4XHEA

Crystal structure of a-achbp in complex with pinnatoxin a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
216
structure length
216
Chain Sequence
b'YKDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Marine Macrocyclic Imines, Pinnatoxins A and G: Structural Determinants and Functional Properties to Distinguish Neuronal alpha 7 from Muscle alpha 12 beta gamma delta nAChRs.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Acetylcholine-binding protein
total genus 58
structure length 216
sequence length 216
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4xheA00
2XYTA 4B5DA 4IREA 5AFHA 2YMDA 3RIAA 2XNVA 3RI5A 3T4MA 2BYQA 3JAFA 3U8JA 3P4WA 2ZJUA 3TLTA 2W8GA 4ZK4A 2YOEA 4NZBA 4Z90A 5HEJA 2BG9A 2ZJVA 3WTLA 5J5IA 2BR7A 4QACA 2QC1B 5HEHA 3WIPA 3WTIA 2BYRA 3RQUA 2YKSA 4IL4A 2Y56A 2XNUA 4DBMA 4ZZCA 4HFIA 4QAAA 2BJ0A 3ZDGA 4ZK1A 4UY2A 2XQ8A 4UM3S 2WNCA 3EHZA 4ZJTA 4QH4A 2WNLA 3UU5A 4QABA 3UU8A 3WTNA 4XHEA 3U8LA 2XNTA 3C79A 3SQ6A 3WTHA 5JMEA 3WTKA 4UXUA 4HQPA 2PH9A 4ILBA 4QH5A 5AFMB 3P50A 4X5TA 5L47A 3UU3A 4A98A 2VL0A 1UX2A 3SQ9A 2XQ7A 4IL9A 2XQ3A 3RIFA 5BP0A 2BYNA 4TWHA 3UQ7A 2Y7YA 4HFEA 1I9BA 4ZR6A 3U8KA 4ALXA 3RQWA 4COFA 2X00A 4FRRA 5AFNA 4Z91A 4ILCA 2UZ6A 4UM3P 4BFQA 2BG9E 3TLVA 3JADA 5J5FA 2Y54A 2XZ5A 4AFGA 3SIOA 2XQ6A 4HFDA 3TLSA 3ZKRA 5AFLA 5J5HA 1UV6A 2XZ6A 3IGQA 5HCJA 2BR8A 3GUAA 5L4HA 3UQ4A 4BQTA 5BRXA 4ZJSA 2XQAA 4TNVA 2BG9B 4LMJA 3C84A 5HEUA 4AFTA 3TLUA 2XQ9A 4EZ1A 2C9TA 5LXBA 2X00D 4F8HA 3RHWA 2Y58A 4XK9A 3UUBA 5AFJA 4HFBA 4ZRUA 5AINA 2BG9C 1UW6A 3UU6A 4HFCA 3WTJA 2WNJA 2XQ4A 5KE4A 4ILAA 3PMZA 4TNWA 4TWFA 4NPPA 3U8NA 2WN9A 4UM3A 5HEGA 4AFHA 4UM1A 4HFHA 5HEOA 2BYSA 4A97A 2BYPA 4PIRA 4TWDA 3TLWA 2YMEA 5CFBA 3LSVA 3UU4A 4QH1A 5AFMA 5CO5A 5FJVA 5SYOA 2XQ5A 3WTOA 2PGZA 3EI0A 5BW2A 5J0ZA 3PEOA 3WTMA 2XYSA 4WV9A 5HCMA 5IUXA 2WZYA 3SH1A 4ZZBA 5LG3A 5AFKA 2W8FA 4D01A 5L4EA 5TVCA 2YN6A 3ZDHA 3U8MA 5J5GA 3EAMA 4LMKA 4LMLA 2Y57A 5KZUA 3JAEA
chains in the Genus database with same CATH superfamily
2XYTA 4B5DA 4IREA 5AFHA 2YMDA 3RIAA 2XNVA 3RI5A 3T4MA 2BYQA 3JAFA 3U8JA 3P4WA 2ZJUA 3TLTA 2W8GA 4ZK4A 2YOEA 4NZBA 4Z90A 5HEJA 2BG9A 2ZJVA 3WTLA 5J5IA 2BR7A 4QACA 2QC1B 5HEHA 3WIPA 3WTIA 2BYRA 3RQUA 2YKSA 4IL4A 2Y56A 2XNUA 4DBMA 4ZZCA 4HFIA 4QAAA 2BJ0A 3ZDGA 4ZK1A 4UY2A 2XQ8A 4UM3S 2WNCA 3EHZA 4ZJTA 4QH4A 2WNLA 3UU5A 4QABA 3UU8A 3WTNA 4XHEA 3U8LA 2XNTA 3C79A 3SQ6A 3WTHA 5JMEA 3WTKA 4UXUA 4HQPA 2PH9A 4ILBA 4QH5A 5AFMB 3P50A 4X5TA 5L47A 3UU3A 4A98A 2VL0A 1UX2A 3SQ9A 2XQ7A 4IL9A 2XQ3A 3RIFA 5BP0A 2BYNA 4TWHA 3UQ7A 2Y7YA 4HFEA 1I9BA 4ZR6A 3U8KA 4ALXA 3RQWA 4COFA 2X00A 4FRRA 5AFNA 4Z91A 4ILCA 2UZ6A 4UM3P 4BFQA 2BG9E 3TLVA 3JADA 5J5FA 2Y54A 2XZ5A 4AFGA 3SIOA 2XQ6A 4HFDA 3TLSA 3ZKRA 5AFLA 5J5HA 1UV6A 2XZ6A 3IGQA 5HCJA 2BR8A 3GUAA 5L4HA 3UQ4A 4BQTA 5BRXA 4ZJSA 2XQAA 4TNVA 2BG9B 4LMJA 3C84A 5HEUA 4AFTA 3TLUA 2XQ9A 4EZ1A 2C9TA 5LXBA 2X00D 4F8HA 3RHWA 2Y58A 4XK9A 3UUBA 5AFJA 4HFBA 4ZRUA 5AINA 2BG9C 1UW6A 3UU6A 4HFCA 3WTJA 2WNJA 2XQ4A 5KE4A 4ILAA 3PMZA 4TNWA 4TWFA 4NPPA 3U8NA 2WN9A 4UM3A 5HEGA 4AFHA 4UM1A 4HFHA 5HEOA 2BYSA 4A97A 2BYPA 4PIRA 4TWDA 3TLWA 2YMEA 5CFBA 3LSVA 3UU4A 4QH1A 5AFMA 5CO5A 5FJVA 5SYOA 2XQ5A 3WTOA 2PGZA 3EI0A 5BW2A 5J0ZA 3PEOA 3WTMA 2XYSA 4WV9A 5HCMA 5IUXA 2WZYA 3SH1A 4ZZBA 5LG3A 5AFKA 2W8FA 4D01A 5L4EA 5TVCA 2YN6A 3ZDHA 3U8MA 5J5GA 3EAMA 4LMKA 4LMLA 2Y57A 5KZUA 3JAEA
chains in the Genus database with same CATH topology
2XYTA 4B5DA 4IREA 5AFHA 2YMDA 3RIAA 2XNVA 3RI5A 3T4MA 2BYQA 3JAFA 3U8JA 3P4WA 2ZJUA 3TLTA 2W8GA 4ZK4A 2YOEA 4NZBA 4Z90A 5HEJA 2BG9A 2ZJVA 3WTLA 5J5IA 2BR7A 4QACA 2QC1B 5HEHA 3WIPA 3WTIA 2BYRA 3RQUA 2YKSA 4IL4A 2Y56A 2XNUA 4DBMA 4ZZCA 4HFIA 4QAAA 2BJ0A 3ZDGA 4ZK1A 4UY2A 2XQ8A 4UM3S 2WNCA 3EHZA 4ZJTA 4QH4A 2WNLA 3UU5A 4QABA 3UU8A 3WTNA 4XHEA 3U8LA 2XNTA 3C79A 3SQ6A 3WTHA 5JMEA 3WTKA 4UXUA 4HQPA 2PH9A 4ILBA 4QH5A 5AFMB 3P50A 4X5TA 5L47A 3UU3A 4A98A 2VL0A 1UX2A 3SQ9A 2XQ7A 4IL9A 2XQ3A 3RIFA 5BP0A 2BYNA 4TWHA 3UQ7A 2Y7YA 4HFEA 1I9BA 4ZR6A 3U8KA 4ALXA 3RQWA 4COFA 2X00A 4FRRA 5AFNA 4Z91A 4ILCA 2UZ6A 4UM3P 4BFQA 2BG9E 3TLVA 3JADA 5J5FA 2Y54A 2XZ5A 4AFGA 3SIOA 2XQ6A 4HFDA 3TLSA 3ZKRA 5AFLA 5J5HA 1UV6A 2XZ6A 3IGQA 5HCJA 2BR8A 3GUAA 5L4HA 3UQ4A 4BQTA 5BRXA 4ZJSA 2XQAA 4TNVA 2BG9B 4LMJA 3C84A 5HEUA 4AFTA 3TLUA 2XQ9A 4EZ1A 2C9TA 5LXBA 2X00D 4F8HA 3RHWA 2Y58A 4XK9A 3UUBA 5AFJA 4HFBA 4ZRUA 5AINA 2BG9C 1UW6A 3UU6A 4HFCA 3WTJA 2WNJA 2XQ4A 5KE4A 4ILAA 3PMZA 4TNWA 4TWFA 4NPPA 3U8NA 2WN9A 4UM3A 5HEGA 4AFHA 4UM1A 4HFHA 5HEOA 2BYSA 4A97A 2BYPA 4PIRA 4TWDA 3TLWA 2YMEA 5CFBA 3LSVA 3UU4A 4QH1A 5AFMA 5CO5A 5FJVA 5SYOA 2XQ5A 3WTOA 2PGZA 3EI0A 5BW2A 5J0ZA 3PEOA 3WTMA 2XYSA 4WV9A 5HCMA 5IUXA 2WZYA 3SH1A 4ZZBA 5LG3A 5AFKA 2W8FA 4D01A 5L4EA 5TVCA 2YN6A 3ZDHA 3U8MA 5J5GA 3EAMA 4LMKA 4LMLA 2Y57A 5KZUA 3JAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XYT A;  4B5D A;  4IRE A;  5AFH A;  2YMD A;  3RIA A;  2XNV A;  3RI5 A;  3T4M A;  2BYQ A;  3JAF A;  3U8J A;  3P4W A;  2ZJU A;  3TLT A;  2W8G A;  4ZK4 A;  2YOE A;  4NZB A;  4Z90 A;  5HEJ A;  2BG9 A;  2ZJV A;  3WTL A;  5J5I A;  2BR7 A;  4QAC A;  2QC1 B;  5HEH A;  3WIP A;  3WTI A;  2BYR A;  3RQU A;  2YKS A;  4IL4 A;  2Y56 A;  2XNU A;  4DBM A;  4ZZC A;  4HFI A;  4QAA A;  2BJ0 A;  3ZDG A;  4ZK1 A;  4UY2 A;  2XQ8 A;  4UM3 S;  2WNC A;  3EHZ A;  4ZJT A;  4QH4 A;  2WNL A;  3UU5 A;  4QAB A;  3UU8 A;  3WTN A;  4XHE A;  3U8L A;  2XNT A;  3C79 A;  3SQ6 A;  3WTH A;  5JME A;  3WTK A;  4UXU A;  4HQP A;  2PH9 A;  4ILB A;  4QH5 A;  5AFM B;  3P50 A;  4X5T A;  5L47 A;  3UU3 A;  4A98 A;  2VL0 A;  1UX2 A;  3SQ9 A;  2XQ7 A;  4IL9 A;  2XQ3 A;  3RIF A;  5BP0 A;  2BYN A;  4TWH A;  3UQ7 A;  2Y7Y A;  4HFE A;  1I9B A;  4ZR6 A;  3U8K A;  4ALX A;  3RQW A;  4COF A;  2X00 A;  4FRR A;  5AFN A;  4Z91 A;  4ILC A;  2UZ6 A;  4UM3 P;  4BFQ A;  2BG9 E;  3TLV A;  3JAD A;  5J5F A;  2Y54 A;  2XZ5 A;  4AFG A;  3SIO A;  2XQ6 A;  4HFD A;  3TLS A;  3ZKR A;  5AFL A;  5J5H A;  1UV6 A;  2XZ6 A;  3IGQ A;  5HCJ A;  2BR8 A;  3GUA A;  5L4H A;  3UQ4 A;  4BQT A;  5BRX A;  4ZJS A;  2XQA A;  4TNV A;  2BG9 B;  4LMJ A;  3C84 A;  5HEU A;  4AFT A;  3TLU A;  2XQ9 A;  4EZ1 A;  2C9T A;  5LXB A;  2X00 D;  4F8H A;  3RHW A;  2Y58 A;  4XK9 A;  3UUB A;  5AFJ A;  4HFB A;  4ZRU A;  5AIN A;  2BG9 C;  1UW6 A;  3UU6 A;  4HFC A;  3WTJ A;  2WNJ A;  2XQ4 A;  5KE4 A;  4ILA A;  3PMZ A;  4TNW A;  4TWF A;  4NPP A;  3U8N A;  2WN9 A;  4UM3 A;  5HEG A;  4AFH A;  4UM1 A;  4HFH A;  5HEO A;  2BYS A;  4A97 A;  2BYP A;  4PIR A;  4TWD A;  3TLW A;  2YME A;  5CFB A;  3LSV A;  3UU4 A;  4QH1 A;  5AFM A;  5CO5 A;  5FJV A;  5SYO A;  2XQ5 A;  3WTO A;  2PGZ A;  3EI0 A;  5BW2 A;  5J0Z A;  3PEO A;  3WTM A;  2XYS A;  4WV9 A;  5HCM A;  5IUX A;  2WZY A;  3SH1 A;  4ZZB A;  5LG3 A;  5AFK A;  2W8F A;  4D01 A;  5L4E A;  5TVC A;  2YN6 A;  3ZDH A;  3U8M A;  5J5G A;  3EAM A;  4LMK A;  4LML A;  2Y57 A;  5KZU A;  3JAE A; 
#chains in the Genus database with same CATH topology
 2XYT A;  4B5D A;  4IRE A;  5AFH A;  2YMD A;  3RIA A;  2XNV A;  3RI5 A;  3T4M A;  2BYQ A;  3JAF A;  3U8J A;  3P4W A;  2ZJU A;  3TLT A;  2W8G A;  4ZK4 A;  2YOE A;  4NZB A;  4Z90 A;  5HEJ A;  2BG9 A;  2ZJV A;  3WTL A;  5J5I A;  2BR7 A;  4QAC A;  2QC1 B;  5HEH A;  3WIP A;  3WTI A;  2BYR A;  3RQU A;  2YKS A;  4IL4 A;  2Y56 A;  2XNU A;  4DBM A;  4ZZC A;  4HFI A;  4QAA A;  2BJ0 A;  3ZDG A;  4ZK1 A;  4UY2 A;  2XQ8 A;  4UM3 S;  2WNC A;  3EHZ A;  4ZJT A;  4QH4 A;  2WNL A;  3UU5 A;  4QAB A;  3UU8 A;  3WTN A;  4XHE A;  3U8L A;  2XNT A;  3C79 A;  3SQ6 A;  3WTH A;  5JME A;  3WTK A;  4UXU A;  4HQP A;  2PH9 A;  4ILB A;  4QH5 A;  5AFM B;  3P50 A;  4X5T A;  5L47 A;  3UU3 A;  4A98 A;  2VL0 A;  1UX2 A;  3SQ9 A;  2XQ7 A;  4IL9 A;  2XQ3 A;  3RIF A;  5BP0 A;  2BYN A;  4TWH A;  3UQ7 A;  2Y7Y A;  4HFE A;  1I9B A;  4ZR6 A;  3U8K A;  4ALX A;  3RQW A;  4COF A;  2X00 A;  4FRR A;  5AFN A;  4Z91 A;  4ILC A;  2UZ6 A;  4UM3 P;  4BFQ A;  2BG9 E;  3TLV A;  3JAD A;  5J5F A;  2Y54 A;  2XZ5 A;  4AFG A;  3SIO A;  2XQ6 A;  4HFD A;  3TLS A;  3ZKR A;  5AFL A;  5J5H A;  1UV6 A;  2XZ6 A;  3IGQ A;  5HCJ A;  2BR8 A;  3GUA A;  5L4H A;  3UQ4 A;  4BQT A;  5BRX A;  4ZJS A;  2XQA A;  4TNV A;  2BG9 B;  4LMJ A;  3C84 A;  5HEU A;  4AFT A;  3TLU A;  2XQ9 A;  4EZ1 A;  2C9T A;  5LXB A;  2X00 D;  4F8H A;  3RHW A;  2Y58 A;  4XK9 A;  3UUB A;  5AFJ A;  4HFB A;  4ZRU A;  5AIN A;  2BG9 C;  1UW6 A;  3UU6 A;  4HFC A;  3WTJ A;  2WNJ A;  2XQ4 A;  5KE4 A;  4ILA A;  3PMZ A;  4TNW A;  4TWF A;  4NPP A;  3U8N A;  2WN9 A;  4UM3 A;  5HEG A;  4AFH A;  4UM1 A;  4HFH A;  5HEO A;  2BYS A;  4A97 A;  2BYP A;  4PIR A;  4TWD A;  3TLW A;  2YME A;  5CFB A;  3LSV A;  3UU4 A;  4QH1 A;  5AFM A;  5CO5 A;  5FJV A;  5SYO A;  2XQ5 A;  3WTO A;  2PGZ A;  3EI0 A;  5BW2 A;  5J0Z A;  3PEO A;  3WTM A;  2XYS A;  4WV9 A;  5HCM A;  5IUX A;  2WZY A;  3SH1 A;  4ZZB A;  5LG3 A;  5AFK A;  2W8F A;  4D01 A;  5L4E A;  5TVC A;  2YN6 A;  3ZDH A;  3U8M A;  5J5G A;  3EAM A;  4LMK A;  4LML A;  2Y57 A;  5KZU A;  3JAE A; 
#chains in the Genus database with same CATH homology
 2XYT A;  4B5D A;  4IRE A;  5AFH A;  2YMD A;  3RIA A;  2XNV A;  3RI5 A;  3T4M A;  2BYQ A;  3JAF A;  3U8J A;  3P4W A;  2ZJU A;  3TLT A;  2W8G A;  4ZK4 A;  2YOE A;  4NZB A;  4Z90 A;  5HEJ A;  2BG9 A;  2ZJV A;  3WTL A;  5J5I A;  2BR7 A;  4QAC A;  2QC1 B;  5HEH A;  3WIP A;  3WTI A;  2BYR A;  3RQU A;  2YKS A;  4IL4 A;  2Y56 A;  2XNU A;  4DBM A;  4ZZC A;  4HFI A;  4QAA A;  2BJ0 A;  3ZDG A;  4ZK1 A;  4UY2 A;  2XQ8 A;  4UM3 S;  2WNC A;  3EHZ A;  4ZJT A;  4QH4 A;  2WNL A;  3UU5 A;  4QAB A;  3UU8 A;  3WTN A;  4XHE A;  3U8L A;  2XNT A;  3C79 A;  3SQ6 A;  3WTH A;  5JME A;  3WTK A;  4UXU A;  4HQP A;  2PH9 A;  4ILB A;  4QH5 A;  5AFM B;  3P50 A;  4X5T A;  5L47 A;  3UU3 A;  4A98 A;  2VL0 A;  1UX2 A;  3SQ9 A;  2XQ7 A;  4IL9 A;  2XQ3 A;  3RIF A;  5BP0 A;  2BYN A;  4TWH A;  3UQ7 A;  2Y7Y A;  4HFE A;  1I9B A;  4ZR6 A;  3U8K A;  4ALX A;  3RQW A;  4COF A;  2X00 A;  4FRR A;  5AFN A;  4Z91 A;  4ILC A;  2UZ6 A;  4UM3 P;  4BFQ A;  2BG9 E;  3TLV A;  3JAD A;  5J5F A;  2Y54 A;  2XZ5 A;  4AFG A;  3SIO A;  2XQ6 A;  4HFD A;  3TLS A;  3ZKR A;  5AFL A;  5J5H A;  1UV6 A;  2XZ6 A;  3IGQ A;  5HCJ A;  2BR8 A;  3GUA A;  5L4H A;  3UQ4 A;  4BQT A;  5BRX A;  4ZJS A;  2XQA A;  4TNV A;  2BG9 B;  4LMJ A;  3C84 A;  5HEU A;  4AFT A;  3TLU A;  2XQ9 A;  4EZ1 A;  2C9T A;  5LXB A;  2X00 D;  4F8H A;  3RHW A;  2Y58 A;  4XK9 A;  3UUB A;  5AFJ A;  4HFB A;  4ZRU A;  5AIN A;  2BG9 C;  1UW6 A;  3UU6 A;  4HFC A;  3WTJ A;  2WNJ A;  2XQ4 A;  5KE4 A;  4ILA A;  3PMZ A;  4TNW A;  4TWF A;  4NPP A;  3U8N A;  2WN9 A;  4UM3 A;  5HEG A;  4AFH A;  4UM1 A;  4HFH A;  5HEO A;  2BYS A;  4A97 A;  2BYP A;  4PIR A;  4TWD A;  3TLW A;  2YME A;  5CFB A;  3LSV A;  3UU4 A;  4QH1 A;  5AFM A;  5CO5 A;  5FJV A;  5SYO A;  2XQ5 A;  3WTO A;  2PGZ A;  3EI0 A;  5BW2 A;  5J0Z A;  3PEO A;  3WTM A;  2XYS A;  4WV9 A;  5HCM A;  5IUX A;  2WZY A;  3SH1 A;  4ZZB A;  5LG3 A;  5AFK A;  2W8F A;  4D01 A;  5L4E A;  5TVC A;  2YN6 A;  3ZDH A;  3U8M A;  5J5G A;  3EAM A;  4LMK A;  4LML A;  2Y57 A;  5KZU A;  3JAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...