4XHEA

Crystal structure of a-achbp in complex with pinnatoxin a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
216
structure length
216
Chain Sequence
YKDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein
molecule keywords Soluble acetylcholine receptor
publication title Marine Macrocyclic Imines, Pinnatoxins A and G: Structural Determinants and Functional Properties to Distinguish Neuronal alpha 7 from Muscle alpha 12 beta gamma delta nAChRs.
pubmed doi rcsb
source organism Aplysia californica
total genus 58
structure length 216
sequence length 216
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4xheA00
2YKSA 3ZKRA 2BG9B 3WTIA 2UZ6A 3ZDGA 2WN9A 2W8FA 3UU3A 5L4EA 4ZJSA 2XYTA 5AFJA 2XZ5A 3PEOA 4TWDA 5AINA 4LMJA 2PH9A 3RQUA 4UM3A 3P50A 4UM1A 3U8LA 3WTMA 5J5FA 5HCMA 2XQ9A 4HFIA 4LMLA 3SIOA 4Z90A 3UU8A 3U8MA 4TNWA 3UU4A 4ILBA 3U8KA 5AFMA 4HFHA 4QACA 5HEHA 5LXBA 3WTKA 4FRRA 3JADA 2BYSA 5AFKA 4ZRUA 1UV6A 5CO5A 2Y58A 4AFHA 4QH1A 4UXUA 2XQ8A 3UUBA 2XQ4A 5LG3A 4UM3S 2X00D 4QH4A 4WV9A 3WTOA 2ZJVA 5HEGA 4ZJTA 2XQ3A 2XQ5A 1I9BA 4ZZBA 2VL0A 4A97A 5AFMB 3LSVA 4COFA 4ILAA 2BJ0A 2WNLA 4HQPA 4ZR6A 4LMKA 3WTHA 3T4MA 5JMEA 3EI0A 2ZJUA 2BR8A 4HFBA 3JAEA 2YN6A 2XZ6A 5TVCA 3TLTA 4F8HA 3RIFA 3TLWA 5KZUA 2BYNA 3U8JA 5BP0A 4ZK1A 3SQ9A 2XNTA 2Y54A 4Z91A 5SYOA 3UU5A 3WTJA 5IUXA 2XNUA 4B5DA 4D01A 3JAFA 3ZDHA 3RQWA 4IL9A 2W8GA 2Y56A 3EHZA 2Y57A 5L47A 4BQTA 2BG9E 4PIRA 4XHEA 4HFCA 3RIAA 2XQAA 5FJVA 3C79A 5KE4A 5J5GA 2BYRA 5AFNA 5BRXA 4UY2A 3UQ7A 5HEUA 4AFTA 4QAAA 3SQ6A 5J0ZA 4A98A 4DBMA 4IREA 2WNCA 5HCJA 4HFEA 4EZ1A 2WNJA 4TWFA 4ZZCA 5AFLA 5CFBA 2BYPA 3C84A 2Y7YA 4TWHA 5HEOA 2XYSA 4ZK4A 4XK9A 2YMDA 1UX2A 2YMEA 4ILCA 4NZBA 4TNVA 3PMZA 3WTNA 3WTLA 4QH5A 5J5HA 4ALXA 2X00A 4X5TA 2C9TA 3TLUA 4HFDA 5L4HA 5AFHA 3U8NA 2BG9A 5HEJA 2QC1B 4AFGA 3RHWA 3TLVA 3P4WA 3SH1A 3UQ4A 2BR7A 3GUAA 4IL4A 3UU6A 2BG9C 2YOEA 4BFQA 2XNVA 4UM3P 3TLSA 1UW6A 5BW2A 2XQ7A 5J5IA 2PGZA 4NPPA 3RI5A 3IGQA 2BYQA 3EAMA 2WZYA 2XQ6A 4QABA 3WIPA
chains in the Genus database with same CATH superfamily
2YKSA 3ZKRA 2BG9B 3WTIA 2UZ6A 3ZDGA 2WN9A 2W8FA 3UU3A 5L4EA 4ZJSA 2XYTA 5AFJA 2XZ5A 3PEOA 4TWDA 5AINA 4LMJA 2PH9A 3RQUA 4UM3A 3P50A 4UM1A 3U8LA 3WTMA 5J5FA 5HCMA 2XQ9A 4HFIA 4LMLA 3SIOA 4Z90A 3UU8A 3U8MA 4TNWA 3UU4A 4ILBA 3U8KA 5AFMA 4HFHA 4QACA 5HEHA 5LXBA 3WTKA 4FRRA 3JADA 2BYSA 5AFKA 4ZRUA 1UV6A 5CO5A 2Y58A 4AFHA 4QH1A 4UXUA 2XQ8A 3UUBA 2XQ4A 5LG3A 4UM3S 2X00D 4QH4A 4WV9A 3WTOA 2ZJVA 5HEGA 4ZJTA 2XQ3A 2XQ5A 1I9BA 4ZZBA 2VL0A 4A97A 5AFMB 3LSVA 4COFA 4ILAA 2BJ0A 2WNLA 4HQPA 4ZR6A 4LMKA 3WTHA 3T4MA 5JMEA 3EI0A 2ZJUA 2BR8A 4HFBA 3JAEA 2YN6A 2XZ6A 5TVCA 3TLTA 4F8HA 3RIFA 3TLWA 5KZUA 2BYNA 3U8JA 5BP0A 4ZK1A 3SQ9A 2XNTA 2Y54A 4Z91A 5SYOA 3UU5A 3WTJA 5IUXA 2XNUA 4B5DA 4D01A 3JAFA 3ZDHA 3RQWA 4IL9A 2W8GA 2Y56A 3EHZA 2Y57A 5L47A 4BQTA 2BG9E 4PIRA 4XHEA 4HFCA 3RIAA 2XQAA 5FJVA 3C79A 5KE4A 5J5GA 2BYRA 5AFNA 5BRXA 4UY2A 3UQ7A 5HEUA 4AFTA 4QAAA 3SQ6A 5J0ZA 4A98A 4DBMA 4IREA 2WNCA 5HCJA 4HFEA 4EZ1A 2WNJA 4TWFA 4ZZCA 5AFLA 5CFBA 2BYPA 3C84A 2Y7YA 4TWHA 5HEOA 2XYSA 4ZK4A 4XK9A 2YMDA 1UX2A 2YMEA 4ILCA 4NZBA 4TNVA 3PMZA 3WTNA 3WTLA 4QH5A 5J5HA 4ALXA 2X00A 4X5TA 2C9TA 3TLUA 4HFDA 5L4HA 5AFHA 3U8NA 2BG9A 5HEJA 2QC1B 4AFGA 3RHWA 3TLVA 3P4WA 3SH1A 3UQ4A 2BR7A 3GUAA 4IL4A 3UU6A 2BG9C 2YOEA 4BFQA 2XNVA 4UM3P 3TLSA 1UW6A 5BW2A 2XQ7A 5J5IA 2PGZA 4NPPA 3RI5A 3IGQA 2BYQA 3EAMA 2WZYA 2XQ6A 4QABA 3WIPA
chains in the Genus database with same CATH topology
2YKSA 3ZKRA 2BG9B 3WTIA 2UZ6A 3ZDGA 2WN9A 2W8FA 3UU3A 5L4EA 4ZJSA 2XYTA 5AFJA 2XZ5A 3PEOA 4TWDA 5AINA 4LMJA 2PH9A 3RQUA 4UM3A 3P50A 4UM1A 3U8LA 3WTMA 5J5FA 5HCMA 2XQ9A 4HFIA 4LMLA 3SIOA 4Z90A 3UU8A 3U8MA 4TNWA 3UU4A 4ILBA 3U8KA 5AFMA 4HFHA 4QACA 5HEHA 5LXBA 3WTKA 4FRRA 3JADA 2BYSA 5AFKA 4ZRUA 1UV6A 5CO5A 2Y58A 4AFHA 4QH1A 4UXUA 2XQ8A 3UUBA 2XQ4A 5LG3A 4UM3S 2X00D 4QH4A 4WV9A 3WTOA 2ZJVA 5HEGA 4ZJTA 2XQ3A 2XQ5A 1I9BA 4ZZBA 2VL0A 4A97A 5AFMB 3LSVA 4COFA 4ILAA 2BJ0A 2WNLA 4HQPA 4ZR6A 4LMKA 3WTHA 3T4MA 5JMEA 3EI0A 2ZJUA 2BR8A 4HFBA 3JAEA 2YN6A 2XZ6A 5TVCA 3TLTA 4F8HA 3RIFA 3TLWA 5KZUA 2BYNA 3U8JA 5BP0A 4ZK1A 3SQ9A 2XNTA 2Y54A 4Z91A 5SYOA 3UU5A 3WTJA 5IUXA 2XNUA 4B5DA 4D01A 3JAFA 3ZDHA 3RQWA 4IL9A 2W8GA 2Y56A 3EHZA 2Y57A 5L47A 4BQTA 2BG9E 4PIRA 4XHEA 4HFCA 3RIAA 2XQAA 5FJVA 3C79A 5KE4A 5J5GA 2BYRA 5AFNA 5BRXA 4UY2A 3UQ7A 5HEUA 4AFTA 4QAAA 3SQ6A 5J0ZA 4A98A 4DBMA 4IREA 2WNCA 5HCJA 4HFEA 4EZ1A 2WNJA 4TWFA 4ZZCA 5AFLA 5CFBA 2BYPA 3C84A 2Y7YA 4TWHA 5HEOA 2XYSA 4ZK4A 4XK9A 2YMDA 1UX2A 2YMEA 4ILCA 4NZBA 4TNVA 3PMZA 3WTNA 3WTLA 4QH5A 5J5HA 4ALXA 2X00A 4X5TA 2C9TA 3TLUA 4HFDA 5L4HA 5AFHA 3U8NA 2BG9A 5HEJA 2QC1B 4AFGA 3RHWA 3TLVA 3P4WA 3SH1A 3UQ4A 2BR7A 3GUAA 4IL4A 3UU6A 2BG9C 2YOEA 4BFQA 2XNVA 4UM3P 3TLSA 1UW6A 5BW2A 2XQ7A 5J5IA 2PGZA 4NPPA 3RI5A 3IGQA 2BYQA 3EAMA 2WZYA 2XQ6A 4QABA 3WIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKS A;  3ZKR A;  2BG9 B;  3WTI A;  2UZ6 A;  3ZDG A;  2WN9 A;  2W8F A;  3UU3 A;  5L4E A;  4ZJS A;  2XYT A;  5AFJ A;  2XZ5 A;  3PEO A;  4TWD A;  5AIN A;  4LMJ A;  2PH9 A;  3RQU A;  4UM3 A;  3P50 A;  4UM1 A;  3U8L A;  3WTM A;  5J5F A;  5HCM A;  2XQ9 A;  4HFI A;  4LML A;  3SIO A;  4Z90 A;  3UU8 A;  3U8M A;  4TNW A;  3UU4 A;  4ILB A;  3U8K A;  5AFM A;  4HFH A;  4QAC A;  5HEH A;  5LXB A;  3WTK A;  4FRR A;  3JAD A;  2BYS A;  5AFK A;  4ZRU A;  1UV6 A;  5CO5 A;  2Y58 A;  4AFH A;  4QH1 A;  4UXU A;  2XQ8 A;  3UUB A;  2XQ4 A;  5LG3 A;  4UM3 S;  2X00 D;  4QH4 A;  4WV9 A;  3WTO A;  2ZJV A;  5HEG A;  4ZJT A;  2XQ3 A;  2XQ5 A;  1I9B A;  4ZZB A;  2VL0 A;  4A97 A;  5AFM B;  3LSV A;  4COF A;  4ILA A;  2BJ0 A;  2WNL A;  4HQP A;  4ZR6 A;  4LMK A;  3WTH A;  3T4M A;  5JME A;  3EI0 A;  2ZJU A;  2BR8 A;  4HFB A;  3JAE A;  2YN6 A;  2XZ6 A;  5TVC A;  3TLT A;  4F8H A;  3RIF A;  3TLW A;  5KZU A;  2BYN A;  3U8J A;  5BP0 A;  4ZK1 A;  3SQ9 A;  2XNT A;  2Y54 A;  4Z91 A;  5SYO A;  3UU5 A;  3WTJ A;  5IUX A;  2XNU A;  4B5D A;  4D01 A;  3JAF A;  3ZDH A;  3RQW A;  4IL9 A;  2W8G A;  2Y56 A;  3EHZ A;  2Y57 A;  5L47 A;  4BQT A;  2BG9 E;  4PIR A;  4XHE A;  4HFC A;  3RIA A;  2XQA A;  5FJV A;  3C79 A;  5KE4 A;  5J5G A;  2BYR A;  5AFN A;  5BRX A;  4UY2 A;  3UQ7 A;  5HEU A;  4AFT A;  4QAA A;  3SQ6 A;  5J0Z A;  4A98 A;  4DBM A;  4IRE A;  2WNC A;  5HCJ A;  4HFE A;  4EZ1 A;  2WNJ A;  4TWF A;  4ZZC A;  5AFL A;  5CFB A;  2BYP A;  3C84 A;  2Y7Y A;  4TWH A;  5HEO A;  2XYS A;  4ZK4 A;  4XK9 A;  2YMD A;  1UX2 A;  2YME A;  4ILC A;  4NZB A;  4TNV A;  3PMZ A;  3WTN A;  3WTL A;  4QH5 A;  5J5H A;  4ALX A;  2X00 A;  4X5T A;  2C9T A;  3TLU A;  4HFD A;  5L4H A;  5AFH A;  3U8N A;  2BG9 A;  5HEJ A;  2QC1 B;  4AFG A;  3RHW A;  3TLV A;  3P4W A;  3SH1 A;  3UQ4 A;  2BR7 A;  3GUA A;  4IL4 A;  3UU6 A;  2BG9 C;  2YOE A;  4BFQ A;  2XNV A;  4UM3 P;  3TLS A;  1UW6 A;  5BW2 A;  2XQ7 A;  5J5I A;  2PGZ A;  4NPP A;  3RI5 A;  3IGQ A;  2BYQ A;  3EAM A;  2WZY A;  2XQ6 A;  4QAB A;  3WIP A; 
#chains in the Genus database with same CATH topology
 2YKS A;  3ZKR A;  2BG9 B;  3WTI A;  2UZ6 A;  3ZDG A;  2WN9 A;  2W8F A;  3UU3 A;  5L4E A;  4ZJS A;  2XYT A;  5AFJ A;  2XZ5 A;  3PEO A;  4TWD A;  5AIN A;  4LMJ A;  2PH9 A;  3RQU A;  4UM3 A;  3P50 A;  4UM1 A;  3U8L A;  3WTM A;  5J5F A;  5HCM A;  2XQ9 A;  4HFI A;  4LML A;  3SIO A;  4Z90 A;  3UU8 A;  3U8M A;  4TNW A;  3UU4 A;  4ILB A;  3U8K A;  5AFM A;  4HFH A;  4QAC A;  5HEH A;  5LXB A;  3WTK A;  4FRR A;  3JAD A;  2BYS A;  5AFK A;  4ZRU A;  1UV6 A;  5CO5 A;  2Y58 A;  4AFH A;  4QH1 A;  4UXU A;  2XQ8 A;  3UUB A;  2XQ4 A;  5LG3 A;  4UM3 S;  2X00 D;  4QH4 A;  4WV9 A;  3WTO A;  2ZJV A;  5HEG A;  4ZJT A;  2XQ3 A;  2XQ5 A;  1I9B A;  4ZZB A;  2VL0 A;  4A97 A;  5AFM B;  3LSV A;  4COF A;  4ILA A;  2BJ0 A;  2WNL A;  4HQP A;  4ZR6 A;  4LMK A;  3WTH A;  3T4M A;  5JME A;  3EI0 A;  2ZJU A;  2BR8 A;  4HFB A;  3JAE A;  2YN6 A;  2XZ6 A;  5TVC A;  3TLT A;  4F8H A;  3RIF A;  3TLW A;  5KZU A;  2BYN A;  3U8J A;  5BP0 A;  4ZK1 A;  3SQ9 A;  2XNT A;  2Y54 A;  4Z91 A;  5SYO A;  3UU5 A;  3WTJ A;  5IUX A;  2XNU A;  4B5D A;  4D01 A;  3JAF A;  3ZDH A;  3RQW A;  4IL9 A;  2W8G A;  2Y56 A;  3EHZ A;  2Y57 A;  5L47 A;  4BQT A;  2BG9 E;  4PIR A;  4XHE A;  4HFC A;  3RIA A;  2XQA A;  5FJV A;  3C79 A;  5KE4 A;  5J5G A;  2BYR A;  5AFN A;  5BRX A;  4UY2 A;  3UQ7 A;  5HEU A;  4AFT A;  4QAA A;  3SQ6 A;  5J0Z A;  4A98 A;  4DBM A;  4IRE A;  2WNC A;  5HCJ A;  4HFE A;  4EZ1 A;  2WNJ A;  4TWF A;  4ZZC A;  5AFL A;  5CFB A;  2BYP A;  3C84 A;  2Y7Y A;  4TWH A;  5HEO A;  2XYS A;  4ZK4 A;  4XK9 A;  2YMD A;  1UX2 A;  2YME A;  4ILC A;  4NZB A;  4TNV A;  3PMZ A;  3WTN A;  3WTL A;  4QH5 A;  5J5H A;  4ALX A;  2X00 A;  4X5T A;  2C9T A;  3TLU A;  4HFD A;  5L4H A;  5AFH A;  3U8N A;  2BG9 A;  5HEJ A;  2QC1 B;  4AFG A;  3RHW A;  3TLV A;  3P4W A;  3SH1 A;  3UQ4 A;  2BR7 A;  3GUA A;  4IL4 A;  3UU6 A;  2BG9 C;  2YOE A;  4BFQ A;  2XNV A;  4UM3 P;  3TLS A;  1UW6 A;  5BW2 A;  2XQ7 A;  5J5I A;  2PGZ A;  4NPP A;  3RI5 A;  3IGQ A;  2BYQ A;  3EAM A;  2WZY A;  2XQ6 A;  4QAB A;  3WIP A; 
#chains in the Genus database with same CATH homology
 2YKS A;  3ZKR A;  2BG9 B;  3WTI A;  2UZ6 A;  3ZDG A;  2WN9 A;  2W8F A;  3UU3 A;  5L4E A;  4ZJS A;  2XYT A;  5AFJ A;  2XZ5 A;  3PEO A;  4TWD A;  5AIN A;  4LMJ A;  2PH9 A;  3RQU A;  4UM3 A;  3P50 A;  4UM1 A;  3U8L A;  3WTM A;  5J5F A;  5HCM A;  2XQ9 A;  4HFI A;  4LML A;  3SIO A;  4Z90 A;  3UU8 A;  3U8M A;  4TNW A;  3UU4 A;  4ILB A;  3U8K A;  5AFM A;  4HFH A;  4QAC A;  5HEH A;  5LXB A;  3WTK A;  4FRR A;  3JAD A;  2BYS A;  5AFK A;  4ZRU A;  1UV6 A;  5CO5 A;  2Y58 A;  4AFH A;  4QH1 A;  4UXU A;  2XQ8 A;  3UUB A;  2XQ4 A;  5LG3 A;  4UM3 S;  2X00 D;  4QH4 A;  4WV9 A;  3WTO A;  2ZJV A;  5HEG A;  4ZJT A;  2XQ3 A;  2XQ5 A;  1I9B A;  4ZZB A;  2VL0 A;  4A97 A;  5AFM B;  3LSV A;  4COF A;  4ILA A;  2BJ0 A;  2WNL A;  4HQP A;  4ZR6 A;  4LMK A;  3WTH A;  3T4M A;  5JME A;  3EI0 A;  2ZJU A;  2BR8 A;  4HFB A;  3JAE A;  2YN6 A;  2XZ6 A;  5TVC A;  3TLT A;  4F8H A;  3RIF A;  3TLW A;  5KZU A;  2BYN A;  3U8J A;  5BP0 A;  4ZK1 A;  3SQ9 A;  2XNT A;  2Y54 A;  4Z91 A;  5SYO A;  3UU5 A;  3WTJ A;  5IUX A;  2XNU A;  4B5D A;  4D01 A;  3JAF A;  3ZDH A;  3RQW A;  4IL9 A;  2W8G A;  2Y56 A;  3EHZ A;  2Y57 A;  5L47 A;  4BQT A;  2BG9 E;  4PIR A;  4XHE A;  4HFC A;  3RIA A;  2XQA A;  5FJV A;  3C79 A;  5KE4 A;  5J5G A;  2BYR A;  5AFN A;  5BRX A;  4UY2 A;  3UQ7 A;  5HEU A;  4AFT A;  4QAA A;  3SQ6 A;  5J0Z A;  4A98 A;  4DBM A;  4IRE A;  2WNC A;  5HCJ A;  4HFE A;  4EZ1 A;  2WNJ A;  4TWF A;  4ZZC A;  5AFL A;  5CFB A;  2BYP A;  3C84 A;  2Y7Y A;  4TWH A;  5HEO A;  2XYS A;  4ZK4 A;  4XK9 A;  2YMD A;  1UX2 A;  2YME A;  4ILC A;  4NZB A;  4TNV A;  3PMZ A;  3WTN A;  3WTL A;  4QH5 A;  5J5H A;  4ALX A;  2X00 A;  4X5T A;  2C9T A;  3TLU A;  4HFD A;  5L4H A;  5AFH A;  3U8N A;  2BG9 A;  5HEJ A;  2QC1 B;  4AFG A;  3RHW A;  3TLV A;  3P4W A;  3SH1 A;  3UQ4 A;  2BR7 A;  3GUA A;  4IL4 A;  3UU6 A;  2BG9 C;  2YOE A;  4BFQ A;  2XNV A;  4UM3 P;  3TLS A;  1UW6 A;  5BW2 A;  2XQ7 A;  5J5I A;  2PGZ A;  4NPP A;  3RI5 A;  3IGQ A;  2BYQ A;  3EAM A;  2WZY A;  2XQ6 A;  4QAB A;  3WIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...