5J5IA

X-ray crystal structure of acetylcholine binding protein (achbp) in complex with 4-(2-amino-6-{bis[(pyridin-2-yl)methyl]amino}pyrimidin-4-yl)phenol
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Substituted 2-Aminopyrimidines Selective for alpha 7-Nicotinic Acetylcholine Receptor Activation and Association with Acetylcholine Binding Proteins.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein, achbp
total genus 51
structure length 213
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j5iA00
3WTMA 2XNVA 4XHEA 4TWHA 4UM3P 2XNTA 4F8HA 2XQ4A 3WTHA 2VL0A 3TLSA 5J5IA 1UW6A 5HEGA 3IGQA 5KE4A 4PIRA 2WNLA 3UU6A 2BJ0A 3WTLA 3EI0A 5AFLA 2WNJA 3P50A 2WZYA 2XZ6A 4AFHA 2XQ9A 2BYSA 4TNWA 4Z91A 5HCJA 3U8MA 5L4EA 3SQ9A 5J5HA 4IL9A 3TLVA 5HCMA 4X5TA 5J5FA 5LXBA 4QH1A 5SYOA 3SQ6A 2PGZA 3RI5A 2WN9A 4HFIA 4UY2A 3SH1A 3RIFA 5J5GA 3UQ7A 5CFBA 2X00D 4ILBA 4ZJTA 5BW2A 4A97A 3UUBA 3UU5A 4HFEA 4HFDA 4ZR6A 2C9TA 4BFQA 4ILAA 2BR8A 5IUXA 4UM3A 3RQWA 4ZZBA 4LMLA 2XQAA 3UU3A 2XQ7A 3UU4A 2XQ8A 5AINA 3WIPA 5BRXA 5HEHA 3UU8A 3GUAA 5TVCA 5HEOA 3UQ4A 3U8JA 5AFKA 2BYPA 3ZDHA 3WTKA 2YKSA 3WTOA 3T4MA 4HFCA 4D01A 4UM1A 5HEUA 5AFNA 4BQTA 3WTJA 4EZ1A 3EHZA 4HFHA 5FJVA 1I9BA 4COFA 4DBMA 3PEOA 2YOEA 2Y54A 4B5DA 3JAFA 4Z90A 3JADA 2XQ5A 1UV6A 4LMKA 4QABA 2BG9E 2Y57A 5HEJA 2BG9A 2UZ6A 3RQUA 2PH9A 1UX2A 2BG9B 4ALXA 2X00A 4NPPA 2XYSA 4ILCA 3TLWA 4HQPA 4ZK4A 4QH5A 4QACA 2W8FA 4LMJA 4TWFA 5LG3A 5J0ZA 2YMEA 4FRRA 2Y7YA 2XNUA 2BYNA 4A98A 4QH4A 4TWDA 3SIOA 5L47A 4UXUA 2BYQA 4IL4A 3TLUA 5AFJA 3PMZA 3TLTA 4ZRUA 3ZDGA 3RIAA 2QC1B 4ZZCA 5KZUA 3JAEA 4NZBA 2ZJVA 2BYRA 3C79A 4HFBA 5CO5A 3ZKRA 3LSVA 3U8NA 3C84A 3U8LA 4UM3S 4QAAA 2XQ3A 5AFMA 5BP0A 3RHWA 2XZ5A 3U8KA 3P4WA 5AFMB 2XQ6A 4WV9A 2WNCA 3EAMA 4AFGA 2W8GA 3WTIA 2Y58A 5L4HA 2YMDA 2XYTA 4XK9A 2BG9C 4TNVA 4AFTA 4ZK1A 5AFHA 2YN6A 2BR7A 2Y56A 5JMEA 3WTNA 4ZJSA 4IREA 2ZJUA
chains in the Genus database with same CATH superfamily
3WTMA 2XNVA 4XHEA 4TWHA 4UM3P 2XNTA 4F8HA 2XQ4A 3WTHA 2VL0A 3TLSA 5J5IA 1UW6A 5HEGA 3IGQA 5KE4A 4PIRA 2WNLA 3UU6A 2BJ0A 3WTLA 3EI0A 5AFLA 2WNJA 3P50A 2WZYA 2XZ6A 4AFHA 2XQ9A 2BYSA 4TNWA 4Z91A 5HCJA 3U8MA 5L4EA 3SQ9A 5J5HA 4IL9A 3TLVA 5HCMA 4X5TA 5J5FA 5LXBA 4QH1A 5SYOA 3SQ6A 2PGZA 3RI5A 2WN9A 4HFIA 4UY2A 3SH1A 3RIFA 5J5GA 3UQ7A 5CFBA 2X00D 4ILBA 4ZJTA 5BW2A 4A97A 3UUBA 3UU5A 4HFEA 4HFDA 4ZR6A 2C9TA 4BFQA 4ILAA 2BR8A 5IUXA 4UM3A 3RQWA 4ZZBA 4LMLA 2XQAA 3UU3A 2XQ7A 3UU4A 2XQ8A 5AINA 3WIPA 5BRXA 5HEHA 3UU8A 3GUAA 5TVCA 5HEOA 3UQ4A 3U8JA 5AFKA 2BYPA 3ZDHA 3WTKA 2YKSA 3WTOA 3T4MA 4HFCA 4D01A 4UM1A 5HEUA 5AFNA 4BQTA 3WTJA 4EZ1A 3EHZA 4HFHA 5FJVA 1I9BA 4COFA 4DBMA 3PEOA 2YOEA 2Y54A 4B5DA 3JAFA 4Z90A 3JADA 2XQ5A 1UV6A 4LMKA 4QABA 2BG9E 2Y57A 5HEJA 2BG9A 2UZ6A 3RQUA 2PH9A 1UX2A 2BG9B 4ALXA 2X00A 4NPPA 2XYSA 4ILCA 3TLWA 4HQPA 4ZK4A 4QH5A 4QACA 2W8FA 4LMJA 4TWFA 5LG3A 5J0ZA 2YMEA 4FRRA 2Y7YA 2XNUA 2BYNA 4A98A 4QH4A 4TWDA 3SIOA 5L47A 4UXUA 2BYQA 4IL4A 3TLUA 5AFJA 3PMZA 3TLTA 4ZRUA 3ZDGA 3RIAA 2QC1B 4ZZCA 5KZUA 3JAEA 4NZBA 2ZJVA 2BYRA 3C79A 4HFBA 5CO5A 3ZKRA 3LSVA 3U8NA 3C84A 3U8LA 4UM3S 4QAAA 2XQ3A 5AFMA 5BP0A 3RHWA 2XZ5A 3U8KA 3P4WA 5AFMB 2XQ6A 4WV9A 2WNCA 3EAMA 4AFGA 2W8GA 3WTIA 2Y58A 5L4HA 2YMDA 2XYTA 4XK9A 2BG9C 4TNVA 4AFTA 4ZK1A 5AFHA 2YN6A 2BR7A 2Y56A 5JMEA 3WTNA 4ZJSA 4IREA 2ZJUA
chains in the Genus database with same CATH topology
3WTMA 2XNVA 4XHEA 4TWHA 4UM3P 2XNTA 4F8HA 2XQ4A 3WTHA 2VL0A 3TLSA 5J5IA 1UW6A 5HEGA 3IGQA 5KE4A 4PIRA 2WNLA 3UU6A 2BJ0A 3WTLA 3EI0A 5AFLA 2WNJA 3P50A 2WZYA 2XZ6A 4AFHA 2XQ9A 2BYSA 4TNWA 4Z91A 5HCJA 3U8MA 5L4EA 3SQ9A 5J5HA 4IL9A 3TLVA 5HCMA 4X5TA 5J5FA 5LXBA 4QH1A 5SYOA 3SQ6A 2PGZA 3RI5A 2WN9A 4HFIA 4UY2A 3SH1A 3RIFA 5J5GA 3UQ7A 5CFBA 2X00D 4ILBA 4ZJTA 5BW2A 4A97A 3UUBA 3UU5A 4HFEA 4HFDA 4ZR6A 2C9TA 4BFQA 4ILAA 2BR8A 5IUXA 4UM3A 3RQWA 4ZZBA 4LMLA 2XQAA 3UU3A 2XQ7A 3UU4A 2XQ8A 5AINA 3WIPA 5BRXA 5HEHA 3UU8A 3GUAA 5TVCA 5HEOA 3UQ4A 3U8JA 5AFKA 2BYPA 3ZDHA 3WTKA 2YKSA 3WTOA 3T4MA 4HFCA 4D01A 4UM1A 5HEUA 5AFNA 4BQTA 3WTJA 4EZ1A 3EHZA 4HFHA 5FJVA 1I9BA 4COFA 4DBMA 3PEOA 2YOEA 2Y54A 4B5DA 3JAFA 4Z90A 3JADA 2XQ5A 1UV6A 4LMKA 4QABA 2BG9E 2Y57A 5HEJA 2BG9A 2UZ6A 3RQUA 2PH9A 1UX2A 2BG9B 4ALXA 2X00A 4NPPA 2XYSA 4ILCA 3TLWA 4HQPA 4ZK4A 4QH5A 4QACA 2W8FA 4LMJA 4TWFA 5LG3A 5J0ZA 2YMEA 4FRRA 2Y7YA 2XNUA 2BYNA 4A98A 4QH4A 4TWDA 3SIOA 5L47A 4UXUA 2BYQA 4IL4A 3TLUA 5AFJA 3PMZA 3TLTA 4ZRUA 3ZDGA 3RIAA 2QC1B 4ZZCA 5KZUA 3JAEA 4NZBA 2ZJVA 2BYRA 3C79A 4HFBA 5CO5A 3ZKRA 3LSVA 3U8NA 3C84A 3U8LA 4UM3S 4QAAA 2XQ3A 5AFMA 5BP0A 3RHWA 2XZ5A 3U8KA 3P4WA 5AFMB 2XQ6A 4WV9A 2WNCA 3EAMA 4AFGA 2W8GA 3WTIA 2Y58A 5L4HA 2YMDA 2XYTA 4XK9A 2BG9C 4TNVA 4AFTA 4ZK1A 5AFHA 2YN6A 2BR7A 2Y56A 5JMEA 3WTNA 4ZJSA 4IREA 2ZJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTM A;  2XNV A;  4XHE A;  4TWH A;  4UM3 P;  2XNT A;  4F8H A;  2XQ4 A;  3WTH A;  2VL0 A;  3TLS A;  5J5I A;  1UW6 A;  5HEG A;  3IGQ A;  5KE4 A;  4PIR A;  2WNL A;  3UU6 A;  2BJ0 A;  3WTL A;  3EI0 A;  5AFL A;  2WNJ A;  3P50 A;  2WZY A;  2XZ6 A;  4AFH A;  2XQ9 A;  2BYS A;  4TNW A;  4Z91 A;  5HCJ A;  3U8M A;  5L4E A;  3SQ9 A;  5J5H A;  4IL9 A;  3TLV A;  5HCM A;  4X5T A;  5J5F A;  5LXB A;  4QH1 A;  5SYO A;  3SQ6 A;  2PGZ A;  3RI5 A;  2WN9 A;  4HFI A;  4UY2 A;  3SH1 A;  3RIF A;  5J5G A;  3UQ7 A;  5CFB A;  2X00 D;  4ILB A;  4ZJT A;  5BW2 A;  4A97 A;  3UUB A;  3UU5 A;  4HFE A;  4HFD A;  4ZR6 A;  2C9T A;  4BFQ A;  4ILA A;  2BR8 A;  5IUX A;  4UM3 A;  3RQW A;  4ZZB A;  4LML A;  2XQA A;  3UU3 A;  2XQ7 A;  3UU4 A;  2XQ8 A;  5AIN A;  3WIP A;  5BRX A;  5HEH A;  3UU8 A;  3GUA A;  5TVC A;  5HEO A;  3UQ4 A;  3U8J A;  5AFK A;  2BYP A;  3ZDH A;  3WTK A;  2YKS A;  3WTO A;  3T4M A;  4HFC A;  4D01 A;  4UM1 A;  5HEU A;  5AFN A;  4BQT A;  3WTJ A;  4EZ1 A;  3EHZ A;  4HFH A;  5FJV A;  1I9B A;  4COF A;  4DBM A;  3PEO A;  2YOE A;  2Y54 A;  4B5D A;  3JAF A;  4Z90 A;  3JAD A;  2XQ5 A;  1UV6 A;  4LMK A;  4QAB A;  2BG9 E;  2Y57 A;  5HEJ A;  2BG9 A;  2UZ6 A;  3RQU A;  2PH9 A;  1UX2 A;  2BG9 B;  4ALX A;  2X00 A;  4NPP A;  2XYS A;  4ILC A;  3TLW A;  4HQP A;  4ZK4 A;  4QH5 A;  4QAC A;  2W8F A;  4LMJ A;  4TWF A;  5LG3 A;  5J0Z A;  2YME A;  4FRR A;  2Y7Y A;  2XNU A;  2BYN A;  4A98 A;  4QH4 A;  4TWD A;  3SIO A;  5L47 A;  4UXU A;  2BYQ A;  4IL4 A;  3TLU A;  5AFJ A;  3PMZ A;  3TLT A;  4ZRU A;  3ZDG A;  3RIA A;  2QC1 B;  4ZZC A;  5KZU A;  3JAE A;  4NZB A;  2ZJV A;  2BYR A;  3C79 A;  4HFB A;  5CO5 A;  3ZKR A;  3LSV A;  3U8N A;  3C84 A;  3U8L A;  4UM3 S;  4QAA A;  2XQ3 A;  5AFM A;  5BP0 A;  3RHW A;  2XZ5 A;  3U8K A;  3P4W A;  5AFM B;  2XQ6 A;  4WV9 A;  2WNC A;  3EAM A;  4AFG A;  2W8G A;  3WTI A;  2Y58 A;  5L4H A;  2YMD A;  2XYT A;  4XK9 A;  2BG9 C;  4TNV A;  4AFT A;  4ZK1 A;  5AFH A;  2YN6 A;  2BR7 A;  2Y56 A;  5JME A;  3WTN A;  4ZJS A;  4IRE A;  2ZJU A; 
#chains in the Genus database with same CATH topology
 3WTM A;  2XNV A;  4XHE A;  4TWH A;  4UM3 P;  2XNT A;  4F8H A;  2XQ4 A;  3WTH A;  2VL0 A;  3TLS A;  5J5I A;  1UW6 A;  5HEG A;  3IGQ A;  5KE4 A;  4PIR A;  2WNL A;  3UU6 A;  2BJ0 A;  3WTL A;  3EI0 A;  5AFL A;  2WNJ A;  3P50 A;  2WZY A;  2XZ6 A;  4AFH A;  2XQ9 A;  2BYS A;  4TNW A;  4Z91 A;  5HCJ A;  3U8M A;  5L4E A;  3SQ9 A;  5J5H A;  4IL9 A;  3TLV A;  5HCM A;  4X5T A;  5J5F A;  5LXB A;  4QH1 A;  5SYO A;  3SQ6 A;  2PGZ A;  3RI5 A;  2WN9 A;  4HFI A;  4UY2 A;  3SH1 A;  3RIF A;  5J5G A;  3UQ7 A;  5CFB A;  2X00 D;  4ILB A;  4ZJT A;  5BW2 A;  4A97 A;  3UUB A;  3UU5 A;  4HFE A;  4HFD A;  4ZR6 A;  2C9T A;  4BFQ A;  4ILA A;  2BR8 A;  5IUX A;  4UM3 A;  3RQW A;  4ZZB A;  4LML A;  2XQA A;  3UU3 A;  2XQ7 A;  3UU4 A;  2XQ8 A;  5AIN A;  3WIP A;  5BRX A;  5HEH A;  3UU8 A;  3GUA A;  5TVC A;  5HEO A;  3UQ4 A;  3U8J A;  5AFK A;  2BYP A;  3ZDH A;  3WTK A;  2YKS A;  3WTO A;  3T4M A;  4HFC A;  4D01 A;  4UM1 A;  5HEU A;  5AFN A;  4BQT A;  3WTJ A;  4EZ1 A;  3EHZ A;  4HFH A;  5FJV A;  1I9B A;  4COF A;  4DBM A;  3PEO A;  2YOE A;  2Y54 A;  4B5D A;  3JAF A;  4Z90 A;  3JAD A;  2XQ5 A;  1UV6 A;  4LMK A;  4QAB A;  2BG9 E;  2Y57 A;  5HEJ A;  2BG9 A;  2UZ6 A;  3RQU A;  2PH9 A;  1UX2 A;  2BG9 B;  4ALX A;  2X00 A;  4NPP A;  2XYS A;  4ILC A;  3TLW A;  4HQP A;  4ZK4 A;  4QH5 A;  4QAC A;  2W8F A;  4LMJ A;  4TWF A;  5LG3 A;  5J0Z A;  2YME A;  4FRR A;  2Y7Y A;  2XNU A;  2BYN A;  4A98 A;  4QH4 A;  4TWD A;  3SIO A;  5L47 A;  4UXU A;  2BYQ A;  4IL4 A;  3TLU A;  5AFJ A;  3PMZ A;  3TLT A;  4ZRU A;  3ZDG A;  3RIA A;  2QC1 B;  4ZZC A;  5KZU A;  3JAE A;  4NZB A;  2ZJV A;  2BYR A;  3C79 A;  4HFB A;  5CO5 A;  3ZKR A;  3LSV A;  3U8N A;  3C84 A;  3U8L A;  4UM3 S;  4QAA A;  2XQ3 A;  5AFM A;  5BP0 A;  3RHW A;  2XZ5 A;  3U8K A;  3P4W A;  5AFM B;  2XQ6 A;  4WV9 A;  2WNC A;  3EAM A;  4AFG A;  2W8G A;  3WTI A;  2Y58 A;  5L4H A;  2YMD A;  2XYT A;  4XK9 A;  2BG9 C;  4TNV A;  4AFT A;  4ZK1 A;  5AFH A;  2YN6 A;  2BR7 A;  2Y56 A;  5JME A;  3WTN A;  4ZJS A;  4IRE A;  2ZJU A; 
#chains in the Genus database with same CATH homology
 3WTM A;  2XNV A;  4XHE A;  4TWH A;  4UM3 P;  2XNT A;  4F8H A;  2XQ4 A;  3WTH A;  2VL0 A;  3TLS A;  5J5I A;  1UW6 A;  5HEG A;  3IGQ A;  5KE4 A;  4PIR A;  2WNL A;  3UU6 A;  2BJ0 A;  3WTL A;  3EI0 A;  5AFL A;  2WNJ A;  3P50 A;  2WZY A;  2XZ6 A;  4AFH A;  2XQ9 A;  2BYS A;  4TNW A;  4Z91 A;  5HCJ A;  3U8M A;  5L4E A;  3SQ9 A;  5J5H A;  4IL9 A;  3TLV A;  5HCM A;  4X5T A;  5J5F A;  5LXB A;  4QH1 A;  5SYO A;  3SQ6 A;  2PGZ A;  3RI5 A;  2WN9 A;  4HFI A;  4UY2 A;  3SH1 A;  3RIF A;  5J5G A;  3UQ7 A;  5CFB A;  2X00 D;  4ILB A;  4ZJT A;  5BW2 A;  4A97 A;  3UUB A;  3UU5 A;  4HFE A;  4HFD A;  4ZR6 A;  2C9T A;  4BFQ A;  4ILA A;  2BR8 A;  5IUX A;  4UM3 A;  3RQW A;  4ZZB A;  4LML A;  2XQA A;  3UU3 A;  2XQ7 A;  3UU4 A;  2XQ8 A;  5AIN A;  3WIP A;  5BRX A;  5HEH A;  3UU8 A;  3GUA A;  5TVC A;  5HEO A;  3UQ4 A;  3U8J A;  5AFK A;  2BYP A;  3ZDH A;  3WTK A;  2YKS A;  3WTO A;  3T4M A;  4HFC A;  4D01 A;  4UM1 A;  5HEU A;  5AFN A;  4BQT A;  3WTJ A;  4EZ1 A;  3EHZ A;  4HFH A;  5FJV A;  1I9B A;  4COF A;  4DBM A;  3PEO A;  2YOE A;  2Y54 A;  4B5D A;  3JAF A;  4Z90 A;  3JAD A;  2XQ5 A;  1UV6 A;  4LMK A;  4QAB A;  2BG9 E;  2Y57 A;  5HEJ A;  2BG9 A;  2UZ6 A;  3RQU A;  2PH9 A;  1UX2 A;  2BG9 B;  4ALX A;  2X00 A;  4NPP A;  2XYS A;  4ILC A;  3TLW A;  4HQP A;  4ZK4 A;  4QH5 A;  4QAC A;  2W8F A;  4LMJ A;  4TWF A;  5LG3 A;  5J0Z A;  2YME A;  4FRR A;  2Y7Y A;  2XNU A;  2BYN A;  4A98 A;  4QH4 A;  4TWD A;  3SIO A;  5L47 A;  4UXU A;  2BYQ A;  4IL4 A;  3TLU A;  5AFJ A;  3PMZ A;  3TLT A;  4ZRU A;  3ZDG A;  3RIA A;  2QC1 B;  4ZZC A;  5KZU A;  3JAE A;  4NZB A;  2ZJV A;  2BYR A;  3C79 A;  4HFB A;  5CO5 A;  3ZKR A;  3LSV A;  3U8N A;  3C84 A;  3U8L A;  4UM3 S;  4QAA A;  2XQ3 A;  5AFM A;  5BP0 A;  3RHW A;  2XZ5 A;  3U8K A;  3P4W A;  5AFM B;  2XQ6 A;  4WV9 A;  2WNC A;  3EAM A;  4AFG A;  2W8G A;  3WTI A;  2Y58 A;  5L4H A;  2YMD A;  2XYT A;  4XK9 A;  2BG9 C;  4TNV A;  4AFT A;  4ZK1 A;  5AFH A;  2YN6 A;  2BR7 A;  2Y56 A;  5JME A;  3WTN A;  4ZJS A;  4IRE A;  2ZJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...