4XHEA

Crystal structure of a-achbp in complex with pinnatoxin a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
216
structure length
216
Chain Sequence
YKDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Marine Macrocyclic Imines, Pinnatoxins A and G: Structural Determinants and Functional Properties to Distinguish Neuronal alpha 7 from Muscle alpha 12 beta gamma delta nAChRs.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Acetylcholine-binding protein
total genus 58
structure length 216
sequence length 216
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4xheA00
2XNVA 5JMEA 2XQ6A 5AFJA 2YMDA 3JAEA 3WTHA 4HQPA 2XYSA 3EI0A 3C84A 4ZJTA 5BW2A 4QABA 4ILBA 5BRXA 4EZ1A 4UM1A 4IREA 3UU3A 2UZ6A 4NZBA 4Z91A 2WNLA 2VL0A 2YN6A 3UUBA 2XQ9A 2BJ0A 2Y54A 2YOEA 3SH1A 4A97A 5AFMB 4BFQA 3WTNA 5J5FA 5KE4A 4UM3A 5J5GA 3UU8A 4TNVA 4B5DA 5LXBA 1UX2A 4D01A 5HEGA 2X00A 5L47A 2QC1B 3JAFA 3IGQA 3U8NA 2BYRA 3P50A 5HEJA 1UW6A 3PMZA 4NPPA 3UU5A 5TVCA 2BYNA 4WV9A 3U8MA 5HEUA 3ZDHA 4QH5A 5KZUA 4TWDA 4ZK4A 5BP0A 2BYPA 2XQ8A 3RQUA 4LMKA 4A98A 4AFHA 4ILAA 4Z90A 5LG3A 2BG9A 3T4MA 2YMEA 4PIRA 3RQWA 3WTJA 4UY2A 4XK9A 2YKSA 3RI5A 3RHWA 4X5TA 2XQ5A 3SQ9A 2Y56A 3TLUA 4IL9A 2BG9B 4QACA 3WTMA 5J5HA 2XZ5A 2BR7A 4LMLA 4ALXA 3UQ7A 5SYOA 3TLSA 2Y57A 4HFHA 4DBMA 3EHZA 4QAAA 4ZJSA 2X00D 3SQ6A 5AFHA 2BG9C 3ZDGA 3UQ4A 3JADA 3WTKA 5AINA 2XQ4A 4HFCA 2BYQA 3U8JA 3U8LA 3WTLA 4LMJA 2XNTA 3SIOA 4ZZCA 2ZJUA 1UV6A 2ZJVA 3GUAA 2XNUA 4AFTA 2BG9E 2W8GA 2XZ6A 4ZR6A 4HFBA 3WIPA 2BR8A 5J5IA 2PH9A 3TLTA 4QH1A 2Y58A 4XHEA 5AFLA 3C79A 5AFKA 3TLVA 4TWFA 4TNWA 2C9TA 4IL4A 5HCJA 5CFBA 5HEHA 4QH4A 2WNCA 5L4EA 3EAMA 3P4WA 2XYTA 3WTOA 2XQ7A 3U8KA 2XQAA 3UU4A 5AFNA 2WZYA 5HEOA 2PGZA 4FRRA 4TWHA 4UXUA 5AFMA 3WTIA 2XQ3A 4AFGA 2WNJA 1I9BA 4BQTA 2Y7YA 4HFIA 5HCMA 3RIAA 3RIFA 2W8FA 3UU6A 4COFA 4ZK1A 2BYSA 3PEOA 4UM3S 5CO5A 3LSVA 3TLWA 4HFDA 4HFEA 4ZRUA 5FJVA 4ILCA 3ZKRA 5J0ZA 4ZZBA 4UM3P 5L4HA 2WN9A 5IUXA 4F8HA
chains in the Genus database with same CATH superfamily
2XNVA 5JMEA 2XQ6A 5AFJA 2YMDA 3JAEA 3WTHA 4HQPA 2XYSA 3EI0A 3C84A 4ZJTA 5BW2A 4QABA 4ILBA 5BRXA 4EZ1A 4UM1A 4IREA 3UU3A 2UZ6A 4NZBA 4Z91A 2WNLA 2VL0A 2YN6A 3UUBA 2XQ9A 2BJ0A 2Y54A 2YOEA 3SH1A 4A97A 5AFMB 4BFQA 3WTNA 5J5FA 5KE4A 4UM3A 5J5GA 3UU8A 4TNVA 4B5DA 5LXBA 1UX2A 4D01A 5HEGA 2X00A 5L47A 2QC1B 3JAFA 3IGQA 3U8NA 2BYRA 3P50A 5HEJA 1UW6A 3PMZA 4NPPA 3UU5A 5TVCA 2BYNA 4WV9A 3U8MA 5HEUA 3ZDHA 4QH5A 5KZUA 4TWDA 4ZK4A 5BP0A 2BYPA 2XQ8A 3RQUA 4LMKA 4A98A 4AFHA 4ILAA 4Z90A 5LG3A 2BG9A 3T4MA 2YMEA 4PIRA 3RQWA 3WTJA 4UY2A 4XK9A 2YKSA 3RI5A 3RHWA 4X5TA 2XQ5A 3SQ9A 2Y56A 3TLUA 4IL9A 2BG9B 4QACA 3WTMA 5J5HA 2XZ5A 2BR7A 4LMLA 4ALXA 3UQ7A 5SYOA 3TLSA 2Y57A 4HFHA 4DBMA 3EHZA 4QAAA 4ZJSA 2X00D 3SQ6A 5AFHA 2BG9C 3ZDGA 3UQ4A 3JADA 3WTKA 5AINA 2XQ4A 4HFCA 2BYQA 3U8JA 3U8LA 3WTLA 4LMJA 2XNTA 3SIOA 4ZZCA 2ZJUA 1UV6A 2ZJVA 3GUAA 2XNUA 4AFTA 2BG9E 2W8GA 2XZ6A 4ZR6A 4HFBA 3WIPA 2BR8A 5J5IA 2PH9A 3TLTA 4QH1A 2Y58A 4XHEA 5AFLA 3C79A 5AFKA 3TLVA 4TWFA 4TNWA 2C9TA 4IL4A 5HCJA 5CFBA 5HEHA 4QH4A 2WNCA 5L4EA 3EAMA 3P4WA 2XYTA 3WTOA 2XQ7A 3U8KA 2XQAA 3UU4A 5AFNA 2WZYA 5HEOA 2PGZA 4FRRA 4TWHA 4UXUA 5AFMA 3WTIA 2XQ3A 4AFGA 2WNJA 1I9BA 4BQTA 2Y7YA 4HFIA 5HCMA 3RIAA 3RIFA 2W8FA 3UU6A 4COFA 4ZK1A 2BYSA 3PEOA 4UM3S 5CO5A 3LSVA 3TLWA 4HFDA 4HFEA 4ZRUA 5FJVA 4ILCA 3ZKRA 5J0ZA 4ZZBA 4UM3P 5L4HA 2WN9A 5IUXA 4F8HA
chains in the Genus database with same CATH topology
2XNVA 5JMEA 2XQ6A 5AFJA 2YMDA 3JAEA 3WTHA 4HQPA 2XYSA 3EI0A 3C84A 4ZJTA 5BW2A 4QABA 4ILBA 5BRXA 4EZ1A 4UM1A 4IREA 3UU3A 2UZ6A 4NZBA 4Z91A 2WNLA 2VL0A 2YN6A 3UUBA 2XQ9A 2BJ0A 2Y54A 2YOEA 3SH1A 4A97A 5AFMB 4BFQA 3WTNA 5J5FA 5KE4A 4UM3A 5J5GA 3UU8A 4TNVA 4B5DA 5LXBA 1UX2A 4D01A 5HEGA 2X00A 5L47A 2QC1B 3JAFA 3IGQA 3U8NA 2BYRA 3P50A 5HEJA 1UW6A 3PMZA 4NPPA 3UU5A 5TVCA 2BYNA 4WV9A 3U8MA 5HEUA 3ZDHA 4QH5A 5KZUA 4TWDA 4ZK4A 5BP0A 2BYPA 2XQ8A 3RQUA 4LMKA 4A98A 4AFHA 4ILAA 4Z90A 5LG3A 2BG9A 3T4MA 2YMEA 4PIRA 3RQWA 3WTJA 4UY2A 4XK9A 2YKSA 3RI5A 3RHWA 4X5TA 2XQ5A 3SQ9A 2Y56A 3TLUA 4IL9A 2BG9B 4QACA 3WTMA 5J5HA 2XZ5A 2BR7A 4LMLA 4ALXA 3UQ7A 5SYOA 3TLSA 2Y57A 4HFHA 4DBMA 3EHZA 4QAAA 4ZJSA 2X00D 3SQ6A 5AFHA 2BG9C 3ZDGA 3UQ4A 3JADA 3WTKA 5AINA 2XQ4A 4HFCA 2BYQA 3U8JA 3U8LA 3WTLA 4LMJA 2XNTA 3SIOA 4ZZCA 2ZJUA 1UV6A 2ZJVA 3GUAA 2XNUA 4AFTA 2BG9E 2W8GA 2XZ6A 4ZR6A 4HFBA 3WIPA 2BR8A 5J5IA 2PH9A 3TLTA 4QH1A 2Y58A 4XHEA 5AFLA 3C79A 5AFKA 3TLVA 4TWFA 4TNWA 2C9TA 4IL4A 5HCJA 5CFBA 5HEHA 4QH4A 2WNCA 5L4EA 3EAMA 3P4WA 2XYTA 3WTOA 2XQ7A 3U8KA 2XQAA 3UU4A 5AFNA 2WZYA 5HEOA 2PGZA 4FRRA 4TWHA 4UXUA 5AFMA 3WTIA 2XQ3A 4AFGA 2WNJA 1I9BA 4BQTA 2Y7YA 4HFIA 5HCMA 3RIAA 3RIFA 2W8FA 3UU6A 4COFA 4ZK1A 2BYSA 3PEOA 4UM3S 5CO5A 3LSVA 3TLWA 4HFDA 4HFEA 4ZRUA 5FJVA 4ILCA 3ZKRA 5J0ZA 4ZZBA 4UM3P 5L4HA 2WN9A 5IUXA 4F8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XNV A;  5JME A;  2XQ6 A;  5AFJ A;  2YMD A;  3JAE A;  3WTH A;  4HQP A;  2XYS A;  3EI0 A;  3C84 A;  4ZJT A;  5BW2 A;  4QAB A;  4ILB A;  5BRX A;  4EZ1 A;  4UM1 A;  4IRE A;  3UU3 A;  2UZ6 A;  4NZB A;  4Z91 A;  2WNL A;  2VL0 A;  2YN6 A;  3UUB A;  2XQ9 A;  2BJ0 A;  2Y54 A;  2YOE A;  3SH1 A;  4A97 A;  5AFM B;  4BFQ A;  3WTN A;  5J5F A;  5KE4 A;  4UM3 A;  5J5G A;  3UU8 A;  4TNV A;  4B5D A;  5LXB A;  1UX2 A;  4D01 A;  5HEG A;  2X00 A;  5L47 A;  2QC1 B;  3JAF A;  3IGQ A;  3U8N A;  2BYR A;  3P50 A;  5HEJ A;  1UW6 A;  3PMZ A;  4NPP A;  3UU5 A;  5TVC A;  2BYN A;  4WV9 A;  3U8M A;  5HEU A;  3ZDH A;  4QH5 A;  5KZU A;  4TWD A;  4ZK4 A;  5BP0 A;  2BYP A;  2XQ8 A;  3RQU A;  4LMK A;  4A98 A;  4AFH A;  4ILA A;  4Z90 A;  5LG3 A;  2BG9 A;  3T4M A;  2YME A;  4PIR A;  3RQW A;  3WTJ A;  4UY2 A;  4XK9 A;  2YKS A;  3RI5 A;  3RHW A;  4X5T A;  2XQ5 A;  3SQ9 A;  2Y56 A;  3TLU A;  4IL9 A;  2BG9 B;  4QAC A;  3WTM A;  5J5H A;  2XZ5 A;  2BR7 A;  4LML A;  4ALX A;  3UQ7 A;  5SYO A;  3TLS A;  2Y57 A;  4HFH A;  4DBM A;  3EHZ A;  4QAA A;  4ZJS A;  2X00 D;  3SQ6 A;  5AFH A;  2BG9 C;  3ZDG A;  3UQ4 A;  3JAD A;  3WTK A;  5AIN A;  2XQ4 A;  4HFC A;  2BYQ A;  3U8J A;  3U8L A;  3WTL A;  4LMJ A;  2XNT A;  3SIO A;  4ZZC A;  2ZJU A;  1UV6 A;  2ZJV A;  3GUA A;  2XNU A;  4AFT A;  2BG9 E;  2W8G A;  2XZ6 A;  4ZR6 A;  4HFB A;  3WIP A;  2BR8 A;  5J5I A;  2PH9 A;  3TLT A;  4QH1 A;  2Y58 A;  4XHE A;  5AFL A;  3C79 A;  5AFK A;  3TLV A;  4TWF A;  4TNW A;  2C9T A;  4IL4 A;  5HCJ A;  5CFB A;  5HEH A;  4QH4 A;  2WNC A;  5L4E A;  3EAM A;  3P4W A;  2XYT A;  3WTO A;  2XQ7 A;  3U8K A;  2XQA A;  3UU4 A;  5AFN A;  2WZY A;  5HEO A;  2PGZ A;  4FRR A;  4TWH A;  4UXU A;  5AFM A;  3WTI A;  2XQ3 A;  4AFG A;  2WNJ A;  1I9B A;  4BQT A;  2Y7Y A;  4HFI A;  5HCM A;  3RIA A;  3RIF A;  2W8F A;  3UU6 A;  4COF A;  4ZK1 A;  2BYS A;  3PEO A;  4UM3 S;  5CO5 A;  3LSV A;  3TLW A;  4HFD A;  4HFE A;  4ZRU A;  5FJV A;  4ILC A;  3ZKR A;  5J0Z A;  4ZZB A;  4UM3 P;  5L4H A;  2WN9 A;  5IUX A;  4F8H A; 
#chains in the Genus database with same CATH topology
 2XNV A;  5JME A;  2XQ6 A;  5AFJ A;  2YMD A;  3JAE A;  3WTH A;  4HQP A;  2XYS A;  3EI0 A;  3C84 A;  4ZJT A;  5BW2 A;  4QAB A;  4ILB A;  5BRX A;  4EZ1 A;  4UM1 A;  4IRE A;  3UU3 A;  2UZ6 A;  4NZB A;  4Z91 A;  2WNL A;  2VL0 A;  2YN6 A;  3UUB A;  2XQ9 A;  2BJ0 A;  2Y54 A;  2YOE A;  3SH1 A;  4A97 A;  5AFM B;  4BFQ A;  3WTN A;  5J5F A;  5KE4 A;  4UM3 A;  5J5G A;  3UU8 A;  4TNV A;  4B5D A;  5LXB A;  1UX2 A;  4D01 A;  5HEG A;  2X00 A;  5L47 A;  2QC1 B;  3JAF A;  3IGQ A;  3U8N A;  2BYR A;  3P50 A;  5HEJ A;  1UW6 A;  3PMZ A;  4NPP A;  3UU5 A;  5TVC A;  2BYN A;  4WV9 A;  3U8M A;  5HEU A;  3ZDH A;  4QH5 A;  5KZU A;  4TWD A;  4ZK4 A;  5BP0 A;  2BYP A;  2XQ8 A;  3RQU A;  4LMK A;  4A98 A;  4AFH A;  4ILA A;  4Z90 A;  5LG3 A;  2BG9 A;  3T4M A;  2YME A;  4PIR A;  3RQW A;  3WTJ A;  4UY2 A;  4XK9 A;  2YKS A;  3RI5 A;  3RHW A;  4X5T A;  2XQ5 A;  3SQ9 A;  2Y56 A;  3TLU A;  4IL9 A;  2BG9 B;  4QAC A;  3WTM A;  5J5H A;  2XZ5 A;  2BR7 A;  4LML A;  4ALX A;  3UQ7 A;  5SYO A;  3TLS A;  2Y57 A;  4HFH A;  4DBM A;  3EHZ A;  4QAA A;  4ZJS A;  2X00 D;  3SQ6 A;  5AFH A;  2BG9 C;  3ZDG A;  3UQ4 A;  3JAD A;  3WTK A;  5AIN A;  2XQ4 A;  4HFC A;  2BYQ A;  3U8J A;  3U8L A;  3WTL A;  4LMJ A;  2XNT A;  3SIO A;  4ZZC A;  2ZJU A;  1UV6 A;  2ZJV A;  3GUA A;  2XNU A;  4AFT A;  2BG9 E;  2W8G A;  2XZ6 A;  4ZR6 A;  4HFB A;  3WIP A;  2BR8 A;  5J5I A;  2PH9 A;  3TLT A;  4QH1 A;  2Y58 A;  4XHE A;  5AFL A;  3C79 A;  5AFK A;  3TLV A;  4TWF A;  4TNW A;  2C9T A;  4IL4 A;  5HCJ A;  5CFB A;  5HEH A;  4QH4 A;  2WNC A;  5L4E A;  3EAM A;  3P4W A;  2XYT A;  3WTO A;  2XQ7 A;  3U8K A;  2XQA A;  3UU4 A;  5AFN A;  2WZY A;  5HEO A;  2PGZ A;  4FRR A;  4TWH A;  4UXU A;  5AFM A;  3WTI A;  2XQ3 A;  4AFG A;  2WNJ A;  1I9B A;  4BQT A;  2Y7Y A;  4HFI A;  5HCM A;  3RIA A;  3RIF A;  2W8F A;  3UU6 A;  4COF A;  4ZK1 A;  2BYS A;  3PEO A;  4UM3 S;  5CO5 A;  3LSV A;  3TLW A;  4HFD A;  4HFE A;  4ZRU A;  5FJV A;  4ILC A;  3ZKR A;  5J0Z A;  4ZZB A;  4UM3 P;  5L4H A;  2WN9 A;  5IUX A;  4F8H A; 
#chains in the Genus database with same CATH homology
 2XNV A;  5JME A;  2XQ6 A;  5AFJ A;  2YMD A;  3JAE A;  3WTH A;  4HQP A;  2XYS A;  3EI0 A;  3C84 A;  4ZJT A;  5BW2 A;  4QAB A;  4ILB A;  5BRX A;  4EZ1 A;  4UM1 A;  4IRE A;  3UU3 A;  2UZ6 A;  4NZB A;  4Z91 A;  2WNL A;  2VL0 A;  2YN6 A;  3UUB A;  2XQ9 A;  2BJ0 A;  2Y54 A;  2YOE A;  3SH1 A;  4A97 A;  5AFM B;  4BFQ A;  3WTN A;  5J5F A;  5KE4 A;  4UM3 A;  5J5G A;  3UU8 A;  4TNV A;  4B5D A;  5LXB A;  1UX2 A;  4D01 A;  5HEG A;  2X00 A;  5L47 A;  2QC1 B;  3JAF A;  3IGQ A;  3U8N A;  2BYR A;  3P50 A;  5HEJ A;  1UW6 A;  3PMZ A;  4NPP A;  3UU5 A;  5TVC A;  2BYN A;  4WV9 A;  3U8M A;  5HEU A;  3ZDH A;  4QH5 A;  5KZU A;  4TWD A;  4ZK4 A;  5BP0 A;  2BYP A;  2XQ8 A;  3RQU A;  4LMK A;  4A98 A;  4AFH A;  4ILA A;  4Z90 A;  5LG3 A;  2BG9 A;  3T4M A;  2YME A;  4PIR A;  3RQW A;  3WTJ A;  4UY2 A;  4XK9 A;  2YKS A;  3RI5 A;  3RHW A;  4X5T A;  2XQ5 A;  3SQ9 A;  2Y56 A;  3TLU A;  4IL9 A;  2BG9 B;  4QAC A;  3WTM A;  5J5H A;  2XZ5 A;  2BR7 A;  4LML A;  4ALX A;  3UQ7 A;  5SYO A;  3TLS A;  2Y57 A;  4HFH A;  4DBM A;  3EHZ A;  4QAA A;  4ZJS A;  2X00 D;  3SQ6 A;  5AFH A;  2BG9 C;  3ZDG A;  3UQ4 A;  3JAD A;  3WTK A;  5AIN A;  2XQ4 A;  4HFC A;  2BYQ A;  3U8J A;  3U8L A;  3WTL A;  4LMJ A;  2XNT A;  3SIO A;  4ZZC A;  2ZJU A;  1UV6 A;  2ZJV A;  3GUA A;  2XNU A;  4AFT A;  2BG9 E;  2W8G A;  2XZ6 A;  4ZR6 A;  4HFB A;  3WIP A;  2BR8 A;  5J5I A;  2PH9 A;  3TLT A;  4QH1 A;  2Y58 A;  4XHE A;  5AFL A;  3C79 A;  5AFK A;  3TLV A;  4TWF A;  4TNW A;  2C9T A;  4IL4 A;  5HCJ A;  5CFB A;  5HEH A;  4QH4 A;  2WNC A;  5L4E A;  3EAM A;  3P4W A;  2XYT A;  3WTO A;  2XQ7 A;  3U8K A;  2XQA A;  3UU4 A;  5AFN A;  2WZY A;  5HEO A;  2PGZ A;  4FRR A;  4TWH A;  4UXU A;  5AFM A;  3WTI A;  2XQ3 A;  4AFG A;  2WNJ A;  1I9B A;  4BQT A;  2Y7Y A;  4HFI A;  5HCM A;  3RIA A;  3RIF A;  2W8F A;  3UU6 A;  4COF A;  4ZK1 A;  2BYS A;  3PEO A;  4UM3 S;  5CO5 A;  3LSV A;  3TLW A;  4HFD A;  4HFE A;  4ZRU A;  5FJV A;  4ILC A;  3ZKR A;  5J0Z A;  4ZZB A;  4UM3 P;  5L4H A;  2WN9 A;  5IUX A;  4F8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...