KDS E;  3ZC1 A;  3QK6 A;  2JJ9 A;  2J1D G;  3ZDH A;  3LK3 B;  2C0S A;  3T4M A;  2NWB A;  1FIO A;  4P0A A;  3FZL B;  4LF9 T;  4YSX A;  3PDY A;  4G63 A;  1IBM T;  2DCF A;  5KDM C;  2KMF A;  1D0X A;  3FBZ A;  4IDQ A;  3FBL A;  5AQS B;  2X0H A;  4UEM A;  5JH7 E;  2LM9 A;  2X0Y A;  4HWF A;  5LB7 B;  5J0Z A;  5L3B B;  2WS3 A;  2M6B A;  3AEE A;  5AFK A;  4QH4 A;  3P4W A;  3L8R A;  3Q9D A;  1HS7 A;  4X1K E;  5FY0 A;  2K3W A;  2KXP B;  2FJD A;  2QGS A;  4ZJS A;  3GN5 A;  3T1Y T;  1NEK A;  1UK5 A;  3BQI A;  5ETW A;  4NUV A;  5FKY A;  3UT5 E;  3V5U A;  4PAG A;  1IBK T;  3RI5 A;  5ABF A;  2P9B A;  4LMK A;  4ISS A;  4IHJ E;  3ZJ1 A;  3RQW A;  1KNP A;  3U8K A;  1VOM A;  5LG3 A;  4K0U A;  1MMD A;  3L09 A;  2BG9 E;  4EOZ B;  3AA0 B;  2XAH B;  3Q5D A;  4IE4 A;  4P09 A;  3CX8 B;  5IWA T;  1E7P A;  2ZMA A;  5LP6 E;  3ONL C;  3SS1 A;  4ERR A;  2IUB A;  4J2C A;  4L0R A;  4AFT A;  4AKG A;  3M65 A;  3C64 A;  5LJM A;  3N9M A;  2XYT A;  4I55 E;  1HNZ T;  4QKN A;  5CFB A;  1HCI A;  4DMV A;  2VAS A;  4DV1 T;  4CZZ B;  5AFU L;  3SIO A;  5FL0 A;  1IBL T;  3Q2M A;  4U74 A;  4YXD A;  2YMD A;  5ADX L;  1WCR A;  1FMW A;  5JDG A;  3DJB A;  4LFA T;  4DMW A;  3ZT6 A;  1O3X A;  1SHZ C;  5L3G B;  1ZKE A;  1HNW T;  2LJL A;  4CXX A;  1XMO T;  3AEA A;  2MYS A;  4BA9 A;  4PK6 A;  1L0V A;  2IDO B;  4HFB A;  4UF0 B;  4WBO A;  3HL6 A;  5BP0 A;  1UV6 A;  3U78 A;  5AQJ B;  2SPC A;  5AQT B;  4JI5 T;  3RIF A;  3P50 A;  4I43 B;  2WQY A;  4GK5 E;  3UQ7 A;  4B3S T;  2V6X A;  2DL1 A;  4XBF B;  3PV0 F;  1VCT A;  2XNT A;  1OED E;  2CXL A;  5LCY A;  1MMA A;  3VHL A;  5J5G A;  2VL8 A;  4AKR B;  2XPK A;  3G06 A;  1YKH B;  2XQ4 A;  3KFW X;  4JI0 T;  2HPL A;  2PG8 A;  2W62 A;  2WY2 A;  5JR9 C;  3AAE B;  5BW2 A;  3NRX A;  3QC9 A;  4E7Z A;  2BBJ A;  3KV4 A;  3KV9 A;  4O4H E;  3K3Q C;  3OBV E;  5L47 A;  2WDQ A;  4TX5 A;  2WU5 A;  3RIU C;  4PNI A;  2OV9 A;  1IAP A;  3CQC B;  3NZQ A;  2CPT A;  3PU3 A;  2A9U A;  4DND A;  5DJQ C;  4MHC A;  3UU6 A;  1OWA A;  4TWF A;  5AIN A;  3GUA A;  1ZV4 X;  3KBT A;  4IST A;  1QSD A;  4ZZB A;  2CBI A;  2IC6 A;  3RIU A;  4CN6 A;  3IBP A;  4K0K T;  5CGM A;  1Z8U A;  4DR7 T;  4CQI A;  3WTN A;  4GYS A;  1HX8 A;  3U3I A;  3JAE A;  4LF4 T;  1M7K A;  4ALX A;  3I1A A;  2E5V A;  2MPK A;  3CQX C;  3LFM A;  3QB5 K;  5HAX A;  2EHO D;  3UFG A;  1G73 A;  2NTY A;  3JC6 D;  4CI2 B;  3PUZ F;  1UX2 A;  2BR7 A;  3EDU A;  2YIN A;  4JLE A;  5L2L A;  2EHO C;  3FZK B;  5F5W A;  2ODU A;  3EUH A;  4ZI2 D;  3RH3 A;  3JC6 C;  1LVF A;  4QXB B;  4BJN A;  4TN7 B;  2YK0 A;  4ZI2 C;  3T1H T;  3EVY A;  2V5C A;  2YDQ A;  3KBU A;  3MJX A;  3PUX F;  2XTL A;  4GYR A;  3CX6 B;  2HPJ A;  3C4X A;  2XUE A;  3PUY F;  3HA4 A;  3PJA J;  4EZH A;  1H7C A;  2XSA A;  1NWM X;  5HWY A;  3ZDG A;  3U8L A;  5AFL A;  2ACX A;  4QAB A;  3OYX A;  5EK4 A;  1KNR A;  1MIY A;  2V5D A;  4CN4 A;  4EXT A;  2C5K T;  4HWD A;  4YLH A;  3KVB A;  3H3M A;  2K5B B;  2LOS A;  4XAX B;  4ZJT A;  3O1I A;  4X62 T;  4H63 V;  2ES0 A;  3PUG A;  4F6R C;  5HWX A;  3I0O A;  5LA6 E;  1HG2 A;  1MIV A;  2NW9 A;  3RRC A;  2X68 A;  2HN2 A;  4PW8 A;  4ZXL A;  2WZH A;  1MMN A;  4LF8 T;  4NZB A;  2JQQ A;  3EAM A;  1WYC A;  2WMO A;  3CQG B;  4DID B;  3OPC A;  1N33 T;  2C9T A;  1KK7 A;  3CK6 A;  5H6Q B;  4EZ4 A;  2WN9 A;  4YSY A;  3QOF A;  2VK9 A;  4WZX A;  2JQK A;  5HEH A;  2C5J A;  1T98 A;  3N9N A;  2BYN A;  1D1B A;  4OYJ A;  5HXR A;  3RRW A;  4DV6 T;  2NW7 A;  4TV8 E;  5AQG B;  5FVK A;  1OED C;  3VR9 A;  4UF0 A;  3JCF A;  4QX7 B;  3CWZ B;  2YDR A;  2BKO A;  3B13 A;  5AQV B;  2XQ7 A;  4UR9 A;  3ZEF B;  4JI3 T;  2LOP A;  3K3N A;  2VKH A;  2WSS V;  4KMC A;  5AQH B;  1WR6 A;  5LMU T;  4TZ4 C;  4ILA A;  2BS4 A;  5AQQ B;  2CMR A;  5J2U E;  3LJC A;  4EZ1 A;  4EED A;  3AE4 A;  3HR0 A;  4ADZ A;  4O4L E;  2Y6X A;  5AFN A;  3D0T A;  4HFI A;  3TLT A;  2KIN B;  2G0U A;  4X20 E;  3N9L A;  3ZSS A;  4BJM A;  2ZM8 A;  3W15 B;  4EGW A;  5LHG B;  3AXJ B;  3OJA A;  5FMN A;  5DAB A;  2VQF T;  1HR0 T;  4B5D A;  2Q9Q D;  2CXD A;  1UUS A;  4UXN B;  2BBH A;  1E2A A;  1LVK A;  2VB6 A;  2Q9Q C;  2V6Y B;  4TNW A;  4HFC A;  2K48 A;  4EEB A;  3ZCJ A;  2AE9 A;  3TLU A;  5AFJ A;  2KZ7 B;  4DR5 T;  5IUX A;  3RC3 A;  4JI6 T;  3C51 A;  2X00 D;  3SFE A;  2CCQ A;  3N2G E;  3NRY A;  4EYY R;  5J2T E;  3O1H A;  5L3F B;  2FJE A;  3UUN A;  4KI0 F;  4P1N A;  2Q9Q A;  4ZR6 A;  2VUR A;  3N2O A;  1UX5 A;  3SOL A;  4IIJ E;  2LHR A;  3SFD A;  1FMV A;  4DR1 T;  4L5G A;  5AFH A;  3FB2 A;  3WIP A;  1MNE A;  5CA0 E;  2PBI A;  3L3P A;  2YEV C;  4YSZ A;  4BFQ A;  1G8X A;  5JRC A;  4HFH A;  3NZP A;  1J1J A;  2LSI A;  2X00 A;  2IAK A;  3CPZ A;  1UW6 A;  5FVL A;  2CHO A;  2JQH A;  4QH5 A;  2XHE B;  2PFV A;  2CEA A;  4UM3 A;  1HF8 A;  3LSV A;  2K24 A;  2VVS A;  2D0T A;  4IT4 A;  4IRE A;  2LSJ A;  2JRK A;  4U3C A;  3RLF F;  3MZK B;  2ZM6 T;  5F8P A;  5LYJ E;  4H9Q C;  5BRX A;  5L3C B;  2LEH A;  2WM9 A;  4ASK A;  5L3E B;  4EB6 E;  1NAF A;  1XDP A;  1Y01 A;  4XHE A;  3H3A A;  4PFO A;  4KUM B;  2WZI A;  2LM2 A;  2BG9 B;  4DBR A;  2KT9 A;  3UU4 A;  4YJ3 E;  2UXX B;  2V7K A;  5JDH A;  4IL9 A;  2XQY A;  3TKL B;  3RQU A;  4I4T E;  5AQN B;  4U31 A;  5LHH B;  2XQ9 A;  3RYC E;  4LF6 T;  4DBM A;  3ZC0 A;  4CXY A;  3OKQ A;  2DWG A;  4IDN A;  2XNU A;  4O8S A;  1R8I A;  4HTE A;  4YT0 A;  3WTH A;  3BK9 A;  2X9X A;  5JDQ A;  1N32 T;  1UX4 A;  3C98 B;  5FY1 A;  3FHN A;  4IE6 A;  3CKD A;  2X67 A;  2V7L A;  4H63 H;  4AFH A;  2YKS A;  2JPF A;  2NTX A;  1KNZ A;  4TUY E;  5IHY A;  3ZMV B;  3ZMZ B;  2UXD T;  3MAC A;  3N9Q A;  5FJV A;  1LKX A;  2XZ6 A;  4M1P A;  2X9Y A;  4ILC A;  2V7J A;  3IEE A;  1I6Z A;  3N9O A;  3P8C D;  4A98 A;  4PJN A;  3VKG A;  5HXS A;  4U33 A;  2YOE A;  3J7Y q;  5HEG A;  4ZOL E;  2JMH A;  5HXE A;  3ONJ A;  1WFD A;  3U8J A;  2WNJ A;  3PU8 A;  4EV6 A;  4QX8 B;  3VRA A;  3B5M A;  3FZH B;  5AFM A;  2W66 A;  2A72 A;  1US7 B;  3V5S A;  2N1G A;  5FYM A;  2H89 A;  4AKL A;  1ZOY A;  2M6I A;  4EAH A;  2F4V T;  4L9I A;  3WTO A;  2H7V C;  2Y58 A;  2I0M A;  2BKN A;  3RYI E;  3ZPO A;  2DHR A;  4AKI A;  2YU2 A;  4OFZ A;  1YXR A;  4YHJ A;  2UUB T;  2HH7 A;  3UUB A;  4PK5 A;  4DR4 T;  4TNV A;  2B76 A;  2CXF A;  4DV5 T;  2XQ5 A;  4ANJ A;  4B3T T;  2WBL A;  3IGQ A;  2W63 A;  1YW0 A;  4HWH A;  5M4Y A;  3PUS A;  4HWI B;  1WR0 A;  5AQF B;  1J5E T;  3ZJ2 A;  3I9Y A;  3O9X A;  4ZHQ E;  1SE7 A;  4U7I A;  3PJA A;  2Y56 A;  2LHN A;  1JNZ A;  3WAK A;  3RIA A;  5CB4 E;  4BAY B;  1X9B A;  4XK9 A;  3UU3 A;  4UEL A;  5A1L A;  3LG7 A;  5JTG A;  4YTN A;  4QHO A;  1X79 A;  3C79 A;  3MA9 A;  2XQ3 A;  4HQP A;  2XAG B;  1LRZ A;  5SYO A;  2K9A A;  1XMQ T;  2ODV A;  1HG5 A;  4ZS3 A;  3N9P A;  5AQM B;  5LBM A;  4HFV A;  2QYW A;  4LML A;  5LHI B;  4PFP A;  2V6Y A;  3SQ6 A;  3HKC E;  2KSR A;  3NKZ A;  3QUJ A;  1KF6 A;  4JV5 T;  3ZT5 A;  2XZ5 A;  4Q25 A;  3OYZ A;  4H9R C;  4ZRU A;  1J5W A;  4A97 A;  2YN6 A;  3RX6 A;  4LMJ A;  4WW0 A;  3FZF B;  2NR4 A;  4HN9 A;  2PTF A;  3PUR A;  2CLY B;  4P0B A;  1DU2 A;  4WNK A;  2DNX A;  2YDS A;  2E9X B;  3Q5X A;  2WDR A;  5L4E A;  3GMI A;  3AA6 B;  3RKG A;  2Y7Y A;  1XNQ T;  2LSK A;  3Q5W A;  3L39 A;  5FL1 A;  4QAC A;  4GK0 E;  5F3J A;  4YFS A;  4ZK4 A;  2ACZ A;  4DR6 T;  4JBW F;  2PGZ A;  3ETU A;  3K8P C;  4Z91 A;  4YTP A;  3AE5 A;  2LRL A;  5HCM A;  2VVN A;  4H9S E;  3WTL A;  3GN5 B;  3JAF A;  4OX9 T;  2XM1 A;  1HX1 B;  1QUU A;  3X1D A;  3A8Y C;  5KZU A;  4MLK A;  3AEC A;  2Y48 B;  4X1I E;  3UU5 A;  5AQU B;  2BG9 A;  4PIR A;  3T8O A;  3C4W A;  1ZEE A;  3TLW A;  5CA1 E;  2BR8 A;  1BR1 A;  3AED A;  3N5L A;  4COF A;  3SRZ A;  4QXC B;  4DBQ A;  2WCA A;  2W2U A;  4MFR A;  1MMG A;  2XQ8 A;  4FRR A;  4YTM A;  4ZEY A;  5EZY E;  4DV4 T;  2UU9 T;  2WU2 A;  5HEJ A;  5LNK A;  4AQF A;  3AE1 A;  2IW5 B;  3C84 A;  3VRB A;  3R84 B;  2YME A;  4HWC A;  4X5T A;  4ILU A;  3IF8 B;  1SUM B;  4UVC B;  4X64 T;  2L9Q A;  2M67 A;  3ABV A;  5FXV A;  5KXJ A;  2V8S V;  5ABE A;  5H6R B;  2LKG A;  4ZS2 A;  3A5X A;  2MTQ A;  3AE8 A;  2VQE T;  4YJ2 E;  3PMZ A;  2AXD S;  5HXC A;  1IJ6 A;  1W9R A;  2L3L A;  4JEU B;  4H9P C;  2ZJV A;  4UIG A;  4GKJ T;  5C3J A;  2XJ7 A;  4JI7 T;  4JEH B;  3P7I A;  3K1S A;  2W8F A;  3EAB A;  3ZN0 B;  2CE7 A;  4TWH A;  4ZI3 D;  3LBX B;  2CA5 A;  4PJJ A;  5DQW A;  4A5X A;  4IE0 A;  2CWY A;  2XAS B;  4IDZ A;  3E08 A;  1S94 A;  4ZI3 C;  2WNC A;  4Z8X A;  2XAJ B;  2BVM A;  2W67 A;  4AQG A;  2FUP A;  2V1D B;  2LRK A;  3ZT7 A;  5JDN A;  3DTO A;  3ONX A;  1W09 A;  1MIW A;  3ZKR A;  3CML A;  5LGT B;  2XNV A;  2KWH A;  2XM2 A;  5HEO A;  3WTI A;  5EK3 A;  3AB3 B;  5HCJ A;  3VU7 H;  3ZMT B;  4E7S A;  5JME A;  5EK2 A;  2QRX A;  5ABG A;  3AE9 A;  5JR9 B;  4FI5 A;  2DLR A;  2Y8D A;  1FJG T;  4DR3 T;  4ZZC A;  5LJN A;  2WNL A;  4AKH A;  1KFY A;  1XNR T;  2XYS A;  1CUN A;  1UGO A;  1VCS A;  5FXZ A;  1WRD A;  2KWI B;  3ZMU B;  1HNX T;  4KHZ F;  1B7T A;  5AQK B;  1U5P A;  4OHF A;  4G2A A;  3RF1 A;  2E2A A;  3MXZ A;  3EDV A;  4NXN T;  3PUA A;  4DUY T;  4V1A v;  3LK2 B;  2WZY A;  3RC8 A;  4B3M T;  5TAO A;  3WAJ A;  3MKD A;  2E9X A;  5GON E;  3NBX X;  4H9N C;  3PEO A;  1CHU A;  4IE7 A;  1JNR A;  5KMG P;  2J47 A;  2XQ6 A;  3TLV A;  2BYS A;  1EZ3 A;  3UUM A;  2BVL A;  4MBQ A;  2D2S A;  4IGU A;  2VKD A;  4C90 A;  3AA1 B;  4UV9 B;  2WWV A;  5ABH A;  3GWH A;  4WV9 A;  5JVD E;  5JQG E;  3DP7 A;  4EIW A;  5BR8 T;  3WTJ A;  2NOX A;  5J1G A;  4X66 T;  3PUQ A;  3UU8 A;  3P4Q A;  3ANW B;  2D0U A;  5AQO B;  4JUY A;  4U2Y A;  2EHO B;  5JRE A;  1WYB A;  4CI3 B;  1SA0 E;  2IML A;  5LOV E;  4O2B E;  2NP9 A;  1D1A A;  3HKB E;  3AEF A;  4NXM T;  4DUZ T;  2ZJU A;  4HKA A;  4ZI7 E;  4UM3 P;  1I9B A;  3NWI A;  2J62 A;  3RGL A;  4LF7 T;  3FXE B;  3N2K E;  5FY7 A;  3U8N A;  3RHW A;  2XAQ B;  4U72 A;  3ZST A;  3NVO A;  3S4U A;  2QVA A;  3AEB A;  2QA7 A;  2NW8 A;  2RP4 A;  4UVB B;  5JDM A;  3ZYL A;  4D01 A;  1ZHC A;  3O1J A;  3BQK A;  2W61 A;  3KV5 A;  2V7M A;  2WDV A;  3AE2 A;  2X66 A;  3AEG A;  2FJB A;  5FNV E;  2R6G F;  4DO0 A;  3QB5 A;  2UUC T;  5LG4 A;  3WI3 A;  2CBJ A;  3BQL A;  1D1C A;  1OXZ A;  3F31 A;  4OYK A;  2DWK A;  2B1E A;  4GOU A;  1VRB A;  2UUA T;  5JDF A;  3I0Q A;  2OLT A;  3J9X 1;  5LGU B;  4X65 T;  2ZM2 A;  2KND A;  3B57 A;  2JMK A;  1YQ3 A;  5LGN B;  4JI1 T;  4UM1 A;  4QWN B;  5JDL A;  1UUR A;  4B6X A;  5DQV A;  1QLB A;  3VR8 A;  4QH1 A;  4TWD A;  5C8Y E;  4QAA A;  4Z90 A;  3WTM A;  1HTJ F;  2E8I A;  3LBX A;  3VKH A;  3ZLI A;  2N2N A;  4B3R T;  1OED B;  1YKE B;  1WLX A;  2WWU A;  5FXX A;  3OTO T;  2Z6E A;  4O2A E;  3KIN B;  2WAU A;  2VKO A;  4DV2 T;  2X0L B;  3PUV F;  3AE6 A;  5FP3 A;  5CJ5 A;  2BZB A;  3SWH A;  5HXH A;  4A56 A;  2BYR A;  3P4S A;  3TLS A;  1N36 T;  1IZN B;  1MND A;  4JI8 T;  4I0U A;  4PK4 A;  3JAD A;  4UM3 S;  3AVR A;  1T7S A;  3Q5E A;  2LSG A;  1D0Z A;  3AXJ A;  4AIS A;  4LFC T;  3AE3 A;  2CM0 A;  3PTR B;  1E1H B;  3HKD E;  3ESL A;  3U8M A;  4LFB T;  1XZY A;  3GA8 A;  4LF5 T;  4AI6 A;  3HI2 A;  3HKE E;  4AXP A;  4JI4 T;  4O4I E;  2JQ9 A;  3PE0 A;  4WYV A;  2DI4 A;  2BYQ A;  3OVU A;  5JR9 A;  1AJ3 A;  1Z0P A;  3RYH E;  5AQR B;  4KX6 A;  1N34 T;  4UXU A;  2MOZ A;  4O4J E;  5L4H A;  3EHZ A;  4YHH T;  2X51 A;  2IC9 A;  3SQ9 A;  4HGA A;  2KLQ A;  5C2T A;  2MAW A;  2Q9Q B;  1XDO A;  3CVR A;  2XY8 B;  2RA1 A;  5J5H A;  1IJ5 A;  4IDP A;  4AQY T;  3CIR A;  2D9D A;  3ZYM A;  4U7Y A;  3C4Z A;  4KP3 C;  2YU1 A;  4OK0 A;  2H3R A;  1BR2 A;  4DR2 T;  1U4Q A;  5JRC B;  3O4X E;  4KBM B;  1T72 A;  3ZMS B;  2WMN A;  2Y54 A;  2Y57 A;  4UVA B;  2H7O A;  5BMV E;  3LK4 2;  4NIQ A;  2A3D A;  2LLY A;  4CXW A;  2BJ0 A;  2BG9 C;  4KHP T;  2PH9 A;  1BR0 A;  1BR4 A;  5ABF B;  3IHR A;  2WB5 A;  3AAI A;  4N78 D;  2LSY A;  2BS3 A;  4C91 A;  3F57 A;  2H88 A;  2VWA A;  5LMN T;  3ZN1 B;  3K3O A;  3FZM B;  4HE8 A;  2A2F X;  3ANW A;  4HFD A;  3UFE A;  2QC1 B;  1FEW A;  2VL0 A;  4UY2 A;  2EHO A;  3ETV A;  2N9D A;  2BYP A;  2XSB A;  1S35 A;  3P4P A;  3AA7 B;  4AQF C;  2XAF B;  4IDO A;  3KVA A;  5E0O A;  1ZP0 A;  4HFE A; 
#chains in the Genus database with same CATH homology
 2BYQ A;  4WV9 A;  5L4E A;  3WTO A;  4TNW A;  2YMD A;  5BW2 A;  4HFC A;  5HEH A;  2Y58 A;  2YME A;  3WTJ A;  2BYN A;  2UZ6 A;  2W8G A;  2XQ9 A;  4UM1 A;  2XNV A;  3TLU A;  4X5T A;  2Y7Y A;  5AFJ A;  3SH1 A;  4DBM A;  4UXU A;  3UU8 A;  5IUX A;  4QAC A;  5J0Z A;  2X00 D;  5HEO A;  5L4H A;  1OED C;  1OED A;  2XNU A;  3WTI A;  4ZK4 A;  5J5I A;  3EHZ A;  5HCJ A;  2M6B A;  5CO5 A;  3UUB A;  4TNV A;  5AFK A;  2PGZ A;  4QH4 A;  5L47 A;  3WTH A;  3P4W A;  3SQ9 A;  2XQ5 A;  5JME A;  2MAW A;  2XQ7 A;  4Z91 A;  2LKG A;  3EI0 A;  4QH1 A;  3WTK A;  4TWD A;  2ZJU A;  4QAA A;  3IGQ A;  4Z90 A;  4ZR6 A;  3WTM A;  5KE4 A;  5HCM A;  4UM3 P;  1I9B A;  5J5H A;  4AFH A;  3WTL A;  4ZK1 A;  2YKS A;  3PMZ A;  4ZJS A;  3JAF A;  2LKH A;  2Y56 A;  5AFH A;  4ZZC A;  3U8N A;  3RHW A;  2WNL A;  3ZDG A;  3U8L A;  1OED B;  3UU6 A;  3WIP A;  2XYS A;  4TWF A;  4HFB A;  5AFL A;  4F8H A;  4QAB A;  3RI5 A;  3RIA A;  5AIN A;  2ZJV A;  3GUA A;  3UQ4 A;  4LMK A;  4BFQ A;  5BP0 A;  4ZZB A;  1UV6 A;  4XK9 A;  4HFH A;  3UU3 A;  4ILA A;  3RQW A;  4AFG A;  5FJV A;  3U8K A;  2X00 A;  5LG3 A;  2Y54 A;  2W8F A;  2Y57 A;  4BQT A;  2BG9 E;  1UW6 A;  4NPP A;  2XZ6 A;  4ILC A;  3C79 A;  4D01 A;  4EZ1 A;  4QH5 A;  4TWH A;  3RIF A;  2LLY A;  2XQ3 A;  4HQP A;  5KZU A;  3P50 A;  2XQA A;  3WTN A;  4UM3 A;  5LXB A;  3JAE A;  3LSV A;  2WZY A;  3UQ7 A;  4ILB A;  3UU5 A;  2BYR A;  5SYO A;  2BJ0 A;  5AFN A;  4HFI A;  2BG9 C;  2BG9 A;  4IRE A;  3TLS A;  3TLT A;  4ZJT A;  4A98 A;  4PIR A;  5TVC A;  2PH9 A;  4ALX A;  3TLW A;  5HEU A;  4IL4 A;  2BR8 A;  2YOE A;  5J5F A;  5HEG A;  3JAD A;  2WNC A;  4UM3 S;  4LML A;  2XNT A;  5BRX A;  4AFT A;  4COF A;  1OED E;  3SQ6 A;  3ZDH A;  2KSR A;  2M6I A;  3PEO A;  3T4M A;  2XYT A;  3U8M A;  5J5G A;  2XZ5 A;  4XHE A;  3U8J A;  2WNJ A;  5CFB A;  2XQ6 A;  3TLV A;  4ZRU A;  2XQ8 A;  2BYS A;  4FRR A;  4HFD A;  3EAM A;  4A97 A;  4NZB A;  4B5D A;  1UX2 A;  2YN6 A;  2XQ4 A;  2BR7 A;  5AFM A;  2QC1 B;  4UY2 A;  2VL0 A;  5AFM B;  2LM2 A;  4LMJ A;  2BG9 B;  3UU4 A;  3SIO A;  2BYP A;  5HEJ A;  2C9T A;  4IL9 A;  3ZKR A;  3C84 A;  2WN9 A;  3RQU A;  4HFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...