4F8HA

X-ray structure of the anesthetic ketamine bound to the glic pentameric ligand-gated ion channel
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structure of the Pentameric Ligand-Gated Ion Channel GLIC Bound with Anesthetic Ketamine.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 89
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4f8hA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4f8hA01
4ZZCA 5LXBA 4LMJA 3UU3A 5J5GA 3U8MA 2XNTA 5LG3A 4ZK4A 3WTMA 4XK9A 3TLSA 3JAEA 4QABA 2WN9A 3SH1A 4UM3S 2XZ6A 3WTKA 4EZ1A 3PMZA 4AFTA 2BYRA 2Y57A 2YOEA 3RI5A 5BP0A 2XNVA 4ZRUA 3UQ4A 3SQ6A 4BFQA 5CFBA 2BR7A 4HFIA 3C79A 2XYSA 3TLWA 2YMDA 3RHWA 4HFHA 5J5HA 5TVCA 4ILBA 2BYQA 2X00A 4UM1A 3P4WA 4UM3A 4HFEA 4AFHA 2W8FA 2XQ8A 3TLTA 2Y58A 3WTNA 2PH9A 1OEDB 3U8JA 3WTLA 5BW2A 3ZKRA 4ZJSA 3U8KA 4TWDA 4B5DA 2WNLA 4IL4A 5HEGA 4TNWA 4FRRA 5HEHA 4TWFA 3C84A 4LMLA 4ILAA 2QC1B 3TLVA 2MAWA 3JAFA 2YN6A 2YMEA 2ZJVA 5J5FA 3LSVA 4Z90A 2BYSA 4QH5A 1UV6A 4A98A 5AFJA 4WV9A 1OEDA 5AFHA 4ZR6A 2LKHA 4HFCA 4TWHA 4ZJTA 4QACA 3WIPA 5L4HA 2WZYA 2XQ7A 2XQAA 5HCMA 5BRXA 2W8GA 3GUAA 4UM3P 1OEDE 5AFKA 4F8HA 3SIOA 5J5IA 2BG9B 4NPPA 3UU6A 3WTJA 5HEJA 2Y54A 3EAMA 4HFDA 5CO5A 2M6IA 1OEDC 2WNCA 3EHZA 2VL0A 3U8NA 3UUBA 5J0ZA 5AFMB 2XQ6A 2M6BA 4HFBA 3JADA 4A97A 4UXUA 3P50A 2LKGA 4IREA 1UX2A 5FJVA 2PGZA 3ZDGA 5AFNA 2BG9A 2BR8A 4BQTA 2Y56A 3T4MA 2YKSA 5KE4A 5AFMA 2XYTA 2LM2A 3RIFA 5SYOA 4IL9A 2BYPA 4HQPA 2XNUA 2BYNA 2BG9E 4Z91A 3UQ7A 2UZ6A 5AFLA 4NZBA 2Y7YA 2LLYA 3WTOA 2BG9C 4D01A 2XZ5A 3ZDHA 5L4EA 3WTHA 4ALXA 4DBMA 5HEUA 1I9BA 4ZK1A 3RIAA 3RQUA 4QAAA 1UW6A 2XQ5A 3RQWA 4PIRA 3WTIA 3UU8A 5HCJA 4XHEA 5HEOA 5AINA 4ZZBA 4X5TA 5L47A 3TLUA 4QH1A 5JMEA 3SQ9A 2XQ4A 3PEOA 2WNJA 4AFGA 2XQ9A 3EI0A 2X00D 2BJ0A 4COFA 3U8LA 3UU4A 2C9TA 4ILCA 5KZUA 4LMKA 3UU5A 5IUXA 2XQ3A 4QH4A 4TNVA 3IGQA 2ZJUA 4UY2A 2KSRA
chains in the Genus database with same CATH superfamily
4BA9A 4ZK4A 4QABA 5J1GA 5AQMB 4HWCA 2NW8A 3GWHA 4CXYA 3KVAA 4UELA 4AKGA 2UXCT 4IE0A 5FMNA 4UEMA 2W8FA 4JEUB 3RF1A 5A1LA 3FXEB 4P1NA 2CBIA 2X9YA 1MIWA 4AI6A 2X0HA 2MAWA 5L3GB 5JDNA 2KLQA 2CBJA 5LA6E 2K5BB 4WBNE 3RPUA 1UK5A 3T1YT 3U78A 2UUAT 1FEWA 2WSSV 3IBPA 2IC6A 3PUWF 1UUSA 4EYYR 4B6XA 2V6YB 4A97A 4UXUA 4UVBB 3QK6A 4WYVA 3PDYA 1UX2A 4DR2T 4WW0A 3U3IA 1UURA 4DUZT 2BBJA 4DR1T 1HNXT 2XNUA 2VQFT 3VRBA 1XNQT 2BG9E 5KXJA 2RPAA 3SS1A 2ZMAA 2A72A 2K9AA 5L4EA 4U2ZA 3EVYA 4YJ3E 2CXFA 1IZNB 4XBFB 3CQXC 3NBXX 3OBVE 2KXPB 3U8LA 3UU4A 4TX5A 5IUXA 4QH4A 1WFDA 4H9OC 3C64A 1VOMA 2UXXB 4CQIA 4UVCB 3AE9A 2Y48B 5LG3A 3FBLA 3AE2A 3PUSA 2XZ6A 4DV2T 3IEEA 1E7PA 4MALA 3RLFF 1AJ3A 1IJ6A 2XUEA 2NW9A 3P4WA 5HXCA 1OEDB 3I1AA 3U8JA 3ZKRA 4JI6T 5JDMA 2WWVA 4AKRB 3C84A 3ETUA 4WV9A 4IDZA 2A9UA 2E5VA 2XAGB 3CMLA 5HCMA 5FY0A 1GQEA 1YKHB 4DR3T 2LRLA 2Y54A 4PFOA 3UUMA 4AQFA 2M6IA 5AQSB 3V5UA 1WR6A 1HR0T 2XJ7A 1BR4A 4EGWA 2X0YA 2V7IA 3ESLA 4PK6A 4CXWA 5SYOA 4YY3T 4HQPA 1JNRA 1WYCA 4YT0A 4IDNA 2VB6A 1OWAA 1FMWA 4G2AA 1H7CA 4QAAA 1UW6A 2LSYA 4QX7B 5TAOA 3PJAJ 4QX8B 5C8YE 1S94A 4B3RT 3AEGA 2BJ0A 5LGNB 2QA7A 3GA8A 1M62A 2BS4A 2KSRA 4QKNA 3Q5DA 2H7OA 4AKLA 2XNTA 2OLTA 4O2AE 3KV6A 3C50A 3AA1B 4HWFA 2W00A 4MBQA 3LK2B 2IAKA 1X79A 4DIDB 4IDPA 2LJLA 2QC1B 3MZKB 5LXTE 4KUMB 3FB2A 5AQHB 4DV1T 4IT4A 4HFCA 4CI1B 4JI3T 4KP3C 4DMWA 4DVDA 2NP9A 2W8GA 1ZKEA 3IHRA 2BS2A 1T8BA 2CEAA 3B5MA 4EAHA 3UUBA 2CA5A 4O4IE 3JADA 1IAPA 1MMGA 4JYAT 4IDQA 4HKAA 4IREA 1EZ3A 4MFRA 3M3ZB 3T4MA 2LEHA 4ZI7E 5JRCB 4MHCA 2ZLYA 1Z8UA 3RYCE 4TV8E 3H3MA 4X1IE 4CXXA 3Q5EA 2WDVA 3G06A 1W0BA 3LFMA 2Z6EA 1KNZA 1E2AA 4GOUA 3ZN1B 4I50E 3BQLA 4DV5T 5LBQB 4N78D 4PIRA 2K48A 5L3DB 5CB4E 4OHFA 5IWAT 2X00D 3ZMVB 2XSBA 3ZPOA 3EDVA 2C9TA 4ILCA 3FHNA 3S4UA 5F8PA 4UY2A 5LMUT 4UIGA 4YSYA 2XAJB 3AA0B 2YEVC 2WN9A 2XASB 3P4RA 2EHOB 5LJNA 2BYQA 2X66A 4ZEYA 2I6HA 2BVLA 1YD8G 4TWDA 2NR4A 2YDRA 4HWIB 2C0SA 2BYSA 1NWMX 3OYZA 2ACZA 1MIVA 2CPTA 2WZYA 5LGUB 2E9XC 3RKGA 3ZMUB 5CO5A 4HFDA 2NW7A 3P8CD 2W62A 1WR0A 4YTNA 4HGAA 3SRZA 3ZYKA 1NEKA 3T8OA 3MXZA 4LFBT 2Y7YA 3MA9A 1N33T 4OYJA 2IW5B 3LK3B 2XZ5A 4XAXB 1OXZA 3UFEA 3FZFB 3F2EA 1U5PA 4H9SE 2DWKA 2X67A 3AE7A 3V5SA 3K3QC 2WMOA 3PEOA 3RYIE 2HN1A 2Q9QC 3PUXF 3U8MA 3R84B 3PU3A 5LP6E 3EUHA 3VHLA 4OFZA 5HXRA 3RI5A 2BR7A 2VQET 2C5IT 2YU1A 4AQYT 2VKDA 5HXHA 4EEBA 2WNLA 4TN7B 1D1CA 4TWFA 3P4QA 3B57A 4U3CA 3H3AA 4LF8T 4OYKA 5DQVA 4UV9B 1HS7A 4U72A 1UX4A 1WYBA 2XTLA 2V26A 4ISTA 4GYSA 2CWYA 4PK5A 4GK5E 2C5JA 5AFKA 2BKOA 1D0ZA 4ZI2C 5CA0E 1U4QA 2W66A 2C5KT 2X51A 2XZEA 1MIYA 2YKSA 3CX8B 4CN6A 2RA1A 2UZ6A 1NAFA 4LF4T 3SFDA 3PE0A 4I0UA 2JQ9A 2YINA 3ZDHA 2I0MA 3WTHA 1UX5A 2WQYA 3RX6A 2B1EA 3TKLB 4HE8A 4ISSA 4LFCT 4FI5A 1FJGT 1R8IA 1L0VA 1HFAA 3E0ZA 2LE8A 2LSJA 2BKPA 4TNVA 5J2TE 1HCIA 5E0OA 2Y6XA 4ZS3A 4LMJA 4L9IA 2CMRA 2E9XD 5DQWA 4B3MT 4U7IA 5JRCA 2XHEB 2XM2A 3C4XA 5DABA 2XY8B 4DUYT 1HF8A 2WZIA 2Y58A 2J4GA 2KT9A 4YJ2E 3NRXA 4O8SA 1ZV4X 3EDUA 4TZ4C 4WBOA 4JI0T 5L3CB 2ZJVA 3WAKA 1MMNA 5L3BB 4J2CA 4AQGA 3MKDA 3WIPA 5HAXA 5LB7B 3K3NA 1HX8A 2XM1A 4F8HA 3WTJA 2CE7A 2LM9A 4UXNB 4YLHA 5JDQA 1OEDC 2Y8DA 4CN4A 2VL0A 2WDRA 2EHOA 3RC3A 3UUXB 2WAUA 3P50A 3VR9A 4ADZA 2XAFB 2L3LA 4ZHQE 4JEHB 4IE7A 2Q9QD 4XZCA 3WI3A 3L39A 1BR1A 2CM0A 4K0UA 4AXPA 2JMHA 2LOPA 4CZZB 4ANJA 3AEAA 2KZ7B 5EK3A 5FXZA 3CQGB 1VRBA 2WNJA 3N5LA 3EI0A 4GIWA 4UF0A 3AA6B 5HXEA 2WP9A 4ZZCA 4DMVA 4UM3S 3SH1A 4GYRA 4K0KT 3LBXB 4EV6A 3AXJA 1X9BA 3N9LA 4X20E 2WBLA 4ZI2D 3TLWA 3RHWA 2PFVA 3ETVA 5J5HA 2ZM6T 3CQCB 2XAHB 3ZCIA 1Y01A 3MACA 4FRRA 2NTXA 5FVLA 2HPJA 4A98A 1S35A 3HKCE 5ADXL 3ABVA 5LGTB 3QUJA 4DV0T 4E7SA 1J5WA 4I4TE 3RRWA 1T98A 1OEDE 3SIOA 3OJAA 2CXDA 4EZHA 3LK42 4U74A 2LKGA 1YW0A 1YXRA 5KX5E 4O4JE 5AFMA 2V6XA 2BYPA 3L09A 3FZHB 3LG7A 3ANWA 4EEDA 3N2KE 4IHJE 4HWDA 3QB5K 5JDHA 2VVNA 5HCJA 3UT5E 2UXBT 4ZZBA 3CK6A 3D0TA 3HKDE 5HWXA 3NVOA 5AQQB 5FVKA 3KINB 2JRKA 2X0LB 5KE4A 4QHOA 2W67A 3O1IA 5DJQC 4X1YE 3WAJA 3ZT6A 2L9QA 2X68A 4ERRA 5KMGP 4AFTA 5BP0A 2XNVA 2V7JA 3Q5WA 2WM9A 1KNPA 2WU5A 5TVCA 3R6NA 1FMVA 4HFEA 2A2FX 3JC6C 5LOVE 2L8KA 1N34T 4Z90A 1YKEB 4QH5A 3C98B 3K8PC 4TWHA 4QACA 4QWNB 4C90A 3C51A 2PJQA 5BRXA 4UM3P 2LSGA 1G73A 2D2SA 5CJ5A 5JR9A 3U8NA 3AVSA 5ABFB 1LRZA 4H9RC 3DJBA 2JQHA 3C4WA 2RP4A 1Z0PA 2FUPA 3RIUA 5LNKA 2MTQA 2X9WA 5FP3A 4OX9T 4ZI3C 2VASA 3OVUA 4ZS2A 3QB5A 5F5WA 2IHR1 5AFUL 3PU8A 4XHEA 2UXNB 3NWIA 3CPZA 2XQ9A 2CXLA 4OK0A 3ZT5A 3UU5A 4PNIA 4V1Av 5CA1E 3IGQA 4KX6A 2ZJUA 3FZMB 2H89A 3RYFE 3BQIA 2XSAA 2H3RA 3UU3A 2CLYB 3JAEA 3JCFA 3KBTA 2X9XA 3WTKA 4EZ1A 2JIWA 5IHYA 4QXBB 3UQ4A 1I6ZA 4HFIA 1ZOYA 2YMDA 4DNDA 3E22E 4ILBA 2GK9A 1XDOA 4O4LE 2XQ8A 4EIWA 5BW2A 1D1BA 2FJDA 2UUBT 2W4XA 3KV5A 3AEDA 5LHIB 3O9XA 2DL1A 2V7LA 3AA7B 2LKHA 5J2UE 2MBGA 4MLKA 1HNZT 5FL0A 3LBXA 1WCRA 5CGMA 5AQUB 4B3ST 5JVDE 4JUYA 2YDSA 1KF6A 2AE9A 5EZYE 5FJVA 2BG9A 4DV4T 5LHGB 4YTPA 3PUZF 2PTFA 5EK4A 1CHUA 2BYNA 3VU7H 3F57A 5AQLB 3KV4A 2UU9T 2LOSA 1W0AA 3N9QA 3I0OA 4UF0B 3RIAA 4NXNT 2VWAA 3RQWA 1YQ4A 3LDQB 3JC6D 5C2TA 2ZM0A 3MJXA 5JDFA 3AE8A 3N9NA 1KEYA 3AXJB 1IJ5A 5LXBA 2ODUA 3ONJA 4XK9A 1UGOA 5AQRB 3PURA 3ONLC 1IBMT 2BYRA 4UVAB 1W9RA 2Y57A 4DR5T 5JTGA 2WMNA 4ASKA 3GN5B 4QXCB 4UM3A 3ZSTA 1E1HB 3WTLA 4F6RC 2R6GF 5FY7A 2SPCA 2LHRA 3N9OA 1FIOA 3CVRA 3TLVA 2YN6A 1UCUA 3HL6A 4ZI3D 1UV6A 5ABHA 2LSKA 2VL8A 5L3FB 3OKQA 4EXTA 4GK0E 3W15B 4H63H 2XQAA 2FJEA 4NUVA 1WRDA 1N32T 1KK7A 3UU6A 2QRXA 4PW8A 2BBHA 4I43B 3CIRA 5AFMB 3PJAA 2M6BA 2ZM8A 3CWZB 3FZKB 1HNWT 1QUUA 3PUVF 2DNXA 2BR8A 4BQTA 2V8SV 3CX7B 3X1DA 3ANWB 2V5DA 5GONE 5LBMA 2XYTA 3RIFA 2XPKA 2I59A 4JBWF 3FZLB 3F31A 5AQFB 3ZYLA 2XAQB 3L8RA 4U33A 4KI0F 1M7KA 2E9XB 3ZYMA 5L3EB 3UULA 3ZMSB 5LJMA 5ABFA 5KZUA 3IA3A 3LJCA 3ZC0A 2IUBA 1QLBA 4YHJA 4BAYB 4EOZB 4AKHA 3PMZA 2JPFA 4ZRUA 3SQ6A 2ZM2A 2LSIA 4IE6A 4DR4T 2DI4A 2X00A 1W09A 2CWOA 4UM1A 4O2BE 5H6QB 2K3WA 2PH9A 3GMIA 3U8KA 4B5DA 4IL4A 2KNDA 2BKNA 4EZ4A 2DCFA 3JAFA 4JI5T 2YMEA 4L0RA 2PBIA 5JR9B 3KBUA 1DU2A 2XQ7A 3O1HA 5FY1A 2H7VC 2NWBA 1LKXA 3SFEA 3EABA 1MMDA 2D9DA 2Q9QB 3J7Yq 2QGSA 4A56A 4P0BA 3RRCA 5JH7E 3NRYA 2JJ9A 2PGZA 5AQKB 2CHNA 2ACXA 3NKZA 2YDQA 4P09A 2NTYA 2FJBA 1BR2A 3AAIA 2E5LT 4DR7T 1QSDA 2D0TA 3ZN0B 5FL1A 2LLYA 2H88A 1I9BA 4LF9T 4C91A 3RH3A 3I0QA 5ETWA 2KINB 4WZXA 4CI3B 2XQ4A 2NOXA 2K24A 3HI2A 5H6RB 1JNZA 4FJOA 4LF7T 3KFWX 2DLRA 4I55E 2VKHA 3AECA 4GKKT 1SA0E 3TLSA 3O4XE 2VK9A 3PV0F 3A8YC 3HR0A 4BFQA 5CFBA 4YSZA 2MPKA 4HFHA 4H63V 2LHNA 3M65A 3BQKA 3N2GE 1WLXA 5HEGA 2IIUA 5HEHA 3VR8A 1G8XA 5J5FA 4O4HE 2ODVA 2BS3A 4ZR6A 3PUGA 3P7IA 4NUUA 3RKOA 3L3PA 4PJMA 4CN1A 4DBRA 2CCQA 2BG9B 5J5IA 2HHHT 5FXVA 4X64T 2WWUA 2V7KA 4LFAT 4JLEA 3HA4A 2VVSA 3GN5A 4L5GA 2FJAA 3C4ZA 2Y56A 1I94T 2LM2A 4PJLA 3Q5XA 4IL9A 1Y64B 2IC9A 2OV9A 5LCYA 4NXMT 4D01A 3ZEFB 1YQ3A 3J9X1 3RQUA 3AEEA 5L47A 4QH1A 5JMEA 1MNDA 3AE6A 3KDSE 3P4SA 4ZK1A 1NENA 5C3JA 3DP7A 1SUMB 2E8IA 5M4YA 4G63A 4X66T 3ZT7A 5JDGA 2WCAA 4GKJT 5F3JA 1HTJF 3WTNA 3TLTA 1SHZC 2E9XA 4HEAA 4LMLA 4YXDA 3AVRA 2CLYC 5AFJA 4JI8T 2B76A 2BVMA 2HPLA 2E2AA 3VKGA 2QYWA 3P4PA 3FBZA 4AKIA 1XZYA 4NPPA 5HEJA 2A3DA 2G0UA 3EAMA 3CKDA 3QOFA 2MOZA 5AQJB 5J0ZA 1V9DA 4HFBA 4U2YA 4YFSA 3ZDGA 5AQPB 1KNRA 2J1DG 1HX1B 4IE5A 5ABGA 4KHZF 2DWGA 2EHOC 5LHHB 2HN2A 3ZMZB 4Z91A 4HTEA 5AFLA 3PTRB 4KBMB 3N9MA 3WTOA 4HFVA 3UUNA 4PJJA 4DBMA 5HEUA 3KVBA 3A5XA 2WY2A 2XQ5A 3UU8A 2Q9QA 5HEOA 4PK4A 4X5TA 1IBLT 2WDQA 3CX6B 5FXWA 5AQIB 5AQGB 2YU2A 3E08A 1HG5A 4H9NC 2W61A 1CUNA 3AB3B 4ILUA 2F4VT 2V1DB 1ZP0A 2CRBA 3IF8B 4TUYE 1N36T 3AE1A 3WTMA 2WZHA 1LVFA 4BJMA 2JQKA 3C79A 4QXHB 1HG2A 3QNUA 4M1PA 4AFHA 4CI2B 4EB6E 4ZJSA 2LT3A 1SE7A 3PUAA 1VCSA 4TNWA 4NIQA 3ZC1A 1B7TA 1VCTA 4U31A 5KDMC 1J1JA 5LYJE 5JQGE 4DR6T 4WNKA 2BZBA 3EHZA 4DV3T 2V5CA 4IE4A 3QC9A 3I9YA 2V7MA 5AFNA 3K1SA 3AE4A 3OYXA 4IIJE 5EK2A 3AE3A 4DV7T 4Z8XA 2V6YA 4H9QC 4IDOA 2IDOB 3UQ7A 2WB5A 4NZBA 2N1GA 3O1JA 4KHPT 2X9HA 4X62T 3VRAA 3WTIA 3BK9A 3B13A 4JI4T 2AXDS 3TLUA 4AQFC 3SQ9A 4COFA 5FKYA 2JMKA 4JI2T 2VURA 1MNEA 2XQ3A 2W63A 2BDEA 4ZXLA 2M67A 3PUYF 1XMQT 3A7MA 1D0XA 3K3OA 2ES0A 5LG4A 5JDLA 2VKOA 3DTOA 4P0AA 4YHHT 4DBQA 4PJNA 3OTOT 3I9WA 2XQYA 2IMLA 1D0YA 2VKJA 2EHOD 3AAEB 4ILAA 4IGUA 1ZEEA 1OEDA 2DHRA 5AFHA 2WU2A 4JI1T 5L4HA 2J47A 3UTKA 3AEBA 2WS3A 3MK7C 3Q9DA 4YTMA 4YSXA 4AISA 2UXDT 4U7YA 1T72A 5AQTB 3ZMTB 3OPCA 3FXDB 3PUQA 1ZHCA 4X65T 1XMOT 5BR8T 1BR0A 4JV5T 1KFYA 5FNVE 2QVAA 5JR9C 3ZJ2A 4KMCA 5LMNT 4A5XA 2YK0A 3ZLIA 4PFPA 4ALXA 3RIUC 1O3XA 1XNRT 5AQNB 2JQQA 1T7SA 5AINA 4PAGA 2CHOA 4HN9A 4LF5T 4AFGA 4Q25A 4BJNA 4LMKA 2HH7A 5HWYA 4E7ZA 4ZOLE 1J5ET 3NZQA 4DV6T 2KWHA 3N2OA 5J5GA 1D1AA 2KWIB 3RC8A 2YOEA 4UR9A 2D0UA 2W2UA 2KMFA 2XYSA 3AAAB 1XDPA 3RGLA 3KV9A 5FXXA 3SOLA 4H9PC 3HKBE 2N2NA 3Q2MA 5HYAA 2PG8A 3SWHA 4TV9E 4EYUA 2OA5A 3LSVA 4HWHA 2D5UA 1XWMA 5BMVE 3VKHA 4ZJTA 2UUCT 3T1HT 3GUAA 5ABEA 4B3TT 2WNCA 2FBWA 5L2LA 3ONXA 2LRKA 2XQ6A 3HKEE 4LF6T 4X1KE 2N9DA 3N9PA 5AQVB 5FYMA 3AE5A 1IBKT 3AEFA 5JREA 3H37A 2MYSA 5HXSA 2P9BA 2BG9C 2W0GA 3UFGA 4JI7T 1LVKA 4AIUA 3ZCJA 5IYZE 4DO0A 1US7B 3ZJ1A 5AQOB 1MMAA 3ZSSA 3RYHE 3NZPA 4UV8B 2J62A
chains in the Genus database with same CATH topology
4ZZCA 5LXBA 4LMJA 3UU3A 5J5GA 3U8MA 2XNTA 5LG3A 4ZK4A 3WTMA 4XK9A 3TLSA 3JAEA 4QABA 2WN9A 3SH1A 4UM3S 2XZ6A 3WTKA 4EZ1A 3PMZA 4AFTA 2BYRA 2Y57A 2YOEA 3RI5A 5BP0A 2XNVA 4ZRUA 3UQ4A 3SQ6A 4BFQA 5CFBA 2BR7A 4HFIA 3C79A 2XYSA 3TLWA 2YMDA 3RHWA 4HFHA 5J5HA 5TVCA 4ILBA 2BYQA 2X00A 4UM1A 3P4WA 4UM3A 4HFEA 4AFHA 2W8FA 2XQ8A 3TLTA 2Y58A 3WTNA 2PH9A 1OEDB 3U8JA 3WTLA 5BW2A 3ZKRA 4ZJSA 3U8KA 4TWDA 4B5DA 2WNLA 4IL4A 5HEGA 4TNWA 4FRRA 5HEHA 4TWFA 3C84A 4LMLA 4ILAA 2QC1B 3TLVA 2MAWA 3JAFA 2YN6A 2YMEA 2ZJVA 5J5FA 3LSVA 4Z90A 2BYSA 4QH5A 1UV6A 4A98A 5AFJA 4WV9A 1OEDA 5AFHA 4ZR6A 2LKHA 4HFCA 4TWHA 4ZJTA 4QACA 3WIPA 5L4HA 2WZYA 2XQ7A 2XQAA 5HCMA 5BRXA 2W8GA 3GUAA 4UM3P 1OEDE 5AFKA 4F8HA 3SIOA 5J5IA 2BG9B 4NPPA 3UU6A 3WTJA 5HEJA 2Y54A 3EAMA 4HFDA 5CO5A 2M6IA 1OEDC 2WNCA 3EHZA 2VL0A 3U8NA 3UUBA 5J0ZA 5AFMB 2XQ6A 2M6BA 4HFBA 3JADA 4A97A 4UXUA 3P50A 2LKGA 4IREA 1UX2A 5FJVA 2PGZA 3ZDGA 5AFNA 2BG9A 2BR8A 4BQTA 2Y56A 3T4MA 2YKSA 5KE4A 5AFMA 2XYTA 2LM2A 3RIFA 5SYOA 4IL9A 2BYPA 4HQPA 2XNUA 2BYNA 2BG9E 4Z91A 3UQ7A 2UZ6A 5AFLA 4NZBA 2Y7YA 2LLYA 3WTOA 2BG9C 4D01A 2XZ5A 3ZDHA 5L4EA 3WTHA 4ALXA 4DBMA 5HEUA 1I9BA 4ZK1A 3RIAA 3RQUA 4QAAA 1UW6A 2XQ5A 3RQWA 4PIRA 3WTIA 3UU8A 5HCJA 4XHEA 5HEOA 5AINA 4ZZBA 4X5TA 5L47A 3TLUA 4QH1A 5JMEA 3SQ9A 2XQ4A 3PEOA 2WNJA 4AFGA 2XQ9A 3EI0A 2X00D 2BJ0A 4COFA 3U8LA 3UU4A 2C9TA 4ILCA 5KZUA 4LMKA 3UU5A 5IUXA 2XQ3A 4QH4A 4TNVA 3IGQA 2ZJUA 4UY2A 2KSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZZC A;  5LXB A;  4LMJ A;  3UU3 A;  5J5G A;  3U8M A;  2XNT A;  5LG3 A;  4ZK4 A;  3WTM A;  4XK9 A;  3TLS A;  3JAE A;  4QAB A;  2WN9 A;  3SH1 A;  4UM3 S;  2XZ6 A;  3WTK A;  4EZ1 A;  3PMZ A;  4AFT A;  2BYR A;  2Y57 A;  2YOE A;  3RI5 A;  5BP0 A;  2XNV A;  4ZRU A;  3UQ4 A;  3SQ6 A;  4BFQ A;  5CFB A;  2BR7 A;  4HFI A;  3C79 A;  2XYS A;  3TLW A;  2YMD A;  3RHW A;  4HFH A;  5J5H A;  5TVC A;  4ILB A;  2BYQ A;  2X00 A;  4UM1 A;  3P4W A;  4UM3 A;  4HFE A;  4AFH A;  2W8F A;  2XQ8 A;  3TLT A;  2Y58 A;  3WTN A;  2PH9 A;  1OED B;  3U8J A;  3WTL A;  5BW2 A;  3ZKR A;  4ZJS A;  3U8K A;  4TWD A;  4B5D A;  2WNL A;  4IL4 A;  5HEG A;  4TNW A;  4FRR A;  5HEH A;  4TWF A;  3C84 A;  4LML A;  4ILA A;  2QC1 B;  3TLV A;  2MAW A;  3JAF A;  2YN6 A;  2YME A;  2ZJV A;  5J5F A;  3LSV A;  4Z90 A;  2BYS A;  4QH5 A;  1UV6 A;  4A98 A;  5AFJ A;  4WV9 A;  1OED A;  5AFH A;  4ZR6 A;  2LKH A;  4HFC A;  4TWH A;  4ZJT A;  4QAC A;  3WIP A;  5L4H A;  2WZY A;  2XQ7 A;  2XQA A;  5HCM A;  5BRX A;  2W8G A;  3GUA A;  4UM3 P;  1OED E;  5AFK A;  4F8H A;  3SIO A;  5J5I A;  2BG9 B;  4NPP A;  3UU6 A;  3WTJ A;  5HEJ A;  2Y54 A;  3EAM A;  4HFD A;  5CO5 A;  2M6I A;  1OED C;  2WNC A;  3EHZ A;  2VL0 A;  3U8N A;  3UUB A;  5J0Z A;  5AFM B;  2XQ6 A;  2M6B A;  4HFB A;  3JAD A;  4A97 A;  4UXU A;  3P50 A;  2LKG A;  4IRE A;  1UX2 A;  5FJV A;  2PGZ A;  3ZDG A;  5AFN A;  2BG9 A;  2BR8 A;  4BQT A;  2Y56 A;  3T4M A;  2YKS A;  5KE4 A;  5AFM A;  2XYT A;  2LM2 A;  3RIF A;  5SYO A;  4IL9 A;  2BYP A;  4HQP A;  2XNU A;  2BYN A;  2BG9 E;  4Z91 A;  3UQ7 A;  2UZ6 A;  5AFL A;  4NZB A;  2Y7Y A;  2LLY A;  3WTO A;  2BG9 C;  4D01 A;  2XZ5 A;  3ZDH A;  5L4E A;  3WTH A;  4ALX A;  4DBM A;  5HEU A;  1I9B A;  4ZK1 A;  3RIA A;  3RQU A;  4QAA A;  1UW6 A;  2XQ5 A;  3RQW A;  4PIR A;  3WTI A;  3UU8 A;  5HCJ A;  4XHE A;  5HEO A;  5AIN A;  4ZZB A;  4X5T A;  5L47 A;  3TLU A;  4QH1 A;  5JME A;  3SQ9 A;  2XQ4 A;  3PEO A;  2WNJ A;  4AFG A;  2XQ9 A;  3EI0 A;  2X00 D;  2BJ0 A;  4COF A;  3U8L A;  3UU4 A;  2C9T A;  4ILC A;  5KZU A;  4LMK A;  3UU5 A;  5IUX A;  2XQ3 A;  4QH4 A;  4TNV A;  3IGQ A;  2ZJU A;  4UY2 A;  2KSR A; 
#chains in the Genus database with same CATH topology
 4BA9 A;  4ZK4 A;  4QAB A;  5J1G A;  5AQM B;  4HWC A;  2NW8 A;  3GWH A;  4CXY A;  3KVA A;  4UEL A;  4AKG A;  2UXC T;  4IE0 A;  5FMN A;  4UEM A;  2W8F A;  4JEU B;  3RF1 A;  5A1L A;  3FXE B;  4P1N A;  2CBI A;  2X9Y A;  1MIW A;  4AI6 A;  2X0H A;  2MAW A;  5L3G B;  5JDN A;  2KLQ A;  2CBJ A;  5LA6 E;  2K5B B;  4WBN E;  3RPU A;  1UK5 A;  3T1Y T;  3U78 A;  2UUA T;  1FEW A;  2WSS V;  3IBP A;  2IC6 A;  3PUW F;  1UUS A;  4EYY R;  4B6X A;  2V6Y B;  4A97 A;  4UXU A;  4UVB B;  3QK6 A;  4WYV A;  3PDY A;  1UX2 A;  4DR2 T;  4WW0 A;  3U3I A;  1UUR A;  4DUZ T;  2BBJ A;  4DR1 T;  1HNX T;  2XNU A;  2VQF T;  3VRB A;  1XNQ T;  2BG9 E;  5KXJ A;  2RPA A;  3SS1 A;  2ZMA A;  2A72 A;  2K9A A;  5L4E A;  4U2Z A;  3EVY A;  4YJ3 E;  2CXF A;  1IZN B;  4XBF B;  3CQX C;  3NBX X;  3OBV E;  2KXP B;  3U8L A;  3UU4 A;  4TX5 A;  5IUX A;  4QH4 A;  1WFD A;  4H9O C;  3C64 A;  1VOM A;  2UXX B;  4CQI A;  4UVC B;  3AE9 A;  2Y48 B;  5LG3 A;  3FBL A;  3AE2 A;  3PUS A;  2XZ6 A;  4DV2 T;  3IEE A;  1E7P A;  4MAL A;  3RLF F;  1AJ3 A;  1IJ6 A;  2XUE A;  2NW9 A;  3P4W A;  5HXC A;  1OED B;  3I1A A;  3U8J A;  3ZKR A;  4JI6 T;  5JDM A;  2WWV A;  4AKR B;  3C84 A;  3ETU A;  4WV9 A;  4IDZ A;  2A9U A;  2E5V A;  2XAG B;  3CML A;  5HCM A;  5FY0 A;  1GQE A;  1YKH B;  4DR3 T;  2LRL A;  2Y54 A;  4PFO A;  3UUM A;  4AQF A;  2M6I A;  5AQS B;  3V5U A;  1WR6 A;  1HR0 T;  2XJ7 A;  1BR4 A;  4EGW A;  2X0Y A;  2V7I A;  3ESL A;  4PK6 A;  4CXW A;  5SYO A;  4YY3 T;  4HQP A;  1JNR A;  1WYC A;  4YT0 A;  4IDN A;  2VB6 A;  1OWA A;  1FMW A;  4G2A A;  1H7C A;  4QAA A;  1UW6 A;  2LSY A;  4QX7 B;  5TAO A;  3PJA J;  4QX8 B;  5C8Y E;  1S94 A;  4B3R T;  3AEG A;  2BJ0 A;  5LGN B;  2QA7 A;  3GA8 A;  1M62 A;  2BS4 A;  2KSR A;  4QKN A;  3Q5D A;  2H7O A;  4AKL A;  2XNT A;  2OLT A;  4O2A E;  3KV6 A;  3C50 A;  3AA1 B;  4HWF A;  2W00 A;  4MBQ A;  3LK2 B;  2IAK A;  1X79 A;  4DID B;  4IDP A;  2LJL A;  2QC1 B;  3MZK B;  5LXT E;  4KUM B;  3FB2 A;  5AQH B;  4DV1 T;  4IT4 A;  4HFC A;  4CI1 B;  4JI3 T;  4KP3 C;  4DMW A;  4DVD A;  2NP9 A;  2W8G A;  1ZKE A;  3IHR A;  2BS2 A;  1T8B A;  2CEA A;  3B5M A;  4EAH A;  3UUB A;  2CA5 A;  4O4I E;  3JAD A;  1IAP A;  1MMG A;  4JYA T;  4IDQ A;  4HKA A;  4IRE A;  1EZ3 A;  4MFR A;  3M3Z B;  3T4M A;  2LEH A;  4ZI7 E;  5JRC B;  4MHC A;  2ZLY A;  1Z8U A;  3RYC E;  4TV8 E;  3H3M A;  4X1I E;  4CXX A;  3Q5E A;  2WDV A;  3G06 A;  1W0B A;  3LFM A;  2Z6E A;  1KNZ A;  1E2A A;  4GOU A;  3ZN1 B;  4I50 E;  3BQL A;  4DV5 T;  5LBQ B;  4N78 D;  4PIR A;  2K48 A;  5L3D B;  5CB4 E;  4OHF A;  5IWA T;  2X00 D;  3ZMV B;  2XSB A;  3ZPO A;  3EDV A;  2C9T A;  4ILC A;  3FHN A;  3S4U A;  5F8P A;  4UY2 A;  5LMU T;  4UIG A;  4YSY A;  2XAJ B;  3AA0 B;  2YEV C;  2WN9 A;  2XAS B;  3P4R A;  2EHO B;  5LJN A;  2BYQ A;  2X66 A;  4ZEY A;  2I6H A;  2BVL A;  1YD8 G;  4TWD A;  2NR4 A;  2YDR A;  4HWI B;  2C0S A;  2BYS A;  1NWM X;  3OYZ A;  2ACZ A;  1MIV A;  2CPT A;  2WZY A;  5LGU B;  2E9X C;  3RKG A;  3ZMU B;  5CO5 A;  4HFD A;  2NW7 A;  3P8C D;  2W62 A;  1WR0 A;  4YTN A;  4HGA A;  3SRZ A;  3ZYK A;  1NEK A;  3T8O A;  3MXZ A;  4LFB T;  2Y7Y A;  3MA9 A;  1N33 T;  4OYJ A;  2IW5 B;  3LK3 B;  2XZ5 A;  4XAX B;  1OXZ A;  3UFE A;  3FZF B;  3F2E A;  1U5P A;  4H9S E;  2DWK A;  2X67 A;  3AE7 A;  3V5S A;  3K3Q C;  2WMO A;  3PEO A;  3RYI E;  2HN1 A;  2Q9Q C;  3PUX F;  3U8M A;  3R84 B;  3PU3 A;  5LP6 E;  3EUH A;  3VHL A;  4OFZ A;  5HXR A;  3RI5 A;  2BR7 A;  2VQE T;  2C5I T;  2YU1 A;  4AQY T;  2VKD A;  5HXH A;  4EEB A;  2WNL A;  4TN7 B;  1D1C A;  4TWF A;  3P4Q A;  3B57 A;  4U3C A;  3H3A A;  4LF8 T;  4OYK A;  5DQV A;  4UV9 B;  1HS7 A;  4U72 A;  1UX4 A;  1WYB A;  2XTL A;  2V26 A;  4IST A;  4GYS A;  2CWY A;  4PK5 A;  4GK5 E;  2C5J A;  5AFK A;  2BKO A;  1D0Z A;  4ZI2 C;  5CA0 E;  1U4Q A;  2W66 A;  2C5K T;  2X51 A;  2XZE A;  1MIY A;  2YKS A;  3CX8 B;  4CN6 A;  2RA1 A;  2UZ6 A;  1NAF A;  4LF4 T;  3SFD A;  3PE0 A;  4I0U A;  2JQ9 A;  2YIN A;  3ZDH A;  2I0M A;  3WTH A;  1UX5 A;  2WQY A;  3RX6 A;  2B1E A;  3TKL B;  4HE8 A;  4ISS A;  4LFC T;  4FI5 A;  1FJG T;  1R8I A;  1L0V A;  1HFA A;  3E0Z A;  2LE8 A;  2LSJ A;  2BKP A;  4TNV A;  5J2T E;  1HCI A;  5E0O A;  2Y6X A;  4ZS3 A;  4LMJ A;  4L9I A;  2CMR A;  2E9X D;  5DQW A;  4B3M T;  4U7I A;  5JRC A;  2XHE B;  2XM2 A;  3C4X A;  5DAB A;  2XY8 B;  4DUY T;  1HF8 A;  2WZI A;  2Y58 A;  2J4G A;  2KT9 A;  4YJ2 E;  3NRX A;  4O8S A;  1ZV4 X;  3EDU A;  4TZ4 C;  4WBO A;  4JI0 T;  5L3C B;  2ZJV A;  3WAK A;  1MMN A;  5L3B B;  4J2C A;  4AQG A;  3MKD A;  3WIP A;  5HAX A;  5LB7 B;  3K3N A;  1HX8 A;  2XM1 A;  4F8H A;  3WTJ A;  2CE7 A;  2LM9 A;  4UXN B;  4YLH A;  5JDQ A;  1OED C;  2Y8D A;  4CN4 A;  2VL0 A;  2WDR A;  2EHO A;  3RC3 A;  3UUX B;  2WAU A;  3P50 A;  3VR9 A;  4ADZ A;  2XAF B;  2L3L A;  4ZHQ E;  4JEH B;  4IE7 A;  2Q9Q D;  4XZC A;  3WI3 A;  3L39 A;  1BR1 A;  2CM0 A;  4K0U A;  4AXP A;  2JMH A;  2LOP A;  4CZZ B;  4ANJ A;  3AEA A;  2KZ7 B;  5EK3 A;  5FXZ A;  3CQG B;  1VRB A;  2WNJ A;  3N5L A;  3EI0 A;  4GIW A;  4UF0 A;  3AA6 B;  5HXE A;  2WP9 A;  4ZZC A;  4DMV A;  4UM3 S;  3SH1 A;  4GYR A;  4K0K T;  3LBX B;  4EV6 A;  3AXJ A;  1X9B A;  3N9L A;  4X20 E;  2WBL A;  4ZI2 D;  3TLW A;  3RHW A;  2PFV A;  3ETV A;  5J5H A;  2ZM6 T;  3CQC B;  2XAH B;  3ZCI A;  1Y01 A;  3MAC A;  4FRR A;  2NTX A;  5FVL A;  2HPJ A;  4A98 A;  1S35 A;  3HKC E;  5ADX L;  3ABV A;  5LGT B;  3QUJ A;  4DV0 T;  4E7S A;  1J5W A;  4I4T E;  3RRW A;  1T98 A;  1OED E;  3SIO A;  3OJA A;  2CXD A;  4EZH A;  3LK4 2;  4U74 A;  2LKG A;  1YW0 A;  1YXR A;  5KX5 E;  4O4J E;  5AFM A;  2V6X A;  2BYP A;  3L09 A;  3FZH B;  3LG7 A;  3ANW A;  4EED A;  3N2K E;  4IHJ E;  4HWD A;  3QB5 K;  5JDH A;  2VVN A;  5HCJ A;  3UT5 E;  2UXB T;  4ZZB A;  3CK6 A;  3D0T A;  3HKD E;  5HWX A;  3NVO A;  5AQQ B;  5FVK A;  3KIN B;  2JRK A;  2X0L B;  5KE4 A;  4QHO A;  2W67 A;  3O1I A;  5DJQ C;  4X1Y E;  3WAJ A;  3ZT6 A;  2L9Q A;  2X68 A;  4ERR A;  5KMG P;  4AFT A;  5BP0 A;  2XNV A;  2V7J A;  3Q5W A;  2WM9 A;  1KNP A;  2WU5 A;  5TVC A;  3R6N A;  1FMV A;  4HFE A;  2A2F X;  3JC6 C;  5LOV E;  2L8K A;  1N34 T;  4Z90 A;  1YKE B;  4QH5 A;  3C98 B;  3K8P C;  4TWH A;  4QAC A;  4QWN B;  4C90 A;  3C51 A;  2PJQ A;  5BRX A;  4UM3 P;  2LSG A;  1G73 A;  2D2S A;  5CJ5 A;  5JR9 A;  3U8N A;  3AVS A;  5ABF B;  1LRZ A;  4H9R C;  3DJB A;  2JQH A;  3C4W A;  2RP4 A;  1Z0P A;  2FUP A;  3RIU A;  5LNK A;  2MTQ A;  2X9W A;  5FP3 A;  4OX9 T;  4ZI3 C;  2VAS A;  3OVU A;  4ZS2 A;  3QB5 A;  5F5W A;  2IHR 1;  5AFU L;  3PU8 A;  4XHE A;  2UXN B;  3NWI A;  3CPZ A;  2XQ9 A;  2CXL A;  4OK0 A;  3ZT5 A;  3UU5 A;  4PNI A;  4V1A v;  5CA1 E;  3IGQ A;  4KX6 A;  2ZJU A;  3FZM B;  2H89 A;  3RYF E;  3BQI A;  2XSA A;  2H3R A;  3UU3 A;  2CLY B;  3JAE A;  3JCF A;  3KBT A;  2X9X A;  3WTK A;  4EZ1 A;  2JIW A;  5IHY A;  4QXB B;  3UQ4 A;  1I6Z A;  4HFI A;  1ZOY A;  2YMD A;  4DND A;  3E22 E;  4ILB A;  2GK9 A;  1XDO A;  4O4L E;  2XQ8 A;  4EIW A;  5BW2 A;  1D1B A;  2FJD A;  2UUB T;  2W4X A;  3KV5 A;  3AED A;  5LHI B;  3O9X A;  2DL1 A;  2V7L A;  3AA7 B;  2LKH A;  5J2U E;  2MBG A;  4MLK A;  1HNZ T;  5FL0 A;  3LBX A;  1WCR A;  5CGM A;  5AQU B;  4B3S T;  5JVD E;  4JUY A;  2YDS A;  1KF6 A;  2AE9 A;  5EZY E;  5FJV A;  2BG9 A;  4DV4 T;  5LHG B;  4YTP A;  3PUZ F;  2PTF A;  5EK4 A;  1CHU A;  2BYN A;  3VU7 H;  3F57 A;  5AQL B;  3KV4 A;  2UU9 T;  2LOS A;  1W0A A;  3N9Q A;  3I0O A;  4UF0 B;  3RIA A;  4NXN T;  2VWA A;  3RQW A;  1YQ4 A;  3LDQ B;  3JC6 D;  5C2T A;  2ZM0 A;  3MJX A;  5JDF A;  3AE8 A;  3N9N A;  1KEY A;  3AXJ B;  1IJ5 A;  5LXB A;  2ODU A;  3ONJ A;  4XK9 A;  1UGO A;  5AQR B;  3PUR A;  3ONL C;  1IBM T;  2BYR A;  4UVA B;  1W9R A;  2Y57 A;  4DR5 T;  5JTG A;  2WMN A;  4ASK A;  3GN5 B;  4QXC B;  4UM3 A;  3ZST A;  1E1H B;  3WTL A;  4F6R C;  2R6G F;  5FY7 A;  2SPC A;  2LHR A;  3N9O A;  1FIO A;  3CVR A;  3TLV A;  2YN6 A;  1UCU A;  3HL6 A;  4ZI3 D;  1UV6 A;  5ABH A;  2LSK A;  2VL8 A;  5L3F B;  3OKQ A;  4EXT A;  4GK0 E;  3W15 B;  4H63 H;  2XQA A;  2FJE A;  4NUV A;  1WRD A;  1N32 T;  1KK7 A;  3UU6 A;  2QRX A;  4PW8 A;  2BBH A;  4I43 B;  3CIR A;  5AFM B;  3PJA A;  2M6B A;  2ZM8 A;  3CWZ B;  3FZK B;  1HNW T;  1QUU A;  3PUV F;  2DNX A;  2BR8 A;  4BQT A;  2V8S V;  3CX7 B;  3X1D A;  3ANW B;  2V5D A;  5GON E;  5LBM A;  2XYT A;  3RIF A;  2XPK A;  2I59 A;  4JBW F;  3FZL B;  3F31 A;  5AQF B;  3ZYL A;  2XAQ B;  3L8R A;  4U33 A;  4KI0 F;  1M7K A;  2E9X B;  3ZYM A;  5L3E B;  3UUL A;  3ZMS B;  5LJM A;  5ABF A;  5KZU A;  3IA3 A;  3LJC A;  3ZC0 A;  2IUB A;  1QLB A;  4YHJ A;  4BAY B;  4EOZ B;  4AKH A;  3PMZ A;  2JPF A;  4ZRU A;  3SQ6 A;  2ZM2 A;  2LSI A;  4IE6 A;  4DR4 T;  2DI4 A;  2X00 A;  1W09 A;  2CWO A;  4UM1 A;  4O2B E;  5H6Q B;  2K3W A;  2PH9 A;  3GMI A;  3U8K A;  4B5D A;  4IL4 A;  2KND A;  2BKN A;  4EZ4 A;  2DCF A;  3JAF A;  4JI5 T;  2YME A;  4L0R A;  2PBI A;  5JR9 B;  3KBU A;  1DU2 A;  2XQ7 A;  3O1H A;  5FY1 A;  2H7V C;  2NWB A;  1LKX A;  3SFE A;  3EAB A;  1MMD A;  2D9D A;  2Q9Q B;  3J7Y q;  2QGS A;  4A56 A;  4P0B A;  3RRC A;  5JH7 E;  3NRY A;  2JJ9 A;  2PGZ A;  5AQK B;  2CHN A;  2ACX A;  3NKZ A;  2YDQ A;  4P09 A;  2NTY A;  2FJB A;  1BR2 A;  3AAI A;  2E5L T;  4DR7 T;  1QSD A;  2D0T A;  3ZN0 B;  5FL1 A;  2LLY A;  2H88 A;  1I9B A;  4LF9 T;  4C91 A;  3RH3 A;  3I0Q A;  5ETW A;  2KIN B;  4WZX A;  4CI3 B;  2XQ4 A;  2NOX A;  2K24 A;  3HI2 A;  5H6R B;  1JNZ A;  4FJO A;  4LF7 T;  3KFW X;  2DLR A;  4I55 E;  2VKH A;  3AEC A;  4GKK T;  1SA0 E;  3TLS A;  3O4X E;  2VK9 A;  3PV0 F;  3A8Y C;  3HR0 A;  4BFQ A;  5CFB A;  4YSZ A;  2MPK A;  4HFH A;  4H63 V;  2LHN A;  3M65 A;  3BQK A;  3N2G E;  1WLX A;  5HEG A;  2IIU A;  5HEH A;  3VR8 A;  1G8X A;  5J5F A;  4O4H E;  2ODV A;  2BS3 A;  4ZR6 A;  3PUG A;  3P7I A;  4NUU A;  3RKO A;  3L3P A;  4PJM A;  4CN1 A;  4DBR A;  2CCQ A;  2BG9 B;  5J5I A;  2HHH T;  5FXV A;  4X64 T;  2WWU A;  2V7K A;  4LFA T;  4JLE A;  3HA4 A;  2VVS A;  3GN5 A;  4L5G A;  2FJA A;  3C4Z A;  2Y56 A;  1I94 T;  2LM2 A;  4PJL A;  3Q5X A;  4IL9 A;  1Y64 B;  2IC9 A;  2OV9 A;  5LCY A;  4NXM T;  4D01 A;  3ZEF B;  1YQ3 A;  3J9X 1;  3RQU A;  3AEE A;  5L47 A;  4QH1 A;  5JME A;  1MND A;  3AE6 A;  3KDS E;  3P4S A;  4ZK1 A;  1NEN A;  5C3J A;  3DP7 A;  1SUM B;  2E8I A;  5M4Y A;  4G63 A;  4X66 T;  3ZT7 A;  5JDG A;  2WCA A;  4GKJ T;  5F3J A;  1HTJ F;  3WTN A;  3TLT A;  1SHZ C;  2E9X A;  4HEA A;  4LML A;  4YXD A;  3AVR A;  2CLY C;  5AFJ A;  4JI8 T;  2B76 A;  2BVM A;  2HPL A;  2E2A A;  3VKG A;  2QYW A;  3P4P A;  3FBZ A;  4AKI A;  1XZY A;  4NPP A;  5HEJ A;  2A3D A;  2G0U A;  3EAM A;  3CKD A;  3QOF A;  2MOZ A;  5AQJ B;  5J0Z A;  1V9D A;  4HFB A;  4U2Y A;  4YFS A;  3ZDG A;  5AQP B;  1KNR A;  2J1D G;  1HX1 B;  4IE5 A;  5ABG A;  4KHZ F;  2DWG A;  2EHO C;  5LHH B;  2HN2 A;  3ZMZ B;  4Z91 A;  4HTE A;  5AFL A;  3PTR B;  4KBM B;  3N9M A;  3WTO A;  4HFV A;  3UUN A;  4PJJ A;  4DBM A;  5HEU A;  3KVB A;  3A5X A;  2WY2 A;  2XQ5 A;  3UU8 A;  2Q9Q A;  5HEO A;  4PK4 A;  4X5T A;  1IBL T;  2WDQ A;  3CX6 B;  5FXW A;  5AQI B;  5AQG B;  2YU2 A;  3E08 A;  1HG5 A;  4H9N C;  2W61 A;  1CUN A;  3AB3 B;  4ILU A;  2F4V T;  2V1D B;  1ZP0 A;  2CRB A;  3IF8 B;  4TUY E;  1N36 T;  3AE1 A;  3WTM A;  2WZH A;  1LVF A;  4BJM A;  2JQK A;  3C79 A;  4QXH B;  1HG2 A;  3QNU A;  4M1P A;  4AFH A;  4CI2 B;  4EB6 E;  4ZJS A;  2LT3 A;  1SE7 A;  3PUA A;  1VCS A;  4TNW A;  4NIQ A;  3ZC1 A;  1B7T A;  1VCT A;  4U31 A;  5KDM C;  1J1J A;  5LYJ E;  5JQG E;  4DR6 T;  4WNK A;  2BZB A;  3EHZ A;  4DV3 T;  2V5C A;  4IE4 A;  3QC9 A;  3I9Y A;  2V7M A;  5AFN A;  3K1S A;  3AE4 A;  3OYX A;  4IIJ E;  5EK2 A;  3AE3 A;  4DV7 T;  4Z8X A;  2V6Y A;  4H9Q C;  4IDO A;  2IDO B;  3UQ7 A;  2WB5 A;  4NZB A;  2N1G A;  3O1J A;  4KHP T;  2X9H A;  4X62 T;  3VRA A;  3WTI A;  3BK9 A;  3B13 A;  4JI4 T;  2AXD S;  3TLU A;  4AQF C;  3SQ9 A;  4COF A;  5FKY A;  2JMK A;  4JI2 T;  2VUR A;  1MNE A;  2XQ3 A;  2W63 A;  2BDE A;  4ZXL A;  2M67 A;  3PUY F;  1XMQ T;  3A7M A;  1D0X A;  3K3O A;  2ES0 A;  5LG4 A;  5JDL A;  2VKO A;  3DTO A;  4P0A A;  4YHH T;  4DBQ A;  4PJN A;  3OTO T;  3I9W A;  2XQY A;  2IML A;  1D0Y A;  2VKJ A;  2EHO D;  3AAE B;  4ILA A;  4IGU A;  1ZEE A;  1OED A;  2DHR A;  5AFH A;  2WU2 A;  4JI1 T;  5L4H A;  2J47 A;  3UTK A;  3AEB A;  2WS3 A;  3MK7 C;  3Q9D A;  4YTM A;  4YSX A;  4AIS A;  2UXD T;  4U7Y A;  1T72 A;  5AQT B;  3ZMT B;  3OPC A;  3FXD B;  3PUQ A;  1ZHC A;  4X65 T;  1XMO T;  5BR8 T;  1BR0 A;  4JV5 T;  1KFY A;  5FNV E;  2QVA A;  5JR9 C;  3ZJ2 A;  4KMC A;  5LMN T;  4A5X A;  2YK0 A;  3ZLI A;  4PFP A;  4ALX A;  3RIU C;  1O3X A;  1XNR T;  5AQN B;  2JQQ A;  1T7S A;  5AIN A;  4PAG A;  2CHO A;  4HN9 A;  4LF5 T;  4AFG A;  4Q25 A;  4BJN A;  4LMK A;  2HH7 A;  5HWY A;  4E7Z A;  4ZOL E;  1J5E T;  3NZQ A;  4DV6 T;  2KWH A;  3N2O A;  5J5G A;  1D1A A;  2KWI B;  3RC8 A;  2YOE A;  4UR9 A;  2D0U A;  2W2U A;  2KMF A;  2XYS A;  3AAA B;  1XDP A;  3RGL A;  3KV9 A;  5FXX A;  3SOL A;  4H9P C;  3HKB E;  2N2N A;  3Q2M A;  5HYA A;  2PG8 A;  3SWH A;  4TV9 E;  4EYU A;  2OA5 A;  3LSV A;  4HWH A;  2D5U A;  1XWM A;  5BMV E;  3VKH A;  4ZJT A;  2UUC T;  3T1H T;  3GUA A;  5ABE A;  4B3T T;  2WNC A;  2FBW A;  5L2L A;  3ONX A;  2LRK A;  2XQ6 A;  3HKE E;  4LF6 T;  4X1K E;  2N9D A;  3N9P A;  5AQV B;  5FYM A;  3AE5 A;  1IBK T;  3AEF A;  5JRE A;  3H37 A;  2MYS A;  5HXS A;  2P9B A;  2BG9 C;  2W0G A;  3UFG A;  4JI7 T;  1LVK A;  4AIU A;  3ZCJ A;  5IYZ E;  4DO0 A;  1US7 B;  3ZJ1 A;  5AQO B;  1MMA A;  3ZSS A;  3RYH E;  3NZP A;  4UV8 B;  2J62 A; 
#chains in the Genus database with same CATH homology
 4ZZC A;  5LXB A;  4LMJ A;  3UU3 A;  5J5G A;  3U8M A;  2XNT A;  5LG3 A;  4ZK4 A;  3WTM A;  4XK9 A;  3TLS A;  3JAE A;  4QAB A;  2WN9 A;  3SH1 A;  4UM3 S;  2XZ6 A;  3WTK A;  4EZ1 A;  3PMZ A;  4AFT A;  2BYR A;  2Y57 A;  2YOE A;  3RI5 A;  5BP0 A;  2XNV A;  4ZRU A;  3UQ4 A;  3SQ6 A;  4BFQ A;  5CFB A;  2BR7 A;  4HFI A;  3C79 A;  2XYS A;  3TLW A;  2YMD A;  3RHW A;  4HFH A;  5J5H A;  5TVC A;  4ILB A;  2BYQ A;  2X00 A;  4UM1 A;  3P4W A;  4UM3 A;  4HFE A;  4AFH A;  2W8F A;  2XQ8 A;  3TLT A;  2Y58 A;  3WTN A;  2PH9 A;  1OED B;  3U8J A;  3WTL A;  5BW2 A;  3ZKR A;  4ZJS A;  3U8K A;  4TWD A;  4B5D A;  2WNL A;  4IL4 A;  5HEG A;  4TNW A;  4FRR A;  5HEH A;  4TWF A;  3C84 A;  4LML A;  4ILA A;  2QC1 B;  3TLV A;  2MAW A;  3JAF A;  2YN6 A;  2YME A;  2ZJV A;  5J5F A;  3LSV A;  4Z90 A;  2BYS A;  4QH5 A;  1UV6 A;  4A98 A;  5AFJ A;  4WV9 A;  1OED A;  5AFH A;  4ZR6 A;  2LKH A;  4HFC A;  4TWH A;  4ZJT A;  4QAC A;  3WIP A;  5L4H A;  2WZY A;  2XQ7 A;  2XQA A;  5HCM A;  5BRX A;  2W8G A;  3GUA A;  4UM3 P;  1OED E;  5AFK A;  4F8H A;  3SIO A;  5J5I A;  2BG9 B;  4NPP A;  3UU6 A;  3WTJ A;  5HEJ A;  2Y54 A;  3EAM A;  4HFD A;  5CO5 A;  2M6I A;  1OED C;  2WNC A;  3EHZ A;  2VL0 A;  3U8N A;  3UUB A;  5J0Z A;  5AFM B;  2XQ6 A;  2M6B A;  4HFB A;  3JAD A;  4A97 A;  4UXU A;  3P50 A;  2LKG A;  4IRE A;  1UX2 A;  5FJV A;  2PGZ A;  3ZDG A;  5AFN A;  2BG9 A;  2BR8 A;  4BQT A;  2Y56 A;  3T4M A;  2YKS A;  5KE4 A;  5AFM A;  2XYT A;  2LM2 A;  3RIF A;  5SYO A;  4IL9 A;  2BYP A;  4HQP A;  2XNU A;  2BYN A;  2BG9 E;  4Z91 A;  3UQ7 A;  2UZ6 A;  5AFL A;  4NZB A;  2Y7Y A;  2LLY A;  3WTO A;  2BG9 C;  4D01 A;  2XZ5 A;  3ZDH A;  5L4E A;  3WTH A;  4ALX A;  4DBM A;  5HEU A;  1I9B A;  4ZK1 A;  3RIA A;  3RQU A;  4QAA A;  1UW6 A;  2XQ5 A;  3RQW A;  4PIR A;  3WTI A;  3UU8 A;  5HCJ A;  4XHE A;  5HEO A;  5AIN A;  4ZZB A;  4X5T A;  5L47 A;  3TLU A;  4QH1 A;  5JME A;  3SQ9 A;  2XQ4 A;  3PEO A;  2WNJ A;  4AFG A;  2XQ9 A;  3EI0 A;  2X00 D;  2BJ0 A;  4COF A;  3U8L A;  3UU4 A;  2C9T A;  4ILC A;  5KZU A;  4LMK A;  3UU5 A;  5IUX A;  2XQ3 A;  4QH4 A;  4TNV A;  3IGQ A;  2ZJU A;  4UY2 A;  2KSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...