5J5IA

X-ray crystal structure of acetylcholine binding protein (achbp) in complex with 4-(2-amino-6-{bis[(pyridin-2-yl)methyl]amino}pyrimidin-4-yl)phenol
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Substituted 2-Aminopyrimidines Selective for alpha 7-Nicotinic Acetylcholine Receptor Activation and Association with Acetylcholine Binding Proteins.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein, achbp
total genus 51
structure length 213
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j5iA00
2YOEA 3WTOA 5HCMA 3UU6A 2VL0A 4Z91A 5FJVA 5CFBA 2XNVA 3EHZA 2XYSA 3U8JA 3UU5A 2BG9B 3UQ7A 2YKSA 5LG3A 2YMEA 2PGZA 2XYTA 4XHEA 4QH4A 2XQ8A 3U8MA 2XNUA 4FRRA 2BG9A 2PH9A 4HFHA 2W8GA 4IL9A 1UW6A 2QC1B 3JAEA 2YN6A 4QH1A 4AFGA 3PEOA 3UQ4A 4Z90A 3RHWA 5HEJA 2Y56A 4X5TA 3C79A 4IREA 2XQ7A 4ILAA 2BYNA 2X00D 4ALXA 2W8FA 4ZRUA 4ZZCA 5AFJA 3TLWA 2XQAA 4HFCA 4ZJSA 5HCJA 3WTMA 5J5GA 2XQ6A 3U8KA 2BYQA 3ZDGA 4DBMA 2BYSA 2ZJUA 3WTNA 3RQUA 4HFDA 3GUAA 4ZR6A 3TLVA 4COFA 2Y54A 5BP0A 5J0ZA 3SQ6A 4TWDA 5HEOA 2XQ3A 4ILCA 4HFIA 5L47A 4AFTA 2Y57A 4NZBA 3IGQA 3RI5A 5BW2A 4ZK4A 4ILBA 3RIAA 5AFKA 3SQ9A 5AINA 1UV6A 2XNTA 4F8HA 3LSVA 2WN9A 2WNCA 4UXUA 3SIOA 5AFHA 4QACA 5IUXA 4HFBA 3WTIA 4BQTA 5L4EA 5L4HA 4A98A 2Y7YA 4XK9A 3EI0A 3ZKRA 2X00A 2BG9E 2BG9C 2XQ9A 4LMLA 3RIFA 3U8NA 3ZDHA 3C84A 4D01A 5LXBA 3UU8A 3UUBA 4IL4A 5BRXA 3WTKA 2ZJVA 5HEUA 1UX2A 3TLUA 4UM3A 2XZ6A 4HQPA 5AFMB 4QH5A 4ZK1A 4HFEA 5HEHA 4A97A 3JAFA 4EZ1A 5SYOA 5TVCA 3P4WA 2BJ0A 2WNJA 4UM3S 3PMZA 5HEGA 5AFMA 2XZ5A 4UY2A 4UM1A 3UU4A 3WTLA 1I9BA 4TWFA 4ZZBA 5J5HA 5KZUA 4UM3P 2C9TA 2BYRA 5J5FA 3TLTA 4TNVA 4LMKA 4WV9A 2BR7A 3T4MA 4ZJTA 2XQ5A 5J5IA 3WTHA 3TLSA 4QAAA 3WTJA 2Y58A 2WNLA 2BR8A 4QABA 3RQWA 4B5DA 4PIRA 4TNWA 5AFNA 3WIPA 4TWHA 3U8LA 5KE4A 5CO5A 3JADA 4LMJA 4NPPA 2UZ6A 2XQ4A 3SH1A 2BYPA 5AFLA 3UU3A 5JMEA 3EAMA 4BFQA 2WZYA 3P50A 4AFHA 2YMDA
chains in the Genus database with same CATH superfamily
2YOEA 3WTOA 5HCMA 3UU6A 2VL0A 4Z91A 5FJVA 5CFBA 2XNVA 3EHZA 2XYSA 3U8JA 3UU5A 2BG9B 3UQ7A 2YKSA 5LG3A 2YMEA 2PGZA 2XYTA 4XHEA 4QH4A 2XQ8A 3U8MA 2XNUA 4FRRA 2BG9A 2PH9A 4HFHA 2W8GA 4IL9A 1UW6A 2QC1B 3JAEA 2YN6A 4QH1A 4AFGA 3PEOA 3UQ4A 4Z90A 3RHWA 5HEJA 2Y56A 4X5TA 3C79A 4IREA 2XQ7A 4ILAA 2BYNA 2X00D 4ALXA 2W8FA 4ZRUA 4ZZCA 5AFJA 3TLWA 2XQAA 4HFCA 4ZJSA 5HCJA 3WTMA 5J5GA 2XQ6A 3U8KA 2BYQA 3ZDGA 4DBMA 2BYSA 2ZJUA 3WTNA 3RQUA 4HFDA 3GUAA 4ZR6A 3TLVA 4COFA 2Y54A 5BP0A 5J0ZA 3SQ6A 4TWDA 5HEOA 2XQ3A 4ILCA 4HFIA 5L47A 4AFTA 2Y57A 4NZBA 3IGQA 3RI5A 5BW2A 4ZK4A 4ILBA 3RIAA 5AFKA 3SQ9A 5AINA 1UV6A 2XNTA 4F8HA 3LSVA 2WN9A 2WNCA 4UXUA 3SIOA 5AFHA 4QACA 5IUXA 4HFBA 3WTIA 4BQTA 5L4EA 5L4HA 4A98A 2Y7YA 4XK9A 3EI0A 3ZKRA 2X00A 2BG9E 2BG9C 2XQ9A 4LMLA 3RIFA 3U8NA 3ZDHA 3C84A 4D01A 5LXBA 3UU8A 3UUBA 4IL4A 5BRXA 3WTKA 2ZJVA 5HEUA 1UX2A 3TLUA 4UM3A 2XZ6A 4HQPA 5AFMB 4QH5A 4ZK1A 4HFEA 5HEHA 4A97A 3JAFA 4EZ1A 5SYOA 5TVCA 3P4WA 2BJ0A 2WNJA 4UM3S 3PMZA 5HEGA 5AFMA 2XZ5A 4UY2A 4UM1A 3UU4A 3WTLA 1I9BA 4TWFA 4ZZBA 5J5HA 5KZUA 4UM3P 2C9TA 2BYRA 5J5FA 3TLTA 4TNVA 4LMKA 4WV9A 2BR7A 3T4MA 4ZJTA 2XQ5A 5J5IA 3WTHA 3TLSA 4QAAA 3WTJA 2Y58A 2WNLA 2BR8A 4QABA 3RQWA 4B5DA 4PIRA 4TNWA 5AFNA 3WIPA 4TWHA 3U8LA 5KE4A 5CO5A 3JADA 4LMJA 4NPPA 2UZ6A 2XQ4A 3SH1A 2BYPA 5AFLA 3UU3A 5JMEA 3EAMA 4BFQA 2WZYA 3P50A 4AFHA 2YMDA
chains in the Genus database with same CATH topology
2YOEA 3WTOA 5HCMA 3UU6A 2VL0A 4Z91A 5FJVA 5CFBA 2XNVA 3EHZA 2XYSA 3U8JA 3UU5A 2BG9B 3UQ7A 2YKSA 5LG3A 2YMEA 2PGZA 2XYTA 4XHEA 4QH4A 2XQ8A 3U8MA 2XNUA 4FRRA 2BG9A 2PH9A 4HFHA 2W8GA 4IL9A 1UW6A 2QC1B 3JAEA 2YN6A 4QH1A 4AFGA 3PEOA 3UQ4A 4Z90A 3RHWA 5HEJA 2Y56A 4X5TA 3C79A 4IREA 2XQ7A 4ILAA 2BYNA 2X00D 4ALXA 2W8FA 4ZRUA 4ZZCA 5AFJA 3TLWA 2XQAA 4HFCA 4ZJSA 5HCJA 3WTMA 5J5GA 2XQ6A 3U8KA 2BYQA 3ZDGA 4DBMA 2BYSA 2ZJUA 3WTNA 3RQUA 4HFDA 3GUAA 4ZR6A 3TLVA 4COFA 2Y54A 5BP0A 5J0ZA 3SQ6A 4TWDA 5HEOA 2XQ3A 4ILCA 4HFIA 5L47A 4AFTA 2Y57A 4NZBA 3IGQA 3RI5A 5BW2A 4ZK4A 4ILBA 3RIAA 5AFKA 3SQ9A 5AINA 1UV6A 2XNTA 4F8HA 3LSVA 2WN9A 2WNCA 4UXUA 3SIOA 5AFHA 4QACA 5IUXA 4HFBA 3WTIA 4BQTA 5L4EA 5L4HA 4A98A 2Y7YA 4XK9A 3EI0A 3ZKRA 2X00A 2BG9E 2BG9C 2XQ9A 4LMLA 3RIFA 3U8NA 3ZDHA 3C84A 4D01A 5LXBA 3UU8A 3UUBA 4IL4A 5BRXA 3WTKA 2ZJVA 5HEUA 1UX2A 3TLUA 4UM3A 2XZ6A 4HQPA 5AFMB 4QH5A 4ZK1A 4HFEA 5HEHA 4A97A 3JAFA 4EZ1A 5SYOA 5TVCA 3P4WA 2BJ0A 2WNJA 4UM3S 3PMZA 5HEGA 5AFMA 2XZ5A 4UY2A 4UM1A 3UU4A 3WTLA 1I9BA 4TWFA 4ZZBA 5J5HA 5KZUA 4UM3P 2C9TA 2BYRA 5J5FA 3TLTA 4TNVA 4LMKA 4WV9A 2BR7A 3T4MA 4ZJTA 2XQ5A 5J5IA 3WTHA 3TLSA 4QAAA 3WTJA 2Y58A 2WNLA 2BR8A 4QABA 3RQWA 4B5DA 4PIRA 4TNWA 5AFNA 3WIPA 4TWHA 3U8LA 5KE4A 5CO5A 3JADA 4LMJA 4NPPA 2UZ6A 2XQ4A 3SH1A 2BYPA 5AFLA 3UU3A 5JMEA 3EAMA 4BFQA 2WZYA 3P50A 4AFHA 2YMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YOE A;  3WTO A;  5HCM A;  3UU6 A;  2VL0 A;  4Z91 A;  5FJV A;  5CFB A;  2XNV A;  3EHZ A;  2XYS A;  3U8J A;  3UU5 A;  2BG9 B;  3UQ7 A;  2YKS A;  5LG3 A;  2YME A;  2PGZ A;  2XYT A;  4XHE A;  4QH4 A;  2XQ8 A;  3U8M A;  2XNU A;  4FRR A;  2BG9 A;  2PH9 A;  4HFH A;  2W8G A;  4IL9 A;  1UW6 A;  2QC1 B;  3JAE A;  2YN6 A;  4QH1 A;  4AFG A;  3PEO A;  3UQ4 A;  4Z90 A;  3RHW A;  5HEJ A;  2Y56 A;  4X5T A;  3C79 A;  4IRE A;  2XQ7 A;  4ILA A;  2BYN A;  2X00 D;  4ALX A;  2W8F A;  4ZRU A;  4ZZC A;  5AFJ A;  3TLW A;  2XQA A;  4HFC A;  4ZJS A;  5HCJ A;  3WTM A;  5J5G A;  2XQ6 A;  3U8K A;  2BYQ A;  3ZDG A;  4DBM A;  2BYS A;  2ZJU A;  3WTN A;  3RQU A;  4HFD A;  3GUA A;  4ZR6 A;  3TLV A;  4COF A;  2Y54 A;  5BP0 A;  5J0Z A;  3SQ6 A;  4TWD A;  5HEO A;  2XQ3 A;  4ILC A;  4HFI A;  5L47 A;  4AFT A;  2Y57 A;  4NZB A;  3IGQ A;  3RI5 A;  5BW2 A;  4ZK4 A;  4ILB A;  3RIA A;  5AFK A;  3SQ9 A;  5AIN A;  1UV6 A;  2XNT A;  4F8H A;  3LSV A;  2WN9 A;  2WNC A;  4UXU A;  3SIO A;  5AFH A;  4QAC A;  5IUX A;  4HFB A;  3WTI A;  4BQT A;  5L4E A;  5L4H A;  4A98 A;  2Y7Y A;  4XK9 A;  3EI0 A;  3ZKR A;  2X00 A;  2BG9 E;  2BG9 C;  2XQ9 A;  4LML A;  3RIF A;  3U8N A;  3ZDH A;  3C84 A;  4D01 A;  5LXB A;  3UU8 A;  3UUB A;  4IL4 A;  5BRX A;  3WTK A;  2ZJV A;  5HEU A;  1UX2 A;  3TLU A;  4UM3 A;  2XZ6 A;  4HQP A;  5AFM B;  4QH5 A;  4ZK1 A;  4HFE A;  5HEH A;  4A97 A;  3JAF A;  4EZ1 A;  5SYO A;  5TVC A;  3P4W A;  2BJ0 A;  2WNJ A;  4UM3 S;  3PMZ A;  5HEG A;  5AFM A;  2XZ5 A;  4UY2 A;  4UM1 A;  3UU4 A;  3WTL A;  1I9B A;  4TWF A;  4ZZB A;  5J5H A;  5KZU A;  4UM3 P;  2C9T A;  2BYR A;  5J5F A;  3TLT A;  4TNV A;  4LMK A;  4WV9 A;  2BR7 A;  3T4M A;  4ZJT A;  2XQ5 A;  5J5I A;  3WTH A;  3TLS A;  4QAA A;  3WTJ A;  2Y58 A;  2WNL A;  2BR8 A;  4QAB A;  3RQW A;  4B5D A;  4PIR A;  4TNW A;  5AFN A;  3WIP A;  4TWH A;  3U8L A;  5KE4 A;  5CO5 A;  3JAD A;  4LMJ A;  4NPP A;  2UZ6 A;  2XQ4 A;  3SH1 A;  2BYP A;  5AFL A;  3UU3 A;  5JME A;  3EAM A;  4BFQ A;  2WZY A;  3P50 A;  4AFH A;  2YMD A; 
#chains in the Genus database with same CATH topology
 2YOE A;  3WTO A;  5HCM A;  3UU6 A;  2VL0 A;  4Z91 A;  5FJV A;  5CFB A;  2XNV A;  3EHZ A;  2XYS A;  3U8J A;  3UU5 A;  2BG9 B;  3UQ7 A;  2YKS A;  5LG3 A;  2YME A;  2PGZ A;  2XYT A;  4XHE A;  4QH4 A;  2XQ8 A;  3U8M A;  2XNU A;  4FRR A;  2BG9 A;  2PH9 A;  4HFH A;  2W8G A;  4IL9 A;  1UW6 A;  2QC1 B;  3JAE A;  2YN6 A;  4QH1 A;  4AFG A;  3PEO A;  3UQ4 A;  4Z90 A;  3RHW A;  5HEJ A;  2Y56 A;  4X5T A;  3C79 A;  4IRE A;  2XQ7 A;  4ILA A;  2BYN A;  2X00 D;  4ALX A;  2W8F A;  4ZRU A;  4ZZC A;  5AFJ A;  3TLW A;  2XQA A;  4HFC A;  4ZJS A;  5HCJ A;  3WTM A;  5J5G A;  2XQ6 A;  3U8K A;  2BYQ A;  3ZDG A;  4DBM A;  2BYS A;  2ZJU A;  3WTN A;  3RQU A;  4HFD A;  3GUA A;  4ZR6 A;  3TLV A;  4COF A;  2Y54 A;  5BP0 A;  5J0Z A;  3SQ6 A;  4TWD A;  5HEO A;  2XQ3 A;  4ILC A;  4HFI A;  5L47 A;  4AFT A;  2Y57 A;  4NZB A;  3IGQ A;  3RI5 A;  5BW2 A;  4ZK4 A;  4ILB A;  3RIA A;  5AFK A;  3SQ9 A;  5AIN A;  1UV6 A;  2XNT A;  4F8H A;  3LSV A;  2WN9 A;  2WNC A;  4UXU A;  3SIO A;  5AFH A;  4QAC A;  5IUX A;  4HFB A;  3WTI A;  4BQT A;  5L4E A;  5L4H A;  4A98 A;  2Y7Y A;  4XK9 A;  3EI0 A;  3ZKR A;  2X00 A;  2BG9 E;  2BG9 C;  2XQ9 A;  4LML A;  3RIF A;  3U8N A;  3ZDH A;  3C84 A;  4D01 A;  5LXB A;  3UU8 A;  3UUB A;  4IL4 A;  5BRX A;  3WTK A;  2ZJV A;  5HEU A;  1UX2 A;  3TLU A;  4UM3 A;  2XZ6 A;  4HQP A;  5AFM B;  4QH5 A;  4ZK1 A;  4HFE A;  5HEH A;  4A97 A;  3JAF A;  4EZ1 A;  5SYO A;  5TVC A;  3P4W A;  2BJ0 A;  2WNJ A;  4UM3 S;  3PMZ A;  5HEG A;  5AFM A;  2XZ5 A;  4UY2 A;  4UM1 A;  3UU4 A;  3WTL A;  1I9B A;  4TWF A;  4ZZB A;  5J5H A;  5KZU A;  4UM3 P;  2C9T A;  2BYR A;  5J5F A;  3TLT A;  4TNV A;  4LMK A;  4WV9 A;  2BR7 A;  3T4M A;  4ZJT A;  2XQ5 A;  5J5I A;  3WTH A;  3TLS A;  4QAA A;  3WTJ A;  2Y58 A;  2WNL A;  2BR8 A;  4QAB A;  3RQW A;  4B5D A;  4PIR A;  4TNW A;  5AFN A;  3WIP A;  4TWH A;  3U8L A;  5KE4 A;  5CO5 A;  3JAD A;  4LMJ A;  4NPP A;  2UZ6 A;  2XQ4 A;  3SH1 A;  2BYP A;  5AFL A;  3UU3 A;  5JME A;  3EAM A;  4BFQ A;  2WZY A;  3P50 A;  4AFH A;  2YMD A; 
#chains in the Genus database with same CATH homology
 2YOE A;  3WTO A;  5HCM A;  3UU6 A;  2VL0 A;  4Z91 A;  5FJV A;  5CFB A;  2XNV A;  3EHZ A;  2XYS A;  3U8J A;  3UU5 A;  2BG9 B;  3UQ7 A;  2YKS A;  5LG3 A;  2YME A;  2PGZ A;  2XYT A;  4XHE A;  4QH4 A;  2XQ8 A;  3U8M A;  2XNU A;  4FRR A;  2BG9 A;  2PH9 A;  4HFH A;  2W8G A;  4IL9 A;  1UW6 A;  2QC1 B;  3JAE A;  2YN6 A;  4QH1 A;  4AFG A;  3PEO A;  3UQ4 A;  4Z90 A;  3RHW A;  5HEJ A;  2Y56 A;  4X5T A;  3C79 A;  4IRE A;  2XQ7 A;  4ILA A;  2BYN A;  2X00 D;  4ALX A;  2W8F A;  4ZRU A;  4ZZC A;  5AFJ A;  3TLW A;  2XQA A;  4HFC A;  4ZJS A;  5HCJ A;  3WTM A;  5J5G A;  2XQ6 A;  3U8K A;  2BYQ A;  3ZDG A;  4DBM A;  2BYS A;  2ZJU A;  3WTN A;  3RQU A;  4HFD A;  3GUA A;  4ZR6 A;  3TLV A;  4COF A;  2Y54 A;  5BP0 A;  5J0Z A;  3SQ6 A;  4TWD A;  5HEO A;  2XQ3 A;  4ILC A;  4HFI A;  5L47 A;  4AFT A;  2Y57 A;  4NZB A;  3IGQ A;  3RI5 A;  5BW2 A;  4ZK4 A;  4ILB A;  3RIA A;  5AFK A;  3SQ9 A;  5AIN A;  1UV6 A;  2XNT A;  4F8H A;  3LSV A;  2WN9 A;  2WNC A;  4UXU A;  3SIO A;  5AFH A;  4QAC A;  5IUX A;  4HFB A;  3WTI A;  4BQT A;  5L4E A;  5L4H A;  4A98 A;  2Y7Y A;  4XK9 A;  3EI0 A;  3ZKR A;  2X00 A;  2BG9 E;  2BG9 C;  2XQ9 A;  4LML A;  3RIF A;  3U8N A;  3ZDH A;  3C84 A;  4D01 A;  5LXB A;  3UU8 A;  3UUB A;  4IL4 A;  5BRX A;  3WTK A;  2ZJV A;  5HEU A;  1UX2 A;  3TLU A;  4UM3 A;  2XZ6 A;  4HQP A;  5AFM B;  4QH5 A;  4ZK1 A;  4HFE A;  5HEH A;  4A97 A;  3JAF A;  4EZ1 A;  5SYO A;  5TVC A;  3P4W A;  2BJ0 A;  2WNJ A;  4UM3 S;  3PMZ A;  5HEG A;  5AFM A;  2XZ5 A;  4UY2 A;  4UM1 A;  3UU4 A;  3WTL A;  1I9B A;  4TWF A;  4ZZB A;  5J5H A;  5KZU A;  4UM3 P;  2C9T A;  2BYR A;  5J5F A;  3TLT A;  4TNV A;  4LMK A;  4WV9 A;  2BR7 A;  3T4M A;  4ZJT A;  2XQ5 A;  5J5I A;  3WTH A;  3TLS A;  4QAA A;  3WTJ A;  2Y58 A;  2WNL A;  2BR8 A;  4QAB A;  3RQW A;  4B5D A;  4PIR A;  4TNW A;  5AFN A;  3WIP A;  4TWH A;  3U8L A;  5KE4 A;  5CO5 A;  3JAD A;  4LMJ A;  4NPP A;  2UZ6 A;  2XQ4 A;  3SH1 A;  2BYP A;  5AFL A;  3UU3 A;  5JME A;  3EAM A;  4BFQ A;  2WZY A;  3P50 A;  4AFH A;  2YMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...