5J5IA

X-ray crystal structure of acetylcholine binding protein (achbp) in complex with 4-(2-amino-6-{bis[(pyridin-2-yl)methyl]amino}pyrimidin-4-yl)phenol
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein, achbp
molecule keywords Acetylcholine-binding protein
publication title Substituted 2-Aminopyrimidines Selective for alpha 7-Nicotinic Acetylcholine Receptor Activation and Association with Acetylcholine Binding Proteins.
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 51
structure length 213
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j5iA00
4UM3A 3RHWA 2BG9E 2PH9A 4QAAA 5AFLA 5IUXA 3P4WA 5AFHA 2XQ9A 3WTJA 3JAEA 2BR8A 3TLSA 4UM1A 2WNLA 4HFIA 3SH1A 3WTOA 2Y54A 4AFTA 5HEJA 3EAMA 3SQ6A 4HFDA 2BG9A 2BG9B 4ZJTA 2XQAA 4PIRA 3UU5A 3U8LA 4LMKA 1UW6A 3SQ9A 2WNJA 4QH5A 5KE4A 3WTHA 2Y56A 2WZYA 4HFCA 5BRXA 2BJ0A 3PMZA 4X5TA 3TLVA 4ZK1A 2XYSA 2Y58A 4Z91A 5AFJA 5TVCA 3TLUA 3C79A 3ZDGA 2YMDA 5BW2A 4B5DA 2W8GA 4ILCA 2PGZA 5AINA 5HEUA 4FRRA 3EHZA 3UU6A 3RIAA 4XHEA 3U8NA 4ALXA 4TWFA 5J5GA 3ZKRA 3P50A 4TNWA 5AFMB 4UY2A 5KZUA 4UM3S 3WTMA 2QC1B 4COFA 2ZJVA 3UU3A 2YOEA 2XQ5A 4TWHA 3JAFA 2UZ6A 2VL0A 4HFEA 4NPPA 3TLTA 5HEHA 2WN9A 3RQWA 3UU4A 2Y57A 3WTIA 5AFNA 4IL4A 5J5IA 5FJVA 4AFHA 4TNVA 4EZ1A 3ZDHA 3RI5A 5JMEA 3RQUA 4ZRUA 4HFBA 2BYSA 3WIPA 2Y7YA 3C84A 4ZK4A 3UQ4A 5L47A 3EI0A 3WTNA 4QH4A 4A97A 1UX2A 4ILBA 4ZJSA 5AFMA 4TWDA 3UUBA 5CFBA 4BFQA 3U8MA 4HQPA 3SIOA 2X00A 4NZBA 2BR7A 2BYRA 3UU8A 2YKSA 2YN6A 2XQ7A 4ZZBA 5HEGA 3LSVA 2C9TA 3WTLA 5SYOA 4QABA 2BYQA 4F8HA 5L4HA 2XNTA 5CO5A 3U8JA 4IREA 4UXUA 5LG3A 5HCMA 2XNUA 2XQ6A 2ZJUA 3PEOA 4QH1A 4D01A 4LMLA 3RIFA 2BG9C 2W8FA 3WTKA 2XQ4A 4HFHA 2XYTA 4ILAA 3U8KA 4AFGA 4LMJA 5HCJA 2XQ3A 3JADA 4ZR6A 2BYNA 2BYPA 3TLWA 2YMEA 5L4EA 5LXBA 1I9BA 4A98A 4DBMA 5BP0A 2XZ5A 4ZZCA 4Z90A 3IGQA 5J5FA 5AFKA 5J0ZA 3GUAA 2XZ6A 4XK9A 2X00D 4UM3P 4QACA 2WNCA 3T4MA 1UV6A 4IL9A 2XQ8A 2XNVA 5J5HA 5HEOA 3UQ7A 4WV9A 4BQTA
chains in the Genus database with same CATH superfamily
4UM3A 3RHWA 2BG9E 2PH9A 4QAAA 5AFLA 5IUXA 3P4WA 5AFHA 2XQ9A 3WTJA 3JAEA 2BR8A 3TLSA 4UM1A 2WNLA 4HFIA 3SH1A 3WTOA 2Y54A 4AFTA 5HEJA 3EAMA 3SQ6A 4HFDA 2BG9A 2BG9B 4ZJTA 2XQAA 4PIRA 3UU5A 3U8LA 4LMKA 1UW6A 3SQ9A 2WNJA 4QH5A 5KE4A 3WTHA 2Y56A 2WZYA 4HFCA 5BRXA 2BJ0A 3PMZA 4X5TA 3TLVA 4ZK1A 2XYSA 2Y58A 4Z91A 5AFJA 5TVCA 3TLUA 3C79A 3ZDGA 2YMDA 5BW2A 4B5DA 2W8GA 4ILCA 2PGZA 5AINA 5HEUA 4FRRA 3EHZA 3UU6A 3RIAA 4XHEA 3U8NA 4ALXA 4TWFA 5J5GA 3ZKRA 3P50A 4TNWA 5AFMB 4UY2A 5KZUA 4UM3S 3WTMA 2QC1B 4COFA 2ZJVA 3UU3A 2YOEA 2XQ5A 4TWHA 3JAFA 2UZ6A 2VL0A 4HFEA 4NPPA 3TLTA 5HEHA 2WN9A 3RQWA 3UU4A 2Y57A 3WTIA 5AFNA 4IL4A 5J5IA 5FJVA 4AFHA 4TNVA 4EZ1A 3ZDHA 3RI5A 5JMEA 3RQUA 4ZRUA 4HFBA 2BYSA 3WIPA 2Y7YA 3C84A 4ZK4A 3UQ4A 5L47A 3EI0A 3WTNA 4QH4A 4A97A 1UX2A 4ILBA 4ZJSA 5AFMA 4TWDA 3UUBA 5CFBA 4BFQA 3U8MA 4HQPA 3SIOA 2X00A 4NZBA 2BR7A 2BYRA 3UU8A 2YKSA 2YN6A 2XQ7A 4ZZBA 5HEGA 3LSVA 2C9TA 3WTLA 5SYOA 4QABA 2BYQA 4F8HA 5L4HA 2XNTA 5CO5A 3U8JA 4IREA 4UXUA 5LG3A 5HCMA 2XNUA 2XQ6A 2ZJUA 3PEOA 4QH1A 4D01A 4LMLA 3RIFA 2BG9C 2W8FA 3WTKA 2XQ4A 4HFHA 2XYTA 4ILAA 3U8KA 4AFGA 4LMJA 5HCJA 2XQ3A 3JADA 4ZR6A 2BYNA 2BYPA 3TLWA 2YMEA 5L4EA 5LXBA 1I9BA 4A98A 4DBMA 5BP0A 2XZ5A 4ZZCA 4Z90A 3IGQA 5J5FA 5AFKA 5J0ZA 3GUAA 2XZ6A 4XK9A 2X00D 4UM3P 4QACA 2WNCA 3T4MA 1UV6A 4IL9A 2XQ8A 2XNVA 5J5HA 5HEOA 3UQ7A 4WV9A 4BQTA
chains in the Genus database with same CATH topology
4UM3A 3RHWA 2BG9E 2PH9A 4QAAA 5AFLA 5IUXA 3P4WA 5AFHA 2XQ9A 3WTJA 3JAEA 2BR8A 3TLSA 4UM1A 2WNLA 4HFIA 3SH1A 3WTOA 2Y54A 4AFTA 5HEJA 3EAMA 3SQ6A 4HFDA 2BG9A 2BG9B 4ZJTA 2XQAA 4PIRA 3UU5A 3U8LA 4LMKA 1UW6A 3SQ9A 2WNJA 4QH5A 5KE4A 3WTHA 2Y56A 2WZYA 4HFCA 5BRXA 2BJ0A 3PMZA 4X5TA 3TLVA 4ZK1A 2XYSA 2Y58A 4Z91A 5AFJA 5TVCA 3TLUA 3C79A 3ZDGA 2YMDA 5BW2A 4B5DA 2W8GA 4ILCA 2PGZA 5AINA 5HEUA 4FRRA 3EHZA 3UU6A 3RIAA 4XHEA 3U8NA 4ALXA 4TWFA 5J5GA 3ZKRA 3P50A 4TNWA 5AFMB 4UY2A 5KZUA 4UM3S 3WTMA 2QC1B 4COFA 2ZJVA 3UU3A 2YOEA 2XQ5A 4TWHA 3JAFA 2UZ6A 2VL0A 4HFEA 4NPPA 3TLTA 5HEHA 2WN9A 3RQWA 3UU4A 2Y57A 3WTIA 5AFNA 4IL4A 5J5IA 5FJVA 4AFHA 4TNVA 4EZ1A 3ZDHA 3RI5A 5JMEA 3RQUA 4ZRUA 4HFBA 2BYSA 3WIPA 2Y7YA 3C84A 4ZK4A 3UQ4A 5L47A 3EI0A 3WTNA 4QH4A 4A97A 1UX2A 4ILBA 4ZJSA 5AFMA 4TWDA 3UUBA 5CFBA 4BFQA 3U8MA 4HQPA 3SIOA 2X00A 4NZBA 2BR7A 2BYRA 3UU8A 2YKSA 2YN6A 2XQ7A 4ZZBA 5HEGA 3LSVA 2C9TA 3WTLA 5SYOA 4QABA 2BYQA 4F8HA 5L4HA 2XNTA 5CO5A 3U8JA 4IREA 4UXUA 5LG3A 5HCMA 2XNUA 2XQ6A 2ZJUA 3PEOA 4QH1A 4D01A 4LMLA 3RIFA 2BG9C 2W8FA 3WTKA 2XQ4A 4HFHA 2XYTA 4ILAA 3U8KA 4AFGA 4LMJA 5HCJA 2XQ3A 3JADA 4ZR6A 2BYNA 2BYPA 3TLWA 2YMEA 5L4EA 5LXBA 1I9BA 4A98A 4DBMA 5BP0A 2XZ5A 4ZZCA 4Z90A 3IGQA 5J5FA 5AFKA 5J0ZA 3GUAA 2XZ6A 4XK9A 2X00D 4UM3P 4QACA 2WNCA 3T4MA 1UV6A 4IL9A 2XQ8A 2XNVA 5J5HA 5HEOA 3UQ7A 4WV9A 4BQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UM3 A;  3RHW A;  2BG9 E;  2PH9 A;  4QAA A;  5AFL A;  5IUX A;  3P4W A;  5AFH A;  2XQ9 A;  3WTJ A;  3JAE A;  2BR8 A;  3TLS A;  4UM1 A;  2WNL A;  4HFI A;  3SH1 A;  3WTO A;  2Y54 A;  4AFT A;  5HEJ A;  3EAM A;  3SQ6 A;  4HFD A;  2BG9 A;  2BG9 B;  4ZJT A;  2XQA A;  4PIR A;  3UU5 A;  3U8L A;  4LMK A;  1UW6 A;  3SQ9 A;  2WNJ A;  4QH5 A;  5KE4 A;  3WTH A;  2Y56 A;  2WZY A;  4HFC A;  5BRX A;  2BJ0 A;  3PMZ A;  4X5T A;  3TLV A;  4ZK1 A;  2XYS A;  2Y58 A;  4Z91 A;  5AFJ A;  5TVC A;  3TLU A;  3C79 A;  3ZDG A;  2YMD A;  5BW2 A;  4B5D A;  2W8G A;  4ILC A;  2PGZ A;  5AIN A;  5HEU A;  4FRR A;  3EHZ A;  3UU6 A;  3RIA A;  4XHE A;  3U8N A;  4ALX A;  4TWF A;  5J5G A;  3ZKR A;  3P50 A;  4TNW A;  5AFM B;  4UY2 A;  5KZU A;  4UM3 S;  3WTM A;  2QC1 B;  4COF A;  2ZJV A;  3UU3 A;  2YOE A;  2XQ5 A;  4TWH A;  3JAF A;  2UZ6 A;  2VL0 A;  4HFE A;  4NPP A;  3TLT A;  5HEH A;  2WN9 A;  3RQW A;  3UU4 A;  2Y57 A;  3WTI A;  5AFN A;  4IL4 A;  5J5I A;  5FJV A;  4AFH A;  4TNV A;  4EZ1 A;  3ZDH A;  3RI5 A;  5JME A;  3RQU A;  4ZRU A;  4HFB A;  2BYS A;  3WIP A;  2Y7Y A;  3C84 A;  4ZK4 A;  3UQ4 A;  5L47 A;  3EI0 A;  3WTN A;  4QH4 A;  4A97 A;  1UX2 A;  4ILB A;  4ZJS A;  5AFM A;  4TWD A;  3UUB A;  5CFB A;  4BFQ A;  3U8M A;  4HQP A;  3SIO A;  2X00 A;  4NZB A;  2BR7 A;  2BYR A;  3UU8 A;  2YKS A;  2YN6 A;  2XQ7 A;  4ZZB A;  5HEG A;  3LSV A;  2C9T A;  3WTL A;  5SYO A;  4QAB A;  2BYQ A;  4F8H A;  5L4H A;  2XNT A;  5CO5 A;  3U8J A;  4IRE A;  4UXU A;  5LG3 A;  5HCM A;  2XNU A;  2XQ6 A;  2ZJU A;  3PEO A;  4QH1 A;  4D01 A;  4LML A;  3RIF A;  2BG9 C;  2W8F A;  3WTK A;  2XQ4 A;  4HFH A;  2XYT A;  4ILA A;  3U8K A;  4AFG A;  4LMJ A;  5HCJ A;  2XQ3 A;  3JAD A;  4ZR6 A;  2BYN A;  2BYP A;  3TLW A;  2YME A;  5L4E A;  5LXB A;  1I9B A;  4A98 A;  4DBM A;  5BP0 A;  2XZ5 A;  4ZZC A;  4Z90 A;  3IGQ A;  5J5F A;  5AFK A;  5J0Z A;  3GUA A;  2XZ6 A;  4XK9 A;  2X00 D;  4UM3 P;  4QAC A;  2WNC A;  3T4M A;  1UV6 A;  4IL9 A;  2XQ8 A;  2XNV A;  5J5H A;  5HEO A;  3UQ7 A;  4WV9 A;  4BQT A; 
#chains in the Genus database with same CATH topology
 4UM3 A;  3RHW A;  2BG9 E;  2PH9 A;  4QAA A;  5AFL A;  5IUX A;  3P4W A;  5AFH A;  2XQ9 A;  3WTJ A;  3JAE A;  2BR8 A;  3TLS A;  4UM1 A;  2WNL A;  4HFI A;  3SH1 A;  3WTO A;  2Y54 A;  4AFT A;  5HEJ A;  3EAM A;  3SQ6 A;  4HFD A;  2BG9 A;  2BG9 B;  4ZJT A;  2XQA A;  4PIR A;  3UU5 A;  3U8L A;  4LMK A;  1UW6 A;  3SQ9 A;  2WNJ A;  4QH5 A;  5KE4 A;  3WTH A;  2Y56 A;  2WZY A;  4HFC A;  5BRX A;  2BJ0 A;  3PMZ A;  4X5T A;  3TLV A;  4ZK1 A;  2XYS A;  2Y58 A;  4Z91 A;  5AFJ A;  5TVC A;  3TLU A;  3C79 A;  3ZDG A;  2YMD A;  5BW2 A;  4B5D A;  2W8G A;  4ILC A;  2PGZ A;  5AIN A;  5HEU A;  4FRR A;  3EHZ A;  3UU6 A;  3RIA A;  4XHE A;  3U8N A;  4ALX A;  4TWF A;  5J5G A;  3ZKR A;  3P50 A;  4TNW A;  5AFM B;  4UY2 A;  5KZU A;  4UM3 S;  3WTM A;  2QC1 B;  4COF A;  2ZJV A;  3UU3 A;  2YOE A;  2XQ5 A;  4TWH A;  3JAF A;  2UZ6 A;  2VL0 A;  4HFE A;  4NPP A;  3TLT A;  5HEH A;  2WN9 A;  3RQW A;  3UU4 A;  2Y57 A;  3WTI A;  5AFN A;  4IL4 A;  5J5I A;  5FJV A;  4AFH A;  4TNV A;  4EZ1 A;  3ZDH A;  3RI5 A;  5JME A;  3RQU A;  4ZRU A;  4HFB A;  2BYS A;  3WIP A;  2Y7Y A;  3C84 A;  4ZK4 A;  3UQ4 A;  5L47 A;  3EI0 A;  3WTN A;  4QH4 A;  4A97 A;  1UX2 A;  4ILB A;  4ZJS A;  5AFM A;  4TWD A;  3UUB A;  5CFB A;  4BFQ A;  3U8M A;  4HQP A;  3SIO A;  2X00 A;  4NZB A;  2BR7 A;  2BYR A;  3UU8 A;  2YKS A;  2YN6 A;  2XQ7 A;  4ZZB A;  5HEG A;  3LSV A;  2C9T A;  3WTL A;  5SYO A;  4QAB A;  2BYQ A;  4F8H A;  5L4H A;  2XNT A;  5CO5 A;  3U8J A;  4IRE A;  4UXU A;  5LG3 A;  5HCM A;  2XNU A;  2XQ6 A;  2ZJU A;  3PEO A;  4QH1 A;  4D01 A;  4LML A;  3RIF A;  2BG9 C;  2W8F A;  3WTK A;  2XQ4 A;  4HFH A;  2XYT A;  4ILA A;  3U8K A;  4AFG A;  4LMJ A;  5HCJ A;  2XQ3 A;  3JAD A;  4ZR6 A;  2BYN A;  2BYP A;  3TLW A;  2YME A;  5L4E A;  5LXB A;  1I9B A;  4A98 A;  4DBM A;  5BP0 A;  2XZ5 A;  4ZZC A;  4Z90 A;  3IGQ A;  5J5F A;  5AFK A;  5J0Z A;  3GUA A;  2XZ6 A;  4XK9 A;  2X00 D;  4UM3 P;  4QAC A;  2WNC A;  3T4M A;  1UV6 A;  4IL9 A;  2XQ8 A;  2XNV A;  5J5H A;  5HEO A;  3UQ7 A;  4WV9 A;  4BQT A; 
#chains in the Genus database with same CATH homology
 4UM3 A;  3RHW A;  2BG9 E;  2PH9 A;  4QAA A;  5AFL A;  5IUX A;  3P4W A;  5AFH A;  2XQ9 A;  3WTJ A;  3JAE A;  2BR8 A;  3TLS A;  4UM1 A;  2WNL A;  4HFI A;  3SH1 A;  3WTO A;  2Y54 A;  4AFT A;  5HEJ A;  3EAM A;  3SQ6 A;  4HFD A;  2BG9 A;  2BG9 B;  4ZJT A;  2XQA A;  4PIR A;  3UU5 A;  3U8L A;  4LMK A;  1UW6 A;  3SQ9 A;  2WNJ A;  4QH5 A;  5KE4 A;  3WTH A;  2Y56 A;  2WZY A;  4HFC A;  5BRX A;  2BJ0 A;  3PMZ A;  4X5T A;  3TLV A;  4ZK1 A;  2XYS A;  2Y58 A;  4Z91 A;  5AFJ A;  5TVC A;  3TLU A;  3C79 A;  3ZDG A;  2YMD A;  5BW2 A;  4B5D A;  2W8G A;  4ILC A;  2PGZ A;  5AIN A;  5HEU A;  4FRR A;  3EHZ A;  3UU6 A;  3RIA A;  4XHE A;  3U8N A;  4ALX A;  4TWF A;  5J5G A;  3ZKR A;  3P50 A;  4TNW A;  5AFM B;  4UY2 A;  5KZU A;  4UM3 S;  3WTM A;  2QC1 B;  4COF A;  2ZJV A;  3UU3 A;  2YOE A;  2XQ5 A;  4TWH A;  3JAF A;  2UZ6 A;  2VL0 A;  4HFE A;  4NPP A;  3TLT A;  5HEH A;  2WN9 A;  3RQW A;  3UU4 A;  2Y57 A;  3WTI A;  5AFN A;  4IL4 A;  5J5I A;  5FJV A;  4AFH A;  4TNV A;  4EZ1 A;  3ZDH A;  3RI5 A;  5JME A;  3RQU A;  4ZRU A;  4HFB A;  2BYS A;  3WIP A;  2Y7Y A;  3C84 A;  4ZK4 A;  3UQ4 A;  5L47 A;  3EI0 A;  3WTN A;  4QH4 A;  4A97 A;  1UX2 A;  4ILB A;  4ZJS A;  5AFM A;  4TWD A;  3UUB A;  5CFB A;  4BFQ A;  3U8M A;  4HQP A;  3SIO A;  2X00 A;  4NZB A;  2BR7 A;  2BYR A;  3UU8 A;  2YKS A;  2YN6 A;  2XQ7 A;  4ZZB A;  5HEG A;  3LSV A;  2C9T A;  3WTL A;  5SYO A;  4QAB A;  2BYQ A;  4F8H A;  5L4H A;  2XNT A;  5CO5 A;  3U8J A;  4IRE A;  4UXU A;  5LG3 A;  5HCM A;  2XNU A;  2XQ6 A;  2ZJU A;  3PEO A;  4QH1 A;  4D01 A;  4LML A;  3RIF A;  2BG9 C;  2W8F A;  3WTK A;  2XQ4 A;  4HFH A;  2XYT A;  4ILA A;  3U8K A;  4AFG A;  4LMJ A;  5HCJ A;  2XQ3 A;  3JAD A;  4ZR6 A;  2BYN A;  2BYP A;  3TLW A;  2YME A;  5L4E A;  5LXB A;  1I9B A;  4A98 A;  4DBM A;  5BP0 A;  2XZ5 A;  4ZZC A;  4Z90 A;  3IGQ A;  5J5F A;  5AFK A;  5J0Z A;  3GUA A;  2XZ6 A;  4XK9 A;  2X00 D;  4UM3 P;  4QAC A;  2WNC A;  3T4M A;  1UV6 A;  4IL9 A;  2XQ8 A;  2XNV A;  5J5H A;  5HEO A;  3UQ7 A;  4WV9 A;  4BQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...