2XQ5A

Pentameric ligand gated ion channel glic in complex with tetraethylarsonium (teas)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
total genus 74
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq5A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq5A01
5CO5A 5AINA 4QH5A 2WN9A 3LSVA 1OEDE 4ZZCA 3SIOA 2WNLA 3U8NA 4TNVA 2BG9C 4ALXA 3UU8A 5AFLA 2BYNA 3EI0A 5KZUA 5HEGA 2YMEA 3RHWA 5LG3A 3UQ7A 4FRRA 5J0ZA 4LMKA 2LLYA 2XQAA 2BJ0A 2BYSA 3RI5A 5AFHA 5AFKA 4UXUA 3UU5A 2XQ9A 2VL0A 3TLSA 3PMZA 3EAMA 5KE4A 3JAEA 3WTNA 5TVCA 4HQPA 2LM2A 3U8JA 4NPPA 2PH9A 4QABA 5FJVA 4TWDA 4XHEA 3TLWA 3EHZA 2XQ6A 2Y58A 4QAAA 4TNWA 5HEJA 2XNUA 2WNJA 4UM3P 4UM3S 4AFHA 4ZK1A 5AFJA 2MAWA 5AFNA 2XQ4A 2X00D 3WTLA 4TWFA 2XZ6A 3SQ6A 4QH4A 2M6IA 3U8MA 3JAFA 5JMEA 2X00A 1OEDC 4ZRUA 4XK9A 4A97A 3RQUA 2YMDA 4QH1A 1OEDA 3WTJA 2XQ8A 4D01A 4LMLA 5HEUA 4ILCA 2BG9A 2XQ7A 4AFTA 5J5GA 3UU4A 1OEDB 2LKGA 4HFEA 2M6BA 2PGZA 2W8GA 4HFCA 5J5FA 3TLTA 2BG9B 4F8HA 2W8FA 3GUAA 4Z91A 3T4MA 4ZJSA 4LMJA 4HFBA 2XNVA 2YKSA 3ZDHA 5J5IA 2UZ6A 4BFQA 4ZK4A 4ILAA 4DBMA 4A98A 4WV9A 2Y7YA 3RIFA 2BG9E 4ZJTA 4EZ1A 4IL9A 5HEHA 2KSRA 3UU6A 2YN6A 3U8KA 3WTHA 4ZR6A 2BYPA 5HEOA 3UUBA 2XZ5A 3UU3A 3ZDGA 4IREA 2XYTA 4ILBA 4PIRA 5L4EA 3U8LA 3TLUA 4COFA 4NZBA 4AFGA 5LXBA 2BR7A 5SYOA 1UV6A 2C9TA 3UQ4A 3WIPA 2LKHA 4HFDA 2Y56A 3IGQA 2ZJVA 5J5HA 2BYRA 5L4HA 4TWHA 3RQWA 3ZKRA 4BQTA 2YOEA 1UW6A 5AFMA 3RIAA 3PEOA 3SQ9A 3P50A 3WTOA 2BR8A 5HCJA 4X5TA 1UX2A 3WTKA 5AFMB 4HFIA 3P4WA 1I9BA 2WZYA 5L47A 5BRXA 4IL4A 3SH1A 3JADA 2WNCA 4Z90A 2XYSA 2Y54A 2Y57A 4UM3A 2BYQA 3C79A 4QACA 2XQ3A 5HCMA 4ZZBA 4UM1A 2ZJUA 5CFBA 2XNTA 2QC1B 3TLVA 4B5DA 4HFHA 5IUXA 3WTIA 2XQ5A 3C84A 4UY2A 5BP0A 5BW2A 3WTMA
chains in the Genus database with same CATH superfamily
1MNEA 4QKNA 5JDHA 4YSZA 3QB5A 4ZS3A 2JQQA 2ES0A 4QX7B 4DR5T 3SWHA 1ZEEA 4LFAT 4GKJT 3LK2B 3PUYF 2ZMAA 3N9PA 4TWDA 3TLWA 1OWAA 3V5UA 2R6GF 3ONXA 3JC6D 3AAEB 3AE3A 2WB5A 2BKPA 2I0MA 1V9DA 2NP9A 2WQYA 3FXDB 4UVBB 4ILCA 4AFTA 2V7MA 4HFCA 1QUUA 1U4QA 2W61A 2KZ7B 4K0KT 4NUVA 2UXCT 2V7JA 2BS4A 3BQLA 3RIFA 2AE9A 4A5XA 4BAYB 5HEHA 4YFSA 5AQFB 3QNUA 5HEOA 2YDRA 4ILBA 3TLUA 2EHOB 2VB6A 4DVDA 3ZC0A 3AVSA 2XZEA 3FHNA 4C91A 1KFYA 4BQTA 2LHNA 1N32T 3RIAA 3SFDA 4X1IE 5M4YA 1Y64B 5L47A 2UXBT 3FZKB 4Z90A 4UM3A 2BYQA 3IF8B 2G0UA 4JI7T 1FIOA 3HKEE 4PK4A 3QUJA 4DR6T 2FUPA 4X65T 4QH5A 2WN9A 5FY0A 3RC8A 4TNVA 2BBJA 5AQGB 3KV6A 5KZUA 3ZMSB 2X9XA 4DR1T 2VKHA 2LHRA 2PTFA 4UVAB 2LT3A 5KE4A 4K0UA 2LM2A 2XAGB 1ZKEA 2V6XA 3EHZA 1YQ3A 4H9SE 3WTLA 2NW7A 2QA7A 5FXXA 2X0LB 1XDPA 2PFVA 4A97A 3O1IA 3O1HA 3PU3A 5AQLB 2CEAA 2PG8A 2V6YA 4IE4A 4I43B 2VQFT 4L5GA 3A8YC 4ZJSA 1XMQT 3A5XA 2BG9E 3K1SA 1T7SA 4XZCA 2BS3A 3U8KA 4ERRA 1NENA 5L3EB 3AEAA 4ZR6A 5HXEA 2LSJA 3ZT5A 2DI4A 4COFA 5C3JA 3AEDA 4O2BE 3UQ4A 2DCFA 5J5HA 4L9IA 4ZI2D 3FB2A 3HR0A 3KV9A 1UGOA 2FJBA 3WTOA 1IJ5A 5HCJA 5BRXA 4ZS2A 3O4XE 5AQSB 1T72A 2HN2A 3KV5A 4U74A 5FYMA 3GWHA 3IEEA 4HFHA 2XQ5A 3CX7B 2IW5B 1KNRA 4EEBA 4X1YE 3TKLB 1HNXT 4MALA 4UF0B 4HN9A 4H9RC 4QXHB 3UULA 2OLTA 3UU8A 1HFAA 5AFLA 4EB6E 5HXSA 4O8SA 1XNRT 4FRRA 3Q5WA 2CPTA 4O2AE 2WZIA 2ODUA 1KEYA 4V1Av 3CWZB 3W15B 1WCRA 3AA1B 4DV4T 1B7TA 2CBJA 2LEHA 3GMIA 3LFMA 3WTJA 3RIUC 2BKNA 5EK3A 3AE9A 3RKOA 3CMLA 1SE7A 3NWIA 2YKSA 5L3DB 4DV2T 4ZK4A 4DBMA 2BZBA 1LVFA 3K3QC 3UU6A 2CMRA 1NAFA 2X66A 2WMOA 3ZN0B 2BYPA 3C98B 5LNKA 1WRDA 2W62A 1D1CA 4AISA 2XHEB 4CI3B 3L09A 3PUVF 5LG4A 1LVKA 3F57A 3P50A 2LSYA 4B3RT 1UX2A 3N9QA 2H7OA 2Y57A 3C79A 2XQ3A 5HCMA 4HE8A 3JC6C 4LF9T 4WBNE 4AKHA 4CI1B 3ONJA 3T8OA 3N9OA 4YHJA 5CO5A 4P0BA 2FJAA 4YJ3E 3AEGA 2WNLA 4CXWA 2V8SV 3AA7B 2HPJA 4TN7B 5AFUL 3P4QA 1MIWA 3ABVA 4IE6A 4NXNT 4IDOA 2V7LA 4IDNA 2IMLA 1YD8G 4IE7A 4DV7T 3EDVA 2YK0A 2XZ6A 2KWIB 4CI2B 2V1DB 2M6IA 2DHRA 4JUYA 5JRCB 4IIJE 1LKXA 5FNVE 2XQ7A 5FXWA 3O9XA 4HTEA 4DV3T 4U72A 3SS1A 4EXTA 4HFBA 3OTOT 2C5KT 4I4TE 1BR0A 3MJXA 3N9MA 2ZM2A 3KVBA 4YTMA 4ISTA 4B3ST 1EZ3A 3ZDGA 3NZQA 3PUSA 3CQXC 4LF6T 1D1BA 5JR9C 3OYZA 4FJOA 3ZKRA 1MIYA 3RLFF 4UEMA 4AIUA 1SA0E 3KDSE 4JI1T 4X5TA 4QX8B 3DP7A 4DIDB 2WNCA 2MOZA 1E7PA 4QXCB 2WU5A 5AQNB 2YDSA 4H9PC 3IHRA 5JVDE 4I0UA 2JIWA 4BJNA 2D2SA 5FMNA 4UV9B 5KXJA 5JR9B 3LSVA 2L8KA 2LJLA 3SIOA 1XMOT 2WDQA 4UV8B 2BYNA 2MTQA 2WAUA 3EDUA 4O4IE 2C5JA 3ETUA 4ANJA 4LMKA 2H88A 1Z0PA 3JAEA 4AKGA 5IYZE 2UXDT 4P1NA 4QAAA 3I9YA 4HWCA 5HXCA 2WNJA 4IGUA 4U2ZA 2CE7A 2Y6XA 2VVSA 4OHFA 3OJAA 3ZYLA 4CXXA 1I94T 2KXPB 3H37A 5IHYA 3IBPA 3PTRB 1OEDA 4PJLA 2FJEA 4HFEA 2VQET 2BG9B 1BR2A 5LYJE 3ZDHA 4YT0A 1I6ZA 1NEKA 2IDOB 2KSRA 2X9YA 2E9XB 4IT4A 4WYVA 5H6RB 4IDZA 4EEDA 4JYAT 3CVRA 4QWNB 1HTJF 4A56A 4DBRA 3PEOA 3SQ9A 4PNIA 3UFEA 5C2TA 1BR4A 4HFIA 4H63V 4OFZA 3R84B 4HKAA 5JDMA 3CQCB 1QSDA 2K9AA 4AKLA 2XNTA 2WCAA 3P4PA 3A7MA 3MA9A 2E8IA 3WTIA 2WS3A 2W66A 4UXNB 5AQKB 2W67A 5J2TE 4KP3C 1HCIA 2LSGA 4AQFC 2K5BB 4JEUB 4X66T 1ZV4X 3RI5A 4PK5A 2XSAA 3TLSA 3WTNA 4U7YA 2WM9A 3BK9A 2EHOC 4TX5A 5FVKA 3EABA 2WDRA 1MMAA 5E0OA 3P8CD 2ZM8A 2D0UA 2WSSV 3RQUA 3SOLA 3SFEA 3U78A 1YKHB 5FY7A 1OEDB 4DV5T 4BJMA 5TAOA 3AXJB 5J5IA 5LA6E 2MYSA 5JDNA 3PU8A 4JI8T 4YLHA 4Q25A 2E9XA 3ZJ1A 3PJAA 2NW8A 3Q5EA 2Y56A 2ZJVA 4H9NC 2A3DA 1W9RA 1UW6A 4GOUA 3VHLA 5CA0E 3WTKA 5AFMB 3RH3A 4DUYT 5L3BB 4AQGA 3C4WA 3KINB 1YQ4A 3P7IA 3C84A 5BW2A 2IIUA 5ABFB 4LF4T 3ETVA 2F4VT 5JTGA 3FBLA 3U8NA 4OX9T 3VRAA 4ZOLE 2BJ0A 3KVAA 4X1KE 5ETWA 3RYHE 4G2AA 4FI5A 3PUGA 1MIVA 4AFHA 3FBZA 4WZXA 4TWFA 3ZC1A 4E7SA 4QH4A 2NW9A 3U8MA 5JMEA 2V7IA 2LRKA 5LXTE 1FJGT 4B3MT 4G63A 2Y8DA 2LKGA 3B57A 3TLTA 1E2AA 4ZEYA 4LMJA 4ZI3D 4YSXA 4EZHA 4CZZB 4UR9A 4JEHB 2E5LT 5J1GA 2EHOA 3UU3A 3U8LA 5LXBA 2BR7A 3PJAJ 1HX8A 3IGQA 3C51A 1Y01A 1N36T 2I59A 4IE5A 4U31A 2YOEA 4L0RA 1UURA 4E7ZA 1FMVA 1W09A 2W63A 4AKIA 2XASB 4P0AA 2BVLA 2Y48B 2YINA 5FY1A 3ZLIA 3WI3A 2J62A 1D0ZA 3H3AA 4WW0A 3CX8B 4YHHT 2N9DA 2DWKA 1HNWT 5LHIB 3N9NA 1R8IA 5ABFA 3QK6A 3RKGA 2QYWA 3P4SA 2XQAA 1VCSA 2A72A 3ZMZB 3ZT7A 4UXUA 5TVCA 2NOXA 4NPPA 4JI4T 1IAPA 4KMCA 1US7B 4PAGA 1HR0T 3UTKA 3JCFA 3GN5B 4H9QC 2KLQA 4O4HE 3R6NA 3ZJ2A 5JRCA 3LBXB 2BS2A 1WLXA 2JJ9A 2CWYA 4F8HA 4C90A 2W8FA 2FJDA 1T98A 2JRKA 2XAQB 2BBHA 2XAFB 4ILAA 4EIWA 2PBIA 5FL1A 3AA0B 4IL9A 2P9BA 4PJJA 2YN6A 2WBLA 2E9XD 3J7Yq 4YTPA 1CHUA 4UVCB 3RQWA 3PUWF 3FZHB 3CKDA 3NVOA 3DJBA 2D5UA 2J1DG 3PURA 3ANWA 2Q9QA 1YXRA 3NZPA 2J4GA 2KINB 2C0SA 3GA8A 2WU2A 1OEDE 2RA1A 3K3NA 5JR9A 4DV6T 4KHPT 2NTXA 5FKYA 5KMGP 3RF1A 4EZ4A 3ZCIA 3HL6A 4AI6A 3HA4A 2VL0A 3E22E 5AQMB 3MXZA 4HQPA 4CXYA 5DJQC 3NBXX 4ZK1A 4PW8A 2MAWA 2XQ4A 2X9HA 4IE0A 3T1HT 5AQPB 2ODVA 5LMNT 3SQ6A 2ZM6T 3ZYMA 2I6HA 3KV4A 4PJNA 5J5FA 3VR9A 3CQGB 2DNXA 3CX6B 4Z91A 2WWVA 3LBXA 5F8PA 5JH7E 1U5PA 4XBFB 3KFWX 5IWAT 4WV9A 2CM0A 4WNKA 2W0GA 2XZ5A 3MZKB 3K3OA 2QVAA 3VKGA 2E5VA 4DV0T 2C9TA 5L3FB 4LF7T 4AKRB 4IDPA 5FXVA 3S4UA 4EAHA 2BYRA 1XWMA 3L8RA 4YTNA 1I9BA 5LOVE 4B3TT 4ILUA 3C4ZA 5CFBA 3RC3A 3RX6A 1LRZA 5JDGA 2VK9A 5BP0A 4KI0F 4EYYR 3C50A 3AAIA 3WTMA 4MFRA 4PFOA 3PUQA 3L3PA 3QB5K 1VCTA 3MK7C 2RP4A 3MKDA 2LSKA 3I1AA 2LLYA 3P4RA 2XQ9A 3PMZA 3C64A 4GYSA 1AJ3A 2PJQA 1IZNB 2V5CA 3CK6A 2XQ6A 4MLKA 2XNUA 3QOFA 2W4XA 4DR3T 5A1LA 2X00A 1WR0A 4ZRUA 4XK9A 4IHJE 2MPKA 2B1EA 5GONE 3DTOA 2ZM0A 3HKDE 1E1HB 2PGZA 2X68A 2ACXA 3T4MA 2LOSA 3CIRA 5LJMA 4EYUA 2X51A 5FP3A 5EZYE 1HS7A 4A98A 1YW0A 3VKHA 2UUBT 4DV1T 1G8XA 3F2EA 3LG7A 4TZ4C 5ADXL 2CCQA 1ZHCA 2XYTA 5ABHA 4U3CA 4LFBT 2K24A 3E0ZA 4M1PA 2CRBA 2HN1A 2V5DA 4U7IA 4CQIA 3C4XA 4ZI2C 1UUSA 4DO0A 1ZP0A 4HWIB 2W00A 4GK0E 2KWHA 3RYIE 2XY8B 3VR8A 3CPZA 1WR6A 2LRLA 1GQEA 1MMNA 4HWHA 4H63H 3RRWA 4HGAA 3LK42 2JQKA 1HNZT 2A9UA 4Z8XA 2YMEA 2HPLA 2K3WA 3UU5A 4B6XA 2D9DA 4JI6T 3LJCA 2VURA 3I9WA 5HEJA 4HFVA 4U33A 1YKEB 2XM2A 5KDMC 4X64T 1OEDC 2XQ8A 4D01A 3ZSTA 1BR1A 2BG9A 2UXXB 3OPCA 2MBGA 2CHOA 2CLYC 2DL1A 2WY2A 3UUNA 4JI2T 3AEFA 2Y7YA 4BA9A 2ACZA 3Q2MA 4O4JE 3HI2A 4DUZT 3N2KE 3L39A 3UT5E 5JDQA 3D0TA 5LMUT 4NZBA 2ZLYA 1KF6A 2N1GA 4YSYA 5JREA 3AE4A 3WIPA 4HFDA 2JMHA 3BQIA 1MNDA 2WDVA 5LHGB 2VVNA 3FZFB 4LF8T 4OYKA 4QHOA 2WZYA 5AQVB 1M62A 5LBQB 3RYFE 2NR4A 1J5WA 4HWDA 3TLVA 2QC1B 4B5DA 5IUXA 4UY2A 3I0OA 4UF0A 5AQIB 5AQOB 4AQFA 2NTYA 2AXDS 2E2AA 2V7KA 5AINA 1SHZC 1KNPA 1XDOA 2BKOA 4LF5T 3BQKA 2WZHA 3UFGA 2HH7A 3FZMB 3EI0A 2XJ7A 2DLRA 5AFHA 4NUUA 2QRXA 3ONLC 2UUAT 5DQVA 4UM3P 2IUBA 4TUYE 1CUNA 3T1YT 2VASA 4WBOA 4HWFA 4EOZB 2CXLA 4QH1A 2VL8A 4LMLA 3E08A 2BDEA 4PK6A 5AQTB 5ABEA 5F5WA 2CA5A 2YU2A 4YXDA 4U2YA 2J47A 4ADZA 3HKBE 1WYCA 1S94A 2XUEA 3OVUA 5L3GB 2L3LA 2WMNA 2X9WA 3WTHA 3ZN1B 4ZI7E 3RPUA 3RGLA 2K48A 5SYOA 4ISSA 5JQGE 1UV6A 3ZEFB 5LBMA 2YU1A 1IBKT 1N33T 5J2UE 5AFMA 1D1AA 2CBIA 3PV0F 4UELA 2VKDA 3F31A 3I0QA 3OYXA 4UM1A 2KMFA 3B5MA 3N2GE 4KBMB 2QGSA 2CHNA 2B76A 2JMKA 2Q9QB 2X0YA 2KNDA 4NXMT 1N34T 4EV6A 4DBQA 1IBLT 3AAAB 2Z6EA 2KT9A 5AQRB 4TV9E 3WAKA 3RHWA 4EGWA 1ZOYA 5DABA 2X0HA 1D0XA 4KHZF 5H6QB 3ZMTB 1Z8UA 2XM1A 1HG5A 3AE8A 4TNWA 5ABGA 5AFJA 3J9X1 2X00D 4GIWA 3VU7H 4J2CA 3VRBA 2BVMA 2YMDA 2OV9A 4DR4T 1QLBA 4OYJA 3H3MA 3NKZA 5F3JA 5CJ5A 3GUAA 4GKKT 2OA5A 3HKCE 2XNVA 4YJ2E 2UZ6A 1IJ6A 3AXJA 1T8BA 4PJMA 5LGTB 1OXZA 1SUMB 4PFPA 3NRXA 4KX6A 4JI0T 5LJNA 2YEVC 4LFCT 3N2OA 1NWMX 5L4HA 3PUZF 5CB4E 2IC6A 2H7VC 5FVLA 3ZCJA 3ZPOA 2UU9T 4KUMB 2EHOD 2ZJUA 1IBMT 4AXPA 4ZHQE 3AE5A 2LSIA 3AE1A 4JBWF 4TV8E 3ZSSA 4ZZCA 2BG9C 3X1DA 5L2LA 1VOMA 4XAXB 5HEGA 5LG3A 1XNQT 3AEEA 2D0TA 3U8JA 2GK9A 5KX5E 5HWYA 4UM3S 3AE7A 5BR8T 5HAXA 3GN5A 2SPCA 2HHHT 3ZMUB 3JAFA 1J5ET 1JNZA 2V6YB 5CGMA 3UUXB 4QXBB 5AQHB 4I55E 5J5GA 4OK0A 3WAJA 3LK3B 2NWBA 2W8GA 1W0BA 3PUXF 3AEBA 3PE0A 3MACA 4MHCA 1UX5A 3K8PC 3ZYKA 3N5LA 4DMWA 4ZJTA 3OKQA 3SRZA 2IC9A 5AQQB 2CWOA 2XTLA 5LHHB 2IHR1 1FMWA 4HEAA 3AECA 3V5SA 4TWHA 2H89A 5AQUB 5C8YE 4O4LE 5LGNB 4ZI3C 3RIUA 2BR8A 3SH1A 3JADA 3QC9A 1JNRA 3ANWB 3EVYA 3KBUA 5CA1E 4QACA 3Q5XA 4UIGA 3AA6B 2IAKA 5DQWA 2W2UA 2XSBA 4DR2T 3ESLA 5HWXA 1L0VA 4ALXA 1UK5A 2CXFA 5J0ZA 1UCUA 2BYSA 1M7KA 4F6RC 4JI5T 5LP6E 2L9QA 3KBTA 3EAMA 2CXDA 5LCYA 4XHEA 3PUAA 3LDQB 4CN1A 3NRYA 2YDQA 5JDFA 1HX1B 4GYRA 5L3CB 2DWGA 4I50E 3PDYA 3B13A 3AE6A 5LB7B 3U3IA 4YY3T 1DU2A 5BMVE 3M3ZB 2CLYB 1FEWA 4BFQA 2WWUA 1VRBA 3UUMA 4IREA 2VKOA 4CN6A 5L4EA 2LOPA 1KNZA 2LKHA 3AB3B 4P09A 3M65A 3N9LA 5EK4A 3RYCE 5HXHA 2Q9QC 4AQYT 4X20E 1WYBA 2A2FX 3P4WA 2XYSA 2N2NA 1D0YA 1HF8A 2FBWA 3RRCA 3O1JA 2XAHB 1MMDA 5FL0A 3Q9DA 4IDQA 4JV5T 3ZT6A 4DMVA 5HXRA 2M67A 3ZMVB 3FZLB 2LE8A 5EK2A 3Q5DA 1J1JA 3UQ7A 5AFKA 1O3XA 4ASKA 2JPFA 1WFDA 4QABA 2PH9A 5FJVA 1G73A 3FXEB 2Y58A 5AQJB 1KK7A 3OBVE 2RPAA 2VKJA 3G06A 5AFNA 1UX4A 3IA3A 3AVRA 2VWAA 2LM9A 5JDLA 4DNDA 3EUHA 1XZYA 5FXZA 4JLEA 5HEUA 4N78D 3UU4A 2UUCT 2M6BA 4DR7T 4JI3T 2X67A 1W0AA 4ZXLA 2WP9A 1S35A 5HYAA 2V26A 4EZ1A 1H7CA 1X9BA 3AE2A 3UUBA 2XPKA 4PIRA 1HG2A 4AFGA 4H9OC 5LGUB 2E9XC 4NIQA 2JQHA 4CN4A 2C5IT 1X79A 4MBQA 2XQYA 2H3RA 2Q9QD 4X62T 4GK5E 2XAJB 2JQ9A 4IL4A 2Y54A 4ZZBA 1MMGA 2UXNB
chains in the Genus database with same CATH topology
5CO5A 5AINA 4QH5A 2WN9A 3LSVA 1OEDE 4ZZCA 3SIOA 2WNLA 3U8NA 4TNVA 2BG9C 4ALXA 3UU8A 5AFLA 2BYNA 3EI0A 5KZUA 5HEGA 2YMEA 3RHWA 5LG3A 3UQ7A 4FRRA 5J0ZA 4LMKA 2LLYA 2XQAA 2BJ0A 2BYSA 3RI5A 5AFHA 5AFKA 4UXUA 3UU5A 2XQ9A 2VL0A 3TLSA 3PMZA 3EAMA 5KE4A 3JAEA 3WTNA 5TVCA 4HQPA 2LM2A 3U8JA 4NPPA 2PH9A 4QABA 5FJVA 4TWDA 4XHEA 3TLWA 3EHZA 2XQ6A 2Y58A 4QAAA 4TNWA 5HEJA 2XNUA 2WNJA 4UM3P 4UM3S 4AFHA 4ZK1A 5AFJA 2MAWA 5AFNA 2XQ4A 2X00D 3WTLA 4TWFA 2XZ6A 3SQ6A 4QH4A 2M6IA 3U8MA 3JAFA 5JMEA 2X00A 1OEDC 4ZRUA 4XK9A 4A97A 3RQUA 2YMDA 4QH1A 1OEDA 3WTJA 2XQ8A 4D01A 4LMLA 5HEUA 4ILCA 2BG9A 2XQ7A 4AFTA 5J5GA 3UU4A 1OEDB 2LKGA 4HFEA 2M6BA 2PGZA 2W8GA 4HFCA 5J5FA 3TLTA 2BG9B 4F8HA 2W8FA 3GUAA 4Z91A 3T4MA 4ZJSA 4LMJA 4HFBA 2XNVA 2YKSA 3ZDHA 5J5IA 2UZ6A 4BFQA 4ZK4A 4ILAA 4DBMA 4A98A 4WV9A 2Y7YA 3RIFA 2BG9E 4ZJTA 4EZ1A 4IL9A 5HEHA 2KSRA 3UU6A 2YN6A 3U8KA 3WTHA 4ZR6A 2BYPA 5HEOA 3UUBA 2XZ5A 3UU3A 3ZDGA 4IREA 2XYTA 4ILBA 4PIRA 5L4EA 3U8LA 3TLUA 4COFA 4NZBA 4AFGA 5LXBA 2BR7A 5SYOA 1UV6A 2C9TA 3UQ4A 3WIPA 2LKHA 4HFDA 2Y56A 3IGQA 2ZJVA 5J5HA 2BYRA 5L4HA 4TWHA 3RQWA 3ZKRA 4BQTA 2YOEA 1UW6A 5AFMA 3RIAA 3PEOA 3SQ9A 3P50A 3WTOA 2BR8A 5HCJA 4X5TA 1UX2A 3WTKA 5AFMB 4HFIA 3P4WA 1I9BA 2WZYA 5L47A 5BRXA 4IL4A 3SH1A 3JADA 2WNCA 4Z90A 2XYSA 2Y54A 2Y57A 4UM3A 2BYQA 3C79A 4QACA 2XQ3A 5HCMA 4ZZBA 4UM1A 2ZJUA 5CFBA 2XNTA 2QC1B 3TLVA 4B5DA 4HFHA 5IUXA 3WTIA 2XQ5A 3C84A 4UY2A 5BP0A 5BW2A 3WTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CO5 A;  5AIN A;  4QH5 A;  2WN9 A;  3LSV A;  1OED E;  4ZZC A;  3SIO A;  2WNL A;  3U8N A;  4TNV A;  2BG9 C;  4ALX A;  3UU8 A;  5AFL A;  2BYN A;  3EI0 A;  5KZU A;  5HEG A;  2YME A;  3RHW A;  5LG3 A;  3UQ7 A;  4FRR A;  5J0Z A;  4LMK A;  2LLY A;  2XQA A;  2BJ0 A;  2BYS A;  3RI5 A;  5AFH A;  5AFK A;  4UXU A;  3UU5 A;  2XQ9 A;  2VL0 A;  3TLS A;  3PMZ A;  3EAM A;  5KE4 A;  3JAE A;  3WTN A;  5TVC A;  4HQP A;  2LM2 A;  3U8J A;  4NPP A;  2PH9 A;  4QAB A;  5FJV A;  4TWD A;  4XHE A;  3TLW A;  3EHZ A;  2XQ6 A;  2Y58 A;  4QAA A;  4TNW A;  5HEJ A;  2XNU A;  2WNJ A;  4UM3 P;  4UM3 S;  4AFH A;  4ZK1 A;  5AFJ A;  2MAW A;  5AFN A;  2XQ4 A;  2X00 D;  3WTL A;  4TWF A;  2XZ6 A;  3SQ6 A;  4QH4 A;  2M6I A;  3U8M A;  3JAF A;  5JME A;  2X00 A;  1OED C;  4ZRU A;  4XK9 A;  4A97 A;  3RQU A;  2YMD A;  4QH1 A;  1OED A;  3WTJ A;  2XQ8 A;  4D01 A;  4LML A;  5HEU A;  4ILC A;  2BG9 A;  2XQ7 A;  4AFT A;  5J5G A;  3UU4 A;  1OED B;  2LKG A;  4HFE A;  2M6B A;  2PGZ A;  2W8G A;  4HFC A;  5J5F A;  3TLT A;  2BG9 B;  4F8H A;  2W8F A;  3GUA A;  4Z91 A;  3T4M A;  4ZJS A;  4LMJ A;  4HFB A;  2XNV A;  2YKS A;  3ZDH A;  5J5I A;  2UZ6 A;  4BFQ A;  4ZK4 A;  4ILA A;  4DBM A;  4A98 A;  4WV9 A;  2Y7Y A;  3RIF A;  2BG9 E;  4ZJT A;  4EZ1 A;  4IL9 A;  5HEH A;  2KSR A;  3UU6 A;  2YN6 A;  3U8K A;  3WTH A;  4ZR6 A;  2BYP A;  5HEO A;  3UUB A;  2XZ5 A;  3UU3 A;  3ZDG A;  4IRE A;  2XYT A;  4ILB A;  4PIR A;  5L4E A;  3U8L A;  3TLU A;  4COF A;  4NZB A;  4AFG A;  5LXB A;  2BR7 A;  5SYO A;  1UV6 A;  2C9T A;  3UQ4 A;  3WIP A;  2LKH A;  4HFD A;  2Y56 A;  3IGQ A;  2ZJV A;  5J5H A;  2BYR A;  5L4H A;  4TWH A;  3RQW A;  3ZKR A;  4BQT A;  2YOE A;  1UW6 A;  5AFM A;  3RIA A;  3PEO A;  3SQ9 A;  3P50 A;  3WTO A;  2BR8 A;  5HCJ A;  4X5T A;  1UX2 A;  3WTK A;  5AFM B;  4HFI A;  3P4W A;  1I9B A;  2WZY A;  5L47 A;  5BRX A;  4IL4 A;  3SH1 A;  3JAD A;  2WNC A;  4Z90 A;  2XYS A;  2Y54 A;  2Y57 A;  4UM3 A;  2BYQ A;  3C79 A;  4QAC A;  2XQ3 A;  5HCM A;  4ZZB A;  4UM1 A;  2ZJU A;  5CFB A;  2XNT A;  2QC1 B;  3TLV A;  4B5D A;  4HFH A;  5IUX A;  3WTI A;  2XQ5 A;  3C84 A;  4UY2 A;  5BP0 A;  5BW2 A;  3WTM A; 
#chains in the Genus database with same CATH topology
 1MNE A;  4QKN A;  5JDH A;  4YSZ A;  3QB5 A;  4ZS3 A;  2JQQ A;  2ES0 A;  4QX7 B;  4DR5 T;  3SWH A;  1ZEE A;  4LFA T;  4GKJ T;  3LK2 B;  3PUY F;  2ZMA A;  3N9P A;  4TWD A;  3TLW A;  1OWA A;  3V5U A;  2R6G F;  3ONX A;  3JC6 D;  3AAE B;  3AE3 A;  2WB5 A;  2BKP A;  2I0M A;  1V9D A;  2NP9 A;  2WQY A;  3FXD B;  4UVB B;  4ILC A;  4AFT A;  2V7M A;  4HFC A;  1QUU A;  1U4Q A;  2W61 A;  2KZ7 B;  4K0K T;  4NUV A;  2UXC T;  2V7J A;  2BS4 A;  3BQL A;  3RIF A;  2AE9 A;  4A5X A;  4BAY B;  5HEH A;  4YFS A;  5AQF B;  3QNU A;  5HEO A;  2YDR A;  4ILB A;  3TLU A;  2EHO B;  2VB6 A;  4DVD A;  3ZC0 A;  3AVS A;  2XZE A;  3FHN A;  4C91 A;  1KFY A;  4BQT A;  2LHN A;  1N32 T;  3RIA A;  3SFD A;  4X1I E;  5M4Y A;  1Y64 B;  5L47 A;  2UXB T;  3FZK B;  4Z90 A;  4UM3 A;  2BYQ A;  3IF8 B;  2G0U A;  4JI7 T;  1FIO A;  3HKE E;  4PK4 A;  3QUJ A;  4DR6 T;  2FUP A;  4X65 T;  4QH5 A;  2WN9 A;  5FY0 A;  3RC8 A;  4TNV A;  2BBJ A;  5AQG B;  3KV6 A;  5KZU A;  3ZMS B;  2X9X A;  4DR1 T;  2VKH A;  2LHR A;  2PTF A;  4UVA B;  2LT3 A;  5KE4 A;  4K0U A;  2LM2 A;  2XAG B;  1ZKE A;  2V6X A;  3EHZ A;  1YQ3 A;  4H9S E;  3WTL A;  2NW7 A;  2QA7 A;  5FXX A;  2X0L B;  1XDP A;  2PFV A;  4A97 A;  3O1I A;  3O1H A;  3PU3 A;  5AQL B;  2CEA A;  2PG8 A;  2V6Y A;  4IE4 A;  4I43 B;  2VQF T;  4L5G A;  3A8Y C;  4ZJS A;  1XMQ T;  3A5X A;  2BG9 E;  3K1S A;  1T7S A;  4XZC A;  2BS3 A;  3U8K A;  4ERR A;  1NEN A;  5L3E B;  3AEA A;  4ZR6 A;  5HXE A;  2LSJ A;  3ZT5 A;  2DI4 A;  4COF A;  5C3J A;  3AED A;  4O2B E;  3UQ4 A;  2DCF A;  5J5H A;  4L9I A;  4ZI2 D;  3FB2 A;  3HR0 A;  3KV9 A;  1UGO A;  2FJB A;  3WTO A;  1IJ5 A;  5HCJ A;  5BRX A;  4ZS2 A;  3O4X E;  5AQS B;  1T72 A;  2HN2 A;  3KV5 A;  4U74 A;  5FYM A;  3GWH A;  3IEE A;  4HFH A;  2XQ5 A;  3CX7 B;  2IW5 B;  1KNR A;  4EEB A;  4X1Y E;  3TKL B;  1HNX T;  4MAL A;  4UF0 B;  4HN9 A;  4H9R C;  4QXH B;  3UUL A;  2OLT A;  3UU8 A;  1HFA A;  5AFL A;  4EB6 E;  5HXS A;  4O8S A;  1XNR T;  4FRR A;  3Q5W A;  2CPT A;  4O2A E;  2WZI A;  2ODU A;  1KEY A;  4V1A v;  3CWZ B;  3W15 B;  1WCR A;  3AA1 B;  4DV4 T;  1B7T A;  2CBJ A;  2LEH A;  3GMI A;  3LFM A;  3WTJ A;  3RIU C;  2BKN A;  5EK3 A;  3AE9 A;  3RKO A;  3CML A;  1SE7 A;  3NWI A;  2YKS A;  5L3D B;  4DV2 T;  4ZK4 A;  4DBM A;  2BZB A;  1LVF A;  3K3Q C;  3UU6 A;  2CMR A;  1NAF A;  2X66 A;  2WMO A;  3ZN0 B;  2BYP A;  3C98 B;  5LNK A;  1WRD A;  2W62 A;  1D1C A;  4AIS A;  2XHE B;  4CI3 B;  3L09 A;  3PUV F;  5LG4 A;  1LVK A;  3F57 A;  3P50 A;  2LSY A;  4B3R T;  1UX2 A;  3N9Q A;  2H7O A;  2Y57 A;  3C79 A;  2XQ3 A;  5HCM A;  4HE8 A;  3JC6 C;  4LF9 T;  4WBN E;  4AKH A;  4CI1 B;  3ONJ A;  3T8O A;  3N9O A;  4YHJ A;  5CO5 A;  4P0B A;  2FJA A;  4YJ3 E;  3AEG A;  2WNL A;  4CXW A;  2V8S V;  3AA7 B;  2HPJ A;  4TN7 B;  5AFU L;  3P4Q A;  1MIW A;  3ABV A;  4IE6 A;  4NXN T;  4IDO A;  2V7L A;  4IDN A;  2IML A;  1YD8 G;  4IE7 A;  4DV7 T;  3EDV A;  2YK0 A;  2XZ6 A;  2KWI B;  4CI2 B;  2V1D B;  2M6I A;  2DHR A;  4JUY A;  5JRC B;  4IIJ E;  1LKX A;  5FNV E;  2XQ7 A;  5FXW A;  3O9X A;  4HTE A;  4DV3 T;  4U72 A;  3SS1 A;  4EXT A;  4HFB A;  3OTO T;  2C5K T;  4I4T E;  1BR0 A;  3MJX A;  3N9M A;  2ZM2 A;  3KVB A;  4YTM A;  4IST A;  4B3S T;  1EZ3 A;  3ZDG A;  3NZQ A;  3PUS A;  3CQX C;  4LF6 T;  1D1B A;  5JR9 C;  3OYZ A;  4FJO A;  3ZKR A;  1MIY A;  3RLF F;  4UEM A;  4AIU A;  1SA0 E;  3KDS E;  4JI1 T;  4X5T A;  4QX8 B;  3DP7 A;  4DID B;  2WNC A;  2MOZ A;  1E7P A;  4QXC B;  2WU5 A;  5AQN B;  2YDS A;  4H9P C;  3IHR A;  5JVD E;  4I0U A;  2JIW A;  4BJN A;  2D2S A;  5FMN A;  4UV9 B;  5KXJ A;  5JR9 B;  3LSV A;  2L8K A;  2LJL A;  3SIO A;  1XMO T;  2WDQ A;  4UV8 B;  2BYN A;  2MTQ A;  2WAU A;  3EDU A;  4O4I E;  2C5J A;  3ETU A;  4ANJ A;  4LMK A;  2H88 A;  1Z0P A;  3JAE A;  4AKG A;  5IYZ E;  2UXD T;  4P1N A;  4QAA A;  3I9Y A;  4HWC A;  5HXC A;  2WNJ A;  4IGU A;  4U2Z A;  2CE7 A;  2Y6X A;  2VVS A;  4OHF A;  3OJA A;  3ZYL A;  4CXX A;  1I94 T;  2KXP B;  3H37 A;  5IHY A;  3IBP A;  3PTR B;  1OED A;  4PJL A;  2FJE A;  4HFE A;  2VQE T;  2BG9 B;  1BR2 A;  5LYJ E;  3ZDH A;  4YT0 A;  1I6Z A;  1NEK A;  2IDO B;  2KSR A;  2X9Y A;  2E9X B;  4IT4 A;  4WYV A;  5H6R B;  4IDZ A;  4EED A;  4JYA T;  3CVR A;  4QWN B;  1HTJ F;  4A56 A;  4DBR A;  3PEO A;  3SQ9 A;  4PNI A;  3UFE A;  5C2T A;  1BR4 A;  4HFI A;  4H63 V;  4OFZ A;  3R84 B;  4HKA A;  5JDM A;  3CQC B;  1QSD A;  2K9A A;  4AKL A;  2XNT A;  2WCA A;  3P4P A;  3A7M A;  3MA9 A;  2E8I A;  3WTI A;  2WS3 A;  2W66 A;  4UXN B;  5AQK B;  2W67 A;  5J2T E;  4KP3 C;  1HCI A;  2LSG A;  4AQF C;  2K5B B;  4JEU B;  4X66 T;  1ZV4 X;  3RI5 A;  4PK5 A;  2XSA A;  3TLS A;  3WTN A;  4U7Y A;  2WM9 A;  3BK9 A;  2EHO C;  4TX5 A;  5FVK A;  3EAB A;  2WDR A;  1MMA A;  5E0O A;  3P8C D;  2ZM8 A;  2D0U A;  2WSS V;  3RQU A;  3SOL A;  3SFE A;  3U78 A;  1YKH B;  5FY7 A;  1OED B;  4DV5 T;  4BJM A;  5TAO A;  3AXJ B;  5J5I A;  5LA6 E;  2MYS A;  5JDN A;  3PU8 A;  4JI8 T;  4YLH A;  4Q25 A;  2E9X A;  3ZJ1 A;  3PJA A;  2NW8 A;  3Q5E A;  2Y56 A;  2ZJV A;  4H9N C;  2A3D A;  1W9R A;  1UW6 A;  4GOU A;  3VHL A;  5CA0 E;  3WTK A;  5AFM B;  3RH3 A;  4DUY T;  5L3B B;  4AQG A;  3C4W A;  3KIN B;  1YQ4 A;  3P7I A;  3C84 A;  5BW2 A;  2IIU A;  5ABF B;  4LF4 T;  3ETV A;  2F4V T;  5JTG A;  3FBL A;  3U8N A;  4OX9 T;  3VRA A;  4ZOL E;  2BJ0 A;  3KVA A;  4X1K E;  5ETW A;  3RYH E;  4G2A A;  4FI5 A;  3PUG A;  1MIV A;  4AFH A;  3FBZ A;  4WZX A;  4TWF A;  3ZC1 A;  4E7S A;  4QH4 A;  2NW9 A;  3U8M A;  5JME A;  2V7I A;  2LRK A;  5LXT E;  1FJG T;  4B3M T;  4G63 A;  2Y8D A;  2LKG A;  3B57 A;  3TLT A;  1E2A A;  4ZEY A;  4LMJ A;  4ZI3 D;  4YSX A;  4EZH A;  4CZZ B;  4UR9 A;  4JEH B;  2E5L T;  5J1G A;  2EHO A;  3UU3 A;  3U8L A;  5LXB A;  2BR7 A;  3PJA J;  1HX8 A;  3IGQ A;  3C51 A;  1Y01 A;  1N36 T;  2I59 A;  4IE5 A;  4U31 A;  2YOE A;  4L0R A;  1UUR A;  4E7Z A;  1FMV A;  1W09 A;  2W63 A;  4AKI A;  2XAS B;  4P0A A;  2BVL A;  2Y48 B;  2YIN A;  5FY1 A;  3ZLI A;  3WI3 A;  2J62 A;  1D0Z A;  3H3A A;  4WW0 A;  3CX8 B;  4YHH T;  2N9D A;  2DWK A;  1HNW T;  5LHI B;  3N9N A;  1R8I A;  5ABF A;  3QK6 A;  3RKG A;  2QYW A;  3P4S A;  2XQA A;  1VCS A;  2A72 A;  3ZMZ B;  3ZT7 A;  4UXU A;  5TVC A;  2NOX A;  4NPP A;  4JI4 T;  1IAP A;  4KMC A;  1US7 B;  4PAG A;  1HR0 T;  3UTK A;  3JCF A;  3GN5 B;  4H9Q C;  2KLQ A;  4O4H E;  3R6N A;  3ZJ2 A;  5JRC A;  3LBX B;  2BS2 A;  1WLX A;  2JJ9 A;  2CWY A;  4F8H A;  4C90 A;  2W8F A;  2FJD A;  1T98 A;  2JRK A;  2XAQ B;  2BBH A;  2XAF B;  4ILA A;  4EIW A;  2PBI A;  5FL1 A;  3AA0 B;  4IL9 A;  2P9B A;  4PJJ A;  2YN6 A;  2WBL A;  2E9X D;  3J7Y q;  4YTP A;  1CHU A;  4UVC B;  3RQW A;  3PUW F;  3FZH B;  3CKD A;  3NVO A;  3DJB A;  2D5U A;  2J1D G;  3PUR A;  3ANW A;  2Q9Q A;  1YXR A;  3NZP A;  2J4G A;  2KIN B;  2C0S A;  3GA8 A;  2WU2 A;  1OED E;  2RA1 A;  3K3N A;  5JR9 A;  4DV6 T;  4KHP T;  2NTX A;  5FKY A;  5KMG P;  3RF1 A;  4EZ4 A;  3ZCI A;  3HL6 A;  4AI6 A;  3HA4 A;  2VL0 A;  3E22 E;  5AQM B;  3MXZ A;  4HQP A;  4CXY A;  5DJQ C;  3NBX X;  4ZK1 A;  4PW8 A;  2MAW A;  2XQ4 A;  2X9H A;  4IE0 A;  3T1H T;  5AQP B;  2ODV A;  5LMN T;  3SQ6 A;  2ZM6 T;  3ZYM A;  2I6H A;  3KV4 A;  4PJN A;  5J5F A;  3VR9 A;  3CQG B;  2DNX A;  3CX6 B;  4Z91 A;  2WWV A;  3LBX A;  5F8P A;  5JH7 E;  1U5P A;  4XBF B;  3KFW X;  5IWA T;  4WV9 A;  2CM0 A;  4WNK A;  2W0G A;  2XZ5 A;  3MZK B;  3K3O A;  2QVA A;  3VKG A;  2E5V A;  4DV0 T;  2C9T A;  5L3F B;  4LF7 T;  4AKR B;  4IDP A;  5FXV A;  3S4U A;  4EAH A;  2BYR A;  1XWM A;  3L8R A;  4YTN A;  1I9B A;  5LOV E;  4B3T T;  4ILU A;  3C4Z A;  5CFB A;  3RC3 A;  3RX6 A;  1LRZ A;  5JDG A;  2VK9 A;  5BP0 A;  4KI0 F;  4EYY R;  3C50 A;  3AAI A;  3WTM A;  4MFR A;  4PFO A;  3PUQ A;  3L3P A;  3QB5 K;  1VCT A;  3MK7 C;  2RP4 A;  3MKD A;  2LSK A;  3I1A A;  2LLY A;  3P4R A;  2XQ9 A;  3PMZ A;  3C64 A;  4GYS A;  1AJ3 A;  2PJQ A;  1IZN B;  2V5C A;  3CK6 A;  2XQ6 A;  4MLK A;  2XNU A;  3QOF A;  2W4X A;  4DR3 T;  5A1L A;  2X00 A;  1WR0 A;  4ZRU A;  4XK9 A;  4IHJ E;  2MPK A;  2B1E A;  5GON E;  3DTO A;  2ZM0 A;  3HKD E;  1E1H B;  2PGZ A;  2X68 A;  2ACX A;  3T4M A;  2LOS A;  3CIR A;  5LJM A;  4EYU A;  2X51 A;  5FP3 A;  5EZY E;  1HS7 A;  4A98 A;  1YW0 A;  3VKH A;  2UUB T;  4DV1 T;  1G8X A;  3F2E A;  3LG7 A;  4TZ4 C;  5ADX L;  2CCQ A;  1ZHC A;  2XYT A;  5ABH A;  4U3C A;  4LFB T;  2K24 A;  3E0Z A;  4M1P A;  2CRB A;  2HN1 A;  2V5D A;  4U7I A;  4CQI A;  3C4X A;  4ZI2 C;  1UUS A;  4DO0 A;  1ZP0 A;  4HWI B;  2W00 A;  4GK0 E;  2KWH A;  3RYI E;  2XY8 B;  3VR8 A;  3CPZ A;  1WR6 A;  2LRL A;  1GQE A;  1MMN A;  4HWH A;  4H63 H;  3RRW A;  4HGA A;  3LK4 2;  2JQK A;  1HNZ T;  2A9U A;  4Z8X A;  2YME A;  2HPL A;  2K3W A;  3UU5 A;  4B6X A;  2D9D A;  4JI6 T;  3LJC A;  2VUR A;  3I9W A;  5HEJ A;  4HFV A;  4U33 A;  1YKE B;  2XM2 A;  5KDM C;  4X64 T;  1OED C;  2XQ8 A;  4D01 A;  3ZST A;  1BR1 A;  2BG9 A;  2UXX B;  3OPC A;  2MBG A;  2CHO A;  2CLY C;  2DL1 A;  2WY2 A;  3UUN A;  4JI2 T;  3AEF A;  2Y7Y A;  4BA9 A;  2ACZ A;  3Q2M A;  4O4J E;  3HI2 A;  4DUZ T;  3N2K E;  3L39 A;  3UT5 E;  5JDQ A;  3D0T A;  5LMU T;  4NZB A;  2ZLY A;  1KF6 A;  2N1G A;  4YSY A;  5JRE A;  3AE4 A;  3WIP A;  4HFD A;  2JMH A;  3BQI A;  1MND A;  2WDV A;  5LHG B;  2VVN A;  3FZF B;  4LF8 T;  4OYK A;  4QHO A;  2WZY A;  5AQV B;  1M62 A;  5LBQ B;  3RYF E;  2NR4 A;  1J5W A;  4HWD A;  3TLV A;  2QC1 B;  4B5D A;  5IUX A;  4UY2 A;  3I0O A;  4UF0 A;  5AQI B;  5AQO B;  4AQF A;  2NTY A;  2AXD S;  2E2A A;  2V7K A;  5AIN A;  1SHZ C;  1KNP A;  1XDO A;  2BKO A;  4LF5 T;  3BQK A;  2WZH A;  3UFG A;  2HH7 A;  3FZM B;  3EI0 A;  2XJ7 A;  2DLR A;  5AFH A;  4NUU A;  2QRX A;  3ONL C;  2UUA T;  5DQV A;  4UM3 P;  2IUB A;  4TUY E;  1CUN A;  3T1Y T;  2VAS A;  4WBO A;  4HWF A;  4EOZ B;  2CXL A;  4QH1 A;  2VL8 A;  4LML A;  3E08 A;  2BDE A;  4PK6 A;  5AQT B;  5ABE A;  5F5W A;  2CA5 A;  2YU2 A;  4YXD A;  4U2Y A;  2J47 A;  4ADZ A;  3HKB E;  1WYC A;  1S94 A;  2XUE A;  3OVU A;  5L3G B;  2L3L A;  2WMN A;  2X9W A;  3WTH A;  3ZN1 B;  4ZI7 E;  3RPU A;  3RGL A;  2K48 A;  5SYO A;  4ISS A;  5JQG E;  1UV6 A;  3ZEF B;  5LBM A;  2YU1 A;  1IBK T;  1N33 T;  5J2U E;  5AFM A;  1D1A A;  2CBI A;  3PV0 F;  4UEL A;  2VKD A;  3F31 A;  3I0Q A;  3OYX A;  4UM1 A;  2KMF A;  3B5M A;  3N2G E;  4KBM B;  2QGS A;  2CHN A;  2B76 A;  2JMK A;  2Q9Q B;  2X0Y A;  2KND A;  4NXM T;  1N34 T;  4EV6 A;  4DBQ A;  1IBL T;  3AAA B;  2Z6E A;  2KT9 A;  5AQR B;  4TV9 E;  3WAK A;  3RHW A;  4EGW A;  1ZOY A;  5DAB A;  2X0H A;  1D0X A;  4KHZ F;  5H6Q B;  3ZMT B;  1Z8U A;  2XM1 A;  1HG5 A;  3AE8 A;  4TNW A;  5ABG A;  5AFJ A;  3J9X 1;  2X00 D;  4GIW A;  3VU7 H;  4J2C A;  3VRB A;  2BVM A;  2YMD A;  2OV9 A;  4DR4 T;  1QLB A;  4OYJ A;  3H3M A;  3NKZ A;  5F3J A;  5CJ5 A;  3GUA A;  4GKK T;  2OA5 A;  3HKC E;  2XNV A;  4YJ2 E;  2UZ6 A;  1IJ6 A;  3AXJ A;  1T8B A;  4PJM A;  5LGT B;  1OXZ A;  1SUM B;  4PFP A;  3NRX A;  4KX6 A;  4JI0 T;  5LJN A;  2YEV C;  4LFC T;  3N2O A;  1NWM X;  5L4H A;  3PUZ F;  5CB4 E;  2IC6 A;  2H7V C;  5FVL A;  3ZCJ A;  3ZPO A;  2UU9 T;  4KUM B;  2EHO D;  2ZJU A;  1IBM T;  4AXP A;  4ZHQ E;  3AE5 A;  2LSI A;  3AE1 A;  4JBW F;  4TV8 E;  3ZSS A;  4ZZC A;  2BG9 C;  3X1D A;  5L2L A;  1VOM A;  4XAX B;  5HEG A;  5LG3 A;  1XNQ T;  3AEE A;  2D0T A;  3U8J A;  2GK9 A;  5KX5 E;  5HWY A;  4UM3 S;  3AE7 A;  5BR8 T;  5HAX A;  3GN5 A;  2SPC A;  2HHH T;  3ZMU B;  3JAF A;  1J5E T;  1JNZ A;  2V6Y B;  5CGM A;  3UUX B;  4QXB B;  5AQH B;  4I55 E;  5J5G A;  4OK0 A;  3WAJ A;  3LK3 B;  2NWB A;  2W8G A;  1W0B A;  3PUX F;  3AEB A;  3PE0 A;  3MAC A;  4MHC A;  1UX5 A;  3K8P C;  3ZYK A;  3N5L A;  4DMW A;  4ZJT A;  3OKQ A;  3SRZ A;  2IC9 A;  5AQQ B;  2CWO A;  2XTL A;  5LHH B;  2IHR 1;  1FMW A;  4HEA A;  3AEC A;  3V5S A;  4TWH A;  2H89 A;  5AQU B;  5C8Y E;  4O4L E;  5LGN B;  4ZI3 C;  3RIU A;  2BR8 A;  3SH1 A;  3JAD A;  3QC9 A;  1JNR A;  3ANW B;  3EVY A;  3KBU A;  5CA1 E;  4QAC A;  3Q5X A;  4UIG A;  3AA6 B;  2IAK A;  5DQW A;  2W2U A;  2XSB A;  4DR2 T;  3ESL A;  5HWX A;  1L0V A;  4ALX A;  1UK5 A;  2CXF A;  5J0Z A;  1UCU A;  2BYS A;  1M7K A;  4F6R C;  4JI5 T;  5LP6 E;  2L9Q A;  3KBT A;  3EAM A;  2CXD A;  5LCY A;  4XHE A;  3PUA A;  3LDQ B;  4CN1 A;  3NRY A;  2YDQ A;  5JDF A;  1HX1 B;  4GYR A;  5L3C B;  2DWG A;  4I50 E;  3PDY A;  3B13 A;  3AE6 A;  5LB7 B;  3U3I A;  4YY3 T;  1DU2 A;  5BMV E;  3M3Z B;  2CLY B;  1FEW A;  4BFQ A;  2WWU A;  1VRB A;  3UUM A;  4IRE A;  2VKO A;  4CN6 A;  5L4E A;  2LOP A;  1KNZ A;  2LKH A;  3AB3 B;  4P09 A;  3M65 A;  3N9L A;  5EK4 A;  3RYC E;  5HXH A;  2Q9Q C;  4AQY T;  4X20 E;  1WYB A;  2A2F X;  3P4W A;  2XYS A;  2N2N A;  1D0Y A;  1HF8 A;  2FBW A;  3RRC A;  3O1J A;  2XAH B;  1MMD A;  5FL0 A;  3Q9D A;  4IDQ A;  4JV5 T;  3ZT6 A;  4DMV A;  5HXR A;  2M67 A;  3ZMV B;  3FZL B;  2LE8 A;  5EK2 A;  3Q5D A;  1J1J A;  3UQ7 A;  5AFK A;  1O3X A;  4ASK A;  2JPF A;  1WFD A;  4QAB A;  2PH9 A;  5FJV A;  1G73 A;  3FXE B;  2Y58 A;  5AQJ B;  1KK7 A;  3OBV E;  2RPA A;  2VKJ A;  3G06 A;  5AFN A;  1UX4 A;  3IA3 A;  3AVR A;  2VWA A;  2LM9 A;  5JDL A;  4DND A;  3EUH A;  1XZY A;  5FXZ A;  4JLE A;  5HEU A;  4N78 D;  3UU4 A;  2UUC T;  2M6B A;  4DR7 T;  4JI3 T;  2X67 A;  1W0A A;  4ZXL A;  2WP9 A;  1S35 A;  5HYA A;  2V26 A;  4EZ1 A;  1H7C A;  1X9B A;  3AE2 A;  3UUB A;  2XPK A;  4PIR A;  1HG2 A;  4AFG A;  4H9O C;  5LGU B;  2E9X C;  4NIQ A;  2JQH A;  4CN4 A;  2C5I T;  1X79 A;  4MBQ A;  2XQY A;  2H3R A;  2Q9Q D;  4X62 T;  4GK5 E;  2XAJ B;  2JQ9 A;  4IL4 A;  2Y54 A;  4ZZB A;  1MMG A;  2UXN B; 
#chains in the Genus database with same CATH homology
 5CO5 A;  5AIN A;  4QH5 A;  2WN9 A;  3LSV A;  1OED E;  4ZZC A;  3SIO A;  2WNL A;  3U8N A;  4TNV A;  2BG9 C;  4ALX A;  3UU8 A;  5AFL A;  2BYN A;  3EI0 A;  5KZU A;  5HEG A;  2YME A;  3RHW A;  5LG3 A;  3UQ7 A;  4FRR A;  5J0Z A;  4LMK A;  2LLY A;  2XQA A;  2BJ0 A;  2BYS A;  3RI5 A;  5AFH A;  5AFK A;  4UXU A;  3UU5 A;  2XQ9 A;  2VL0 A;  3TLS A;  3PMZ A;  3EAM A;  5KE4 A;  3JAE A;  3WTN A;  5TVC A;  4HQP A;  2LM2 A;  3U8J A;  4NPP A;  2PH9 A;  4QAB A;  5FJV A;  4TWD A;  4XHE A;  3TLW A;  3EHZ A;  2XQ6 A;  2Y58 A;  4QAA A;  4TNW A;  5HEJ A;  2XNU A;  2WNJ A;  4UM3 P;  4UM3 S;  4AFH A;  4ZK1 A;  5AFJ A;  2MAW A;  5AFN A;  2XQ4 A;  2X00 D;  3WTL A;  4TWF A;  2XZ6 A;  3SQ6 A;  4QH4 A;  2M6I A;  3U8M A;  3JAF A;  5JME A;  2X00 A;  1OED C;  4ZRU A;  4XK9 A;  4A97 A;  3RQU A;  2YMD A;  4QH1 A;  1OED A;  3WTJ A;  2XQ8 A;  4D01 A;  4LML A;  5HEU A;  4ILC A;  2BG9 A;  2XQ7 A;  4AFT A;  5J5G A;  3UU4 A;  1OED B;  2LKG A;  4HFE A;  2M6B A;  2PGZ A;  2W8G A;  4HFC A;  5J5F A;  3TLT A;  2BG9 B;  4F8H A;  2W8F A;  3GUA A;  4Z91 A;  3T4M A;  4ZJS A;  4LMJ A;  4HFB A;  2XNV A;  2YKS A;  3ZDH A;  5J5I A;  2UZ6 A;  4BFQ A;  4ZK4 A;  4ILA A;  4DBM A;  4A98 A;  4WV9 A;  2Y7Y A;  3RIF A;  2BG9 E;  4ZJT A;  4EZ1 A;  4IL9 A;  5HEH A;  2KSR A;  3UU6 A;  2YN6 A;  3U8K A;  3WTH A;  4ZR6 A;  2BYP A;  5HEO A;  3UUB A;  2XZ5 A;  3UU3 A;  3ZDG A;  4IRE A;  2XYT A;  4ILB A;  4PIR A;  5L4E A;  3U8L A;  3TLU A;  4COF A;  4NZB A;  4AFG A;  5LXB A;  2BR7 A;  5SYO A;  1UV6 A;  2C9T A;  3UQ4 A;  3WIP A;  2LKH A;  4HFD A;  2Y56 A;  3IGQ A;  2ZJV A;  5J5H A;  2BYR A;  5L4H A;  4TWH A;  3RQW A;  3ZKR A;  4BQT A;  2YOE A;  1UW6 A;  5AFM A;  3RIA A;  3PEO A;  3SQ9 A;  3P50 A;  3WTO A;  2BR8 A;  5HCJ A;  4X5T A;  1UX2 A;  3WTK A;  5AFM B;  4HFI A;  3P4W A;  1I9B A;  2WZY A;  5L47 A;  5BRX A;  4IL4 A;  3SH1 A;  3JAD A;  2WNC A;  4Z90 A;  2XYS A;  2Y54 A;  2Y57 A;  4UM3 A;  2BYQ A;  3C79 A;  4QAC A;  2XQ3 A;  5HCM A;  4ZZB A;  4UM1 A;  2ZJU A;  5CFB A;  2XNT A;  2QC1 B;  3TLV A;  4B5D A;  4HFH A;  5IUX A;  3WTI A;  2XQ5 A;  3C84 A;  4UY2 A;  5BP0 A;  5BW2 A;  3WTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...