4F8HA

X-ray structure of the anesthetic ketamine bound to the glic pentameric ligand-gated ion channel
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Proton-gated ion channel
publication title Structure of the Pentameric Ligand-Gated Ion Channel GLIC Bound with Anesthetic Ketamine.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 89
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4f8hA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4f8hA01
4TWDA 4ILAA 2YMEA 3WTLA 2W8GA 2XNTA 4NPPA 4COFA 4ZR6A 2XZ5A 5L4HA 1UW6A 4X5TA 4HFDA 2X00D 3WTMA 4HFCA 5HEGA 4HFEA 3WTKA 5BW2A 3UU8A 4A98A 2Y58A 4XHEA 3U8JA 5AFMB 4ZZCA 3IGQA 2WZYA 3SH1A 2X00A 4BQTA 5AFKA 3RIFA 5CFBA 2PH9A 3JADA 4IL9A 2C9TA 4BFQA 5KE4A 5BRXA 4F8HA 3P4WA 4ZJTA 5AINA 4LMLA 2XQ3A 1OEDB 4AFTA 2Y7YA 3EHZA 3TLVA 4DBMA 3JAFA 3SQ6A 5HEUA 3TLWA 4TNVA 2BYRA 2XYSA 4LMJA 2WNJA 3U8KA 2XQ9A 2W8FA 2Y56A 4ALXA 3RI5A 2KSRA 2XQ4A 2Y57A 3WIPA 3WTJA 3UU5A 5HEJA 4FRRA 4UXUA 2BG9B 3TLTA 3UUBA 5J5HA 4ZZBA 3UU3A 4QAAA 2BYPA 3U8LA 3RQUA 3C79A 2LKHA 1OEDE 3GUAA 4WV9A 4IL4A 2LKGA 4Z91A 3C84A 4PIRA 3PMZA 2YMDA 5J0ZA 3UU6A 3PEOA 3UQ4A 1I9BA 3SIOA 4QH4A 2XQ8A 4ILBA 2WNCA 5AFHA 5IUXA 5AFNA 5LG3A 4NZBA 3T4MA 4QH1A 2QC1B 5AFLA 2XNVA 4UM3S 5J5GA 4UM1A 5BP0A 1UX2A 2Y54A 4UM3A 5J5IA 2YKSA 4A97A 2XYTA 5SYOA 2BYNA 2BJ0A 1OEDC 2WN9A 2M6IA 3WTOA 4AFGA 3ZDHA 2YOEA 2ZJVA 3EI0A 3EAMA 5CO5A 3WTHA 2BYSA 4D01A 2PGZA 3ZKRA 2VL0A 5KZUA 5JMEA 3P50A 4ILCA 5FJVA 2BR7A 3SQ9A 4AFHA 2XZ6A 4UM3P 1OEDA 4ZK1A 5L4EA 2BG9C 2MAWA 4Z90A 4HFHA 3U8NA 5LXBA 3UU4A 3U8MA 2XQAA 4UY2A 2WNLA 5HEHA 4HFBA 2BG9E 4TNWA 3RIAA 2BYQA 4B5DA 4TWHA 2YN6A 4EZ1A 5HEOA 2ZJUA 4IREA 2BG9A 5L47A 4ZRUA 2M6BA 3LSVA 2BR8A 3WTIA 5HCJA 3UQ7A 5AFJA 5AFMA 4ZK4A 4HFIA 5J5FA 3ZDGA 2XQ6A 4QABA 4TWFA 1UV6A 3TLSA 4ZJSA 4QACA 2UZ6A 4QH5A 3JAEA 4LMKA 3RHWA 2XNUA 4HQPA 5HCMA 4XK9A 5TVCA 3TLUA 2LLYA 2LM2A 2XQ7A 3RQWA 3WTNA 2XQ5A
chains in the Genus database with same CATH superfamily
3ABVA 2CRBA 4HFCA 1US7B 3WAKA 4OHFA 2CHOA 2CHNA 2ES0A 4BA9A 1UCUA 1BR2A 4IDNA 4H9NC 2BS2A 2V6XA 4OK0A 4IE4A 2YDQA 3KINB 4Z91A 2A72A 4JUYA 5J0ZA 3CX6B 2WS3A 2L3LA 5AFHA 2B1EA 2Q9QC 3NKZA 5L2LA 4UV9B 5J5GA 3AEEA 2KMFA 2MOZA 3ZDHA 3CMLA 2V7KA 1WR0A 2Q9QA 5AQJB 2X0LB 3PUSA 1MNEA 2LSGA 2UXBT 4WBNE 4CXWA 2H89A 4XBFB 3LK3B 3OBVE 3DTOA 4KP3C 5HEOA 2CPTA 5L3GB 1W9RA 3AE7A 3CPZA 3RYHE 4EEBA 4ZI7E 2CBIA 5FVKA 1G8XA 4UVBB 1IBMT 4ZI3D 4YSZA 4KX6A 1KNPA 1KNRA 3RHWA 4WNKA 2HN2A 1N34T 4XK9A 3RLFF 4LFCT 2PFVA 4YXDA 3OPCA 5FXZA 2Y58A 4XHEA 3P7IA 2XAHB 4BQTA 4DV3T 3SFEA 4U7YA 1FMVA 2W00A 1JNZA 4H63H 3GWHA 5J2TE 5AINA 3IF8B 5FY1A 2Y7YA 3EHZA 5AQIB 2VKJA 2XYSA 2WP9A 3AECA 4IIJE 4O4LE 2V7LA 5AQQB 3UUNA 4K0UA 2NOXA 4JBWF 4EZHA 3PMZA 1NAFA 1HCIA 3LBXA 1Z0PA 1YQ4A 4ZI2D 4ILBA 1SA0E 2LRKA 4YFSA 1MIWA 4O4JE 3SS1A 2D0TA 4U31A 2JQKA 3HR0A 2EHOC 5CO5A 2C5KT 1XDOA 5DQWA 5JMEA 4ERRA 3VHLA 3OJAA 2XAQB 4HKAA 4DUYT 1BR0A 3LK2B 2EHOA 4HFHA 2D9DA 4BAYB 2ZLYA 2XM2A 5JDGA 3PUVF 2UUBT 2BG9E 2IAKA 4IREA 2LE8A 2YDRA 5LGUB 1WYBA 1YQ3A 2CWOA 5FXWA 3K3QC 5CGMA 4E7SA 4YSXA 2A3DA 3OTOT 1XNQT 3CX8B 4DV4T 3LG7A 3RKGA 4JI6T 4IE7A 1M62A 4MBQA 2X68A 4WZXA 3A5XA 4E7ZA 4KMCA 3VRBA 2X00A 4X1KE 3AVSA 3AAEB 1OXZA 4CI3B 1KFYA 2HPJA 4P0BA 1MMNA 5DQVA 3CQGB 3ESLA 2MTQA 2K5BB 3AE6A 4HFVA 4UF0B 4DR5T 1Y01A 2V7IA 3P4SA 4LFBT 4GYSA 5E0OA 5JDQA 3UQ4A 4I0UA 5JH7E 2XNVA 2VQFT 2VKDA 2BJ0A 4YHJA 3WTOA 2ZJVA 4JEUB 1BR4A 2UUCT 3N9OA 4DVDA 3P8CD 3PUGA 3RF1A 3ZEFB 2BG9C 5F3JA 2D0UA 2LSIA 3RRWA 5JDNA 3AA7B 4DV2T 3RIAA 4I43B 2BG9A 3I9YA 3N5LA 4GKJT 2QYWA 2X51A 1XZYA 4X65T 4EB6E 3I1AA 4QXCB 3ONXA 2V7MA 5DABA 5EK2A 2DWGA 2XTLA 3M65A 1ZV4X 3M3ZB 2AXDS 2YMEA 3ZMSB 3RC8A 2JIWA 5ETWA 4PK4A 3P4PA 1L0VA 3C51A 5AQMB 3UU8A 2BS4A 1CHUA 1I6ZA 3ZMUB 3FXEB 2WAUA 1HF8A 4LF8T 3WAJA 2BBJA 4AFTA 1E1HB 3NZPA 1YXRA 4H9RC 2E2AA 2YU2A 2WNJA 4L0RA 4U72A 1NENA 4O8SA 1FMWA 4TX5A 5L3BB 3CVRA 3SFDA 5JRCB 5AQKB 4HWIB 2LSJA 3HKEE 4UM3S 5ADXL 3AEGA 2WDQA 1XWMA 4YSYA 5HXSA 2X0HA 2WBLA 2NWBA 4EV6A 3AAAB 5FJVA 4YTPA 2BVMA 5EZYE 4GIWA 3S4UA 3U8MA 3QK6A 2FBWA 4GOUA 2YDSA 5DJQC 1UUSA 3WI3A 2NW8A 1ZKEA 4ZRUA 2M6BA 5BR8T 5HCJA 4CN1A 2BKPA 5FXXA 1BR1A 2XNUA 4HQPA 2X9YA 2LLYA 2DWKA 1VRBA 4N78D 2CWYA 3U8JA 2J62A 2XNTA 2JMKA 3FXDB 5LYJE 1D1AA 4IE6A 5HEGA 4HFEA 3R84B 2C0SA 3K8PC 3A7MA 3KBUA 5CFBA 3L3PA 4AKHA 2H3RA 1MMDA 4I55E 3TLVA 2OLTA 3AE1A 5ABEA 2L8KA 5AQVB 2FJDA 5JDFA 4IGUA 4WV9A 1HNXT 3H3MA 4TZ4C 3J9X1 4IDOA 5LXTE 4ZS2A 2XQ8A 3CQXC 3ZC1A 3HKBE 5GONE 5AFNA 3LK42 4QXHB 3RGLA 1Y64B 2P9BA 4GYRA 4CN4A 1YD8G 1HX1B 3NVOA 3EVYA 1OEDC 3LJCA 2WZHA 2Y48B 2QRXA 3AE3A 2BR7A 2LOPA 1OEDA 2IHR1 2XAFB 4X20E 3UU4A 3VR9A 2QVAA 5AQUB 4AKLA 5L3CB 4EXTA 4JLEA 3WTIA 2LSKA 4GK0E 5LJMA 2DCFA 5BMVE 1U5PA 3L8RA 5AQNB 3SRZA 3TLUA 4CQIA 3RQWA 1S35A 2MBGA 4QX7B 3KFWX 1O3XA 3FZKB 4WW0A 1XDPA 3NZQA 4NPPA 2V6YA 2IMLA 1D0YA 4FI5A 1WYCA 4DO0A 3SH1A 3RIFA 2Q9QB 2X9HA 3BQLA 3ETUA 2J4GA 2I6HA 3AEDA 3A8YC 1YW0A 1W0BA 4LMJA 3PUWF 2BKNA 2VWAA 5JVDE 3QUJA 3AA6B 4IDQA 5JREA 2M67A 1MIYA 5FNVE 5L3EB 2CLYC 5LMUT 4HGAA 5IUXA 2K48A 2DL1A 4UM1A 2ZMAA 2Z6EA 3AEBA 2Q9QD 2YKSA 4I50E 4A97A 3ZSTA 2WCAA 4CI1B 4AFHA 4ZK1A 4MALA 2OA5A 2NR4A 2VASA 3O1IA 2W62A 2WDVA 2D2SA 2E9XC 1G73A 3UTKA 1VOMA 2E5LT 1AJ3A 2XQYA 3ZSSA 4TWFA 2HN1A 2E9XA 2X0YA 1UX4A 4B6XA 2X67A 5TVCA 3VU7H 3RH3A 2BS3A 1MIVA 5LBMA 3IEEA 3LBXB 2KWIB 4ZR6A 2A9UA 4JYAT 5IWAT 2WWVA 5JTGA 3F31A 3MA9A 1HG5A 2PBIA 2ZM0A 4YY3T 5KMGP 4Z8XA 2C9TA 4DR6T 4KBMB 3HI2A 2MYSA 4ZJTA 4H9QC 2EHOB 1LRZA 1LVKA 3HL6A 2Y57A 4M1PA 3IBPA 2JPFA 4IDZA 3Q5XA 3RQUA 2BYPA 4X66T 4HWDA 4JI5T 2XM1A 4V1Av 5ABFA 3ZT7A 2KXPB 4O4HE 3AE2A 3WTHA 3T1HT 2UXCT 3ZJ1A 1S94A 2EHOD 3SQ9A 5HWYA 3CIRA 4UM3P 1XMQT 2LT3A 1UGOA 4U2YA 2UXNB 5AQLB 3RRCA 3MKDA 5LG4A 4TWHA 2ZJUA 2FUPA 3N9PA 4IE5A 2BR8A 4ISSA 5AFJA 3AB3B 4ZK4A 2LM9A 4HFIA 3OYZA 5FMNA 1MNDA 4QACA 4EGWA 1UK5A 3QC9A 4QHOA 1HNZT 5H6QB 5AQHB 2FJBA 4JI0T 1XNRT 2OV9A 5FYMA 2JQ9A 3Q5EA 4ZOLE 2X00D 1JNRA 5F5WA 1GQEA 4DMWA 5AFKA 1IJ6A 4LF6T 3AEAA 4C91A 5HYAA 3BK9A 3P4WA 2VK9A 1HS7A 2X9XA 3PE0A 3JAFA 2JRKA 1NWMX 4BJMA 2IDOB 3FB2A 2Y56A 4DNDA 3AVRA 3WTJA 4HE8A 2BG9B 3IHRA 3KV5A 3PUZF 4AKGA 3UU3A 5AQPB 5LB7B 2LKHA 3N9MA 4U74A 3ZCJA 4DV5T 3C4XA 3GN5A 1DU2A 4O4IE 4ISTA 5J5IA 1ZHCA 3O4XE 5J1GA 5JR9C 4NUUA 4ADZA 5LP6E 4U33A 1IAPA 2K9AA 3P50A 3MJXA 3LDQB 4DV0T 2ODVA 2LOSA 5JR9A 2MAWA 5FL0A 2LSYA 4AQYT 4PK5A 2IC6A 1NEKA 4NXMT 2YINA 2XQ6A 3MACA 1UV6A 5AQRB 1U4QA 1D1BA 2I0MA 5C3JA 4YTMA 4QH5A 4PJLA 4DBRA 5HXRA 1QLBA 3UT5E 4LF5T 3ZN0B 3JC6C 5JDHA 2XSBA 2XQ5A 2YEVC 2F4VT 3H3AA 3EDUA 3VKGA 1UW6A 2CBJA 3CQCB 3HA4A 5AFMB 3IGQA 3G06A 1UX5A 2PH9A 2CMRA 3JADA 1J5WA 2WM9A 2UXDT 3C4WA 4EZ4A 3FZFB 3RYFE 2KSRA 2YU1A 4FRRA 5LA6E 2PTFA 2WU5A 5FY0A 2DI4A 2WDRA 2CA5A 2WMOA 4YTNA 4OYKA 4G2AA 1W0AA 3ZMTB 4XAXB 5CA1E 3QOFA 2G0UA 4JI4T 4G63A 3T4MA 3D0TA 4B3MT 3OKQA 2QGSA 2RPAA 3C4ZA 5LJNA 4DR3T 2PGZA 3AE9A 3UUMA 5JDLA 5EK4A 5IHYA 3X1DA 5HXCA 4UY2A 2WNLA 2CXFA 1N36T 5L47A 3AE4A 5AFMA 4QABA 3ZJ2A 4QWNB 3AA1B 2W0GA 2KLQA 4X1YE 4O2BE 4O2AE 4FJOA 3AXJA 5AQGB 4PNIA 4COFA 2K24A 2LEHA 3U3IA 3KVBA 4BJNA 4A98A 3RYIE 2CCQA 2WZYA 3AE5A 2QA7A 3E22E 2NW9A 4GK5E 5CJ5A 1OEDB 4JEHB 3CK6A 4KUMB 2KINB 5LMNT 3RI5A 4UXUA 5J5HA 3TLTA 3UUBA 3UUXB 2KNDA 4IE0A 2SPCA 2XSAA 3NBXX 5C8YE 1YKEB 3UU6A 4ILUA 4ZS3A 3QNUA 3SIOA 4QH4A 2L9QA 4WBOA 5LG3A 3DJBA 5FXVA 2J47A 1WCRA 4TN7B 5SYOA 2XY8B 2WB5A 4AFGA 2YOEA 5AQSB 2LHNA 2JJ9A 2V6YB 4AIUA 2C5IT 3CKDA 4MHCA 4TUYE 1IJ5A 4Q25A 1B7TA 1ZOYA 2V26A 4ANJA 2FJEA 1IBKT 2ZM8A 3LSVA 3UQ7A 1D1CA 3GA8A 4KHZF 2IW5B 4P1NA 4ZJSA 1SHZC 4J2CA 3C98B 4B3RT 5HCMA 2LM2A 4HEAA 2WMNA 4JI8T 2V1DB 3KV4A 1MMAA 4LF7T 3IA3A 1T8BA 5L3FB 2UUAT 1ZP0A 3WTKA 2KT9A 5BW2A 2CLYB 1J5ET 4BFQA 4YHHT 2MPKA 3I0OA 4F8HA 4HWHA 3O9XA 1CUNA 3PU3A 4UELA 3V5UA 2BYRA 2VVSA 1T98A 3AA0B 4DIDB 3WIPA 4NIQA 4U7IA 1QSDA 3VR8A 5AQOB 3U8LA 4LF9T 3ZYLA 2E9XB 4CXYA 4AISA 4PW8A 4JI3T 5LBQB 4L9IA 5HXHA 2CE7A 2PG8A 2I59A 2E5VA 2ACZA 2WWUA 2BYNA 2KWHA 4D01A 3ZKRA 4IDPA 2NTYA 1IZNB 2FJAA 3C64A 3FBZA 5L3DB 3U8NA 2XQAA 1EZ3A 5HEHA 4F6RC 2YN6A 4UEMA 3OVUA 2E9XD 2AE9A 1D0XA 3MZKB 1SE7A 4P09A 1HFAA 4H9OC 4PK6A 4UV8B 3JAEA 2LJLA 4MLKA 1SUMB 3PUYF 2XQ7A 4YT0A 5HEJA 5LHGB 5ABFB 3QB5K 2ACXA 3ZT5A 5M4YA 1FJGT 2XZ5A 2A2FX 2WQYA 4L5GA 2PJQA 4CXXA 4EAHA 4UXNB 3RC3A 5FY7A 3MK7C 2BVLA 2UU9T 2XJ7A 5HEUA 2JQQA 5FKYA 2XQ9A 4ALXA 1J1JA 3UU5A 3EUHA 4ZZBA 2ZM2A 4EYYR 1WFDA 2BKOA 5JQGE 3L09A 3ANWA 2BZBA 3C84A 2C5JA 4DBQA 2CEAA 5AFLA 4AQGA 5AQFB 4HTEA 1UX2A 4UM3A 4K0KT 2K3WA 2WN9A 2CXLA 2M6IA 3EI0A 5KZUA 4C90A 5ABGA 1OWAA 4UR9A 2B76A 2YK0A 4EIWA 4X64T 3SOLA 1XMOT 1W09A 3KVAA 4TNWA 2RP4A 2VL8A 2VURA 3BQKA 3PJAA 3ONJA 3ONLC 4ZI3C 3PUQA 3TLSA 2UZ6A 1KEYA 5AFUL 2XHEB 4I4TE 4DV7T 4X62T 1I94T 3TKLB 3GN5B 3EABA 4ZXLA 4WYVA 4KHPT 3NWIA 4AXPA 4ZZCA 4IT4A 4IL9A 1T7SA 2D5UA 3K1SA 1WR6A 2R6GF 4LMLA 4EEDA 5JR9B 1LKXA 1H7CA 3ZYMA 4MFRA 3VRAA 1ZEEA 4HWFA 3U8KA 1VCTA 3FZHB 2XQ4A 1X9BA 4LF4T 3LFMA 4QXBB 1X79A 3PUXF 5HXEA 4QAAA 4AQFC 1QUUA 5LHHB 4IL4A 3CX7B 4ZI2C 4A56A 3PEOA 1I9BA 4AQFA 3F2EA 2NP9A 2HPLA 2V5DA 2KZ7B 2XUEA 3ZC0A 4PJMA 4JI2T 3SWHA 3V5SA 3KV6A 2VKOA 4NXNT 4DR2T 2VVNA 5LOVE 4A5XA 3UFGA 2H88A 3FZLB 2BDEA 4UVCB 2UXXB 3Q9DA 4PJNA 4HFBA 1N32T 2W67A 5J5FA 3ZDGA 3L39A 2IIUA 2CM0A 2XZEA 4IHJE 3U78A 4X1IE 2XAGB 1HNWT 3RYCE 2Y6XA 2ODUA 4DMVA 3W15B 2LKGA 4TWDA 1HTJF 3JC6D 3RPUA 3Q5WA 4U2ZA 3ZLIA 5L4HA 3N9QA 4X5TA 4HFDA 3PJAJ 3PDYA 2W4XA 1V9DA 3ZCIA 5HWXA 3E08A 1HX8A 5BRXA 4PFOA 2HH7A 4P0AA 4JI1T 3TLWA 3FHNA 2W61A 2CXDA 4HN9A 3HKDE 4QKNA 4YJ3E 4UIGA 3CWZB 3RIUC 2WZIA 4JI7T 1FIOA 4XZCA 2E8IA 1WRDA 2X9WA 2ZM6T 3AE8A 3RIUA 3N2KE 4DR4T 2JQHA 2Y8DA 5F8PA 4QH1A 2XAJB 4UVAB 3ETVA 3RKOA 3VKHA 3OYXA 3AXJB 2XYTA 1YKHB 4AI6A 2VL0A 3KV9A 1KNZA 2IUBA 3Q5DA 4OYJA 5ABHA 5FVLA 4YJ2E 2BYQA 1KK7A 3ZT6A 3T8OA 5LNKA 2J1DG 4TV9E 4UF0A 1VCSA 5CA0E 4H9SE 3Q2MA 1M7KA 3DP7A 2DNXA 2N1GA 3UFEA 4ASKA 5LGTB 3N9LA 4KI0F 3K3NA 3ZYKA 4ILAA 3KBTA 4ZEYA 3PV0F 4GKKT 4DUZT 5IYZE 1LVFA 2DHRA 4OX9T 3AEFA 3O1HA 3H37A 3C50A 2V8SV 5KE4A 3N9NA 3F57A 3N2GE 1N33T 3I9WA 5KDMC 3FBLA 2NTXA 4AKRB 5HAXA 2NW7A 5H6RB 3C79A 1OEDE 3GUAA 4PIRA 4NUVA 4EYUA 5JDMA 3MXZA 4CI2B 2WNCA 2VKHA 2W63A 2QC1B 2X66A 1KF6A 1E7PA 4H9PC 2Y54A 2VB6A 5CB4E 3PURA 2H7OA 3T1YT 2JMHA 4B3TT 3ZMVB 5KXJA 3EDVA 2XZ6A 5L4EA 2N9DA 4H63V 2VQET 5LXBA 3GMIA 4YLHA 2GK9A 5EK3A 5LCYA 5JRCA 1T72A 4B3ST 4HWCA 1MMGA 4DV6T 1FEWA 4LMKA 4PFPA 1D0ZA 2BBHA 3WTNA 3NRXA 3WTLA 2W8GA 2XPKA 3PU8A 5LGNB 3HKCE 3R6NA 3WTMA 3BQIA 1HG2A 4DR7T 3JCFA 4LFAT 3ZN1B 3RX6A 2W2UA 4JV5T 3I0QA 3FZMB 5AQTB 3K3OA 2V7JA 2XQ3A 4DBMA 3SQ6A 4TNVA 3KDSE 2W8FA 3N2OA 1E2AA 5KX5E 3B13A 3P4QA 4CN6A 5LHIB 4PJJA 2RA1A 2V5CA 2WY2A 2YMDA 5TAOA 3P4RA 2LRLA 3PUAA 3J7Yq 4NZBA 1IBLT 3ZMZB 1Z8UA 4PAGA 5BP0A 2XASB 3B5MA 1UURA 3O1JA 3EAMA 4CZZB 4TV8E 2BYSA 5C2TA 3PTRB 4OFZA 4AKIA 4ILCA 3QB5A 1HR0T 1WLXA 4Z90A 2N2NA 2HHHT 4DR1T 2DLRA 1R8IA 4DV1T 4QX8B 5FP3A 4ZHQE 4B5DA 4EZ1A 3NRYA 2WSSV 3E0ZA 2WU2A 5J2UE 5A1LA 3B57A 3AAIA 3ZPOA 2W66A 5FL1A 2H7VC 3ANWB 4EOZB 2IC9A 3UULA 4U3CA 2LHRA
chains in the Genus database with same CATH topology
4TWDA 4ILAA 2YMEA 3WTLA 2W8GA 2XNTA 4NPPA 4COFA 4ZR6A 2XZ5A 5L4HA 1UW6A 4X5TA 4HFDA 2X00D 3WTMA 4HFCA 5HEGA 4HFEA 3WTKA 5BW2A 3UU8A 4A98A 2Y58A 4XHEA 3U8JA 5AFMB 4ZZCA 3IGQA 2WZYA 3SH1A 2X00A 4BQTA 5AFKA 3RIFA 5CFBA 2PH9A 3JADA 4IL9A 2C9TA 4BFQA 5KE4A 5BRXA 4F8HA 3P4WA 4ZJTA 5AINA 4LMLA 2XQ3A 1OEDB 4AFTA 2Y7YA 3EHZA 3TLVA 4DBMA 3JAFA 3SQ6A 5HEUA 3TLWA 4TNVA 2BYRA 2XYSA 4LMJA 2WNJA 3U8KA 2XQ9A 2W8FA 2Y56A 4ALXA 3RI5A 2KSRA 2XQ4A 2Y57A 3WIPA 3WTJA 3UU5A 5HEJA 4FRRA 4UXUA 2BG9B 3TLTA 3UUBA 5J5HA 4ZZBA 3UU3A 4QAAA 2BYPA 3U8LA 3RQUA 3C79A 2LKHA 1OEDE 3GUAA 4WV9A 4IL4A 2LKGA 4Z91A 3C84A 4PIRA 3PMZA 2YMDA 5J0ZA 3UU6A 3PEOA 3UQ4A 1I9BA 3SIOA 4QH4A 2XQ8A 4ILBA 2WNCA 5AFHA 5IUXA 5AFNA 5LG3A 4NZBA 3T4MA 4QH1A 2QC1B 5AFLA 2XNVA 4UM3S 5J5GA 4UM1A 5BP0A 1UX2A 2Y54A 4UM3A 5J5IA 2YKSA 4A97A 2XYTA 5SYOA 2BYNA 2BJ0A 1OEDC 2WN9A 2M6IA 3WTOA 4AFGA 3ZDHA 2YOEA 2ZJVA 3EI0A 3EAMA 5CO5A 3WTHA 2BYSA 4D01A 2PGZA 3ZKRA 2VL0A 5KZUA 5JMEA 3P50A 4ILCA 5FJVA 2BR7A 3SQ9A 4AFHA 2XZ6A 4UM3P 1OEDA 4ZK1A 5L4EA 2BG9C 2MAWA 4Z90A 4HFHA 3U8NA 5LXBA 3UU4A 3U8MA 2XQAA 4UY2A 2WNLA 5HEHA 4HFBA 2BG9E 4TNWA 3RIAA 2BYQA 4B5DA 4TWHA 2YN6A 4EZ1A 5HEOA 2ZJUA 4IREA 2BG9A 5L47A 4ZRUA 2M6BA 3LSVA 2BR8A 3WTIA 5HCJA 3UQ7A 5AFJA 5AFMA 4ZK4A 4HFIA 5J5FA 3ZDGA 2XQ6A 4QABA 4TWFA 1UV6A 3TLSA 4ZJSA 4QACA 2UZ6A 4QH5A 3JAEA 4LMKA 3RHWA 2XNUA 4HQPA 5HCMA 4XK9A 5TVCA 3TLUA 2LLYA 2LM2A 2XQ7A 3RQWA 3WTNA 2XQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TWD A;  4ILA A;  2YME A;  3WTL A;  2W8G A;  2XNT A;  4NPP A;  4COF A;  4ZR6 A;  2XZ5 A;  5L4H A;  1UW6 A;  4X5T A;  4HFD A;  2X00 D;  3WTM A;  4HFC A;  5HEG A;  4HFE A;  3WTK A;  5BW2 A;  3UU8 A;  4A98 A;  2Y58 A;  4XHE A;  3U8J A;  5AFM B;  4ZZC A;  3IGQ A;  2WZY A;  3SH1 A;  2X00 A;  4BQT A;  5AFK A;  3RIF A;  5CFB A;  2PH9 A;  3JAD A;  4IL9 A;  2C9T A;  4BFQ A;  5KE4 A;  5BRX A;  4F8H A;  3P4W A;  4ZJT A;  5AIN A;  4LML A;  2XQ3 A;  1OED B;  4AFT A;  2Y7Y A;  3EHZ A;  3TLV A;  4DBM A;  3JAF A;  3SQ6 A;  5HEU A;  3TLW A;  4TNV A;  2BYR A;  2XYS A;  4LMJ A;  2WNJ A;  3U8K A;  2XQ9 A;  2W8F A;  2Y56 A;  4ALX A;  3RI5 A;  2KSR A;  2XQ4 A;  2Y57 A;  3WIP A;  3WTJ A;  3UU5 A;  5HEJ A;  4FRR A;  4UXU A;  2BG9 B;  3TLT A;  3UUB A;  5J5H A;  4ZZB A;  3UU3 A;  4QAA A;  2BYP A;  3U8L A;  3RQU A;  3C79 A;  2LKH A;  1OED E;  3GUA A;  4WV9 A;  4IL4 A;  2LKG A;  4Z91 A;  3C84 A;  4PIR A;  3PMZ A;  2YMD A;  5J0Z A;  3UU6 A;  3PEO A;  3UQ4 A;  1I9B A;  3SIO A;  4QH4 A;  2XQ8 A;  4ILB A;  2WNC A;  5AFH A;  5IUX A;  5AFN A;  5LG3 A;  4NZB A;  3T4M A;  4QH1 A;  2QC1 B;  5AFL A;  2XNV A;  4UM3 S;  5J5G A;  4UM1 A;  5BP0 A;  1UX2 A;  2Y54 A;  4UM3 A;  5J5I A;  2YKS A;  4A97 A;  2XYT A;  5SYO A;  2BYN A;  2BJ0 A;  1OED C;  2WN9 A;  2M6I A;  3WTO A;  4AFG A;  3ZDH A;  2YOE A;  2ZJV A;  3EI0 A;  3EAM A;  5CO5 A;  3WTH A;  2BYS A;  4D01 A;  2PGZ A;  3ZKR A;  2VL0 A;  5KZU A;  5JME A;  3P50 A;  4ILC A;  5FJV A;  2BR7 A;  3SQ9 A;  4AFH A;  2XZ6 A;  4UM3 P;  1OED A;  4ZK1 A;  5L4E A;  2BG9 C;  2MAW A;  4Z90 A;  4HFH A;  3U8N A;  5LXB A;  3UU4 A;  3U8M A;  2XQA A;  4UY2 A;  2WNL A;  5HEH A;  4HFB A;  2BG9 E;  4TNW A;  3RIA A;  2BYQ A;  4B5D A;  4TWH A;  2YN6 A;  4EZ1 A;  5HEO A;  2ZJU A;  4IRE A;  2BG9 A;  5L47 A;  4ZRU A;  2M6B A;  3LSV A;  2BR8 A;  3WTI A;  5HCJ A;  3UQ7 A;  5AFJ A;  5AFM A;  4ZK4 A;  4HFI A;  5J5F A;  3ZDG A;  2XQ6 A;  4QAB A;  4TWF A;  1UV6 A;  3TLS A;  4ZJS A;  4QAC A;  2UZ6 A;  4QH5 A;  3JAE A;  4LMK A;  3RHW A;  2XNU A;  4HQP A;  5HCM A;  4XK9 A;  5TVC A;  3TLU A;  2LLY A;  2LM2 A;  2XQ7 A;  3RQW A;  3WTN A;  2XQ5 A; 
#chains in the Genus database with same CATH topology
 3ABV A;  2CRB A;  4HFC A;  1US7 B;  3WAK A;  4OHF A;  2CHO A;  2CHN A;  2ES0 A;  4BA9 A;  1UCU A;  1BR2 A;  4IDN A;  4H9N C;  2BS2 A;  2V6X A;  4OK0 A;  4IE4 A;  2YDQ A;  3KIN B;  4Z91 A;  2A72 A;  4JUY A;  5J0Z A;  3CX6 B;  2WS3 A;  2L3L A;  5AFH A;  2B1E A;  2Q9Q C;  3NKZ A;  5L2L A;  4UV9 B;  5J5G A;  3AEE A;  2KMF A;  2MOZ A;  3ZDH A;  3CML A;  2V7K A;  1WR0 A;  2Q9Q A;  5AQJ B;  2X0L B;  3PUS A;  1MNE A;  2LSG A;  2UXB T;  4WBN E;  4CXW A;  2H89 A;  4XBF B;  3LK3 B;  3OBV E;  3DTO A;  4KP3 C;  5HEO A;  2CPT A;  5L3G B;  1W9R A;  3AE7 A;  3CPZ A;  3RYH E;  4EEB A;  4ZI7 E;  2CBI A;  5FVK A;  1G8X A;  4UVB B;  1IBM T;  4ZI3 D;  4YSZ A;  4KX6 A;  1KNP A;  1KNR A;  3RHW A;  4WNK A;  2HN2 A;  1N34 T;  4XK9 A;  3RLF F;  4LFC T;  2PFV A;  4YXD A;  3OPC A;  5FXZ A;  2Y58 A;  4XHE A;  3P7I A;  2XAH B;  4BQT A;  4DV3 T;  3SFE A;  4U7Y A;  1FMV A;  2W00 A;  1JNZ A;  4H63 H;  3GWH A;  5J2T E;  5AIN A;  3IF8 B;  5FY1 A;  2Y7Y A;  3EHZ A;  5AQI B;  2VKJ A;  2XYS A;  2WP9 A;  3AEC A;  4IIJ E;  4O4L E;  2V7L A;  5AQQ B;  3UUN A;  4K0U A;  2NOX A;  4JBW F;  4EZH A;  3PMZ A;  1NAF A;  1HCI A;  3LBX A;  1Z0P A;  1YQ4 A;  4ZI2 D;  4ILB A;  1SA0 E;  2LRK A;  4YFS A;  1MIW A;  4O4J E;  3SS1 A;  2D0T A;  4U31 A;  2JQK A;  3HR0 A;  2EHO C;  5CO5 A;  2C5K T;  1XDO A;  5DQW A;  5JME A;  4ERR A;  3VHL A;  3OJA A;  2XAQ B;  4HKA A;  4DUY T;  1BR0 A;  3LK2 B;  2EHO A;  4HFH A;  2D9D A;  4BAY B;  2ZLY A;  2XM2 A;  5JDG A;  3PUV F;  2UUB T;  2BG9 E;  2IAK A;  4IRE A;  2LE8 A;  2YDR A;  5LGU B;  1WYB A;  1YQ3 A;  2CWO A;  5FXW A;  3K3Q C;  5CGM A;  4E7S A;  4YSX A;  2A3D A;  3OTO T;  1XNQ T;  3CX8 B;  4DV4 T;  3LG7 A;  3RKG A;  4JI6 T;  4IE7 A;  1M62 A;  4MBQ A;  2X68 A;  4WZX A;  3A5X A;  4E7Z A;  4KMC A;  3VRB A;  2X00 A;  4X1K E;  3AVS A;  3AAE B;  1OXZ A;  4CI3 B;  1KFY A;  2HPJ A;  4P0B A;  1MMN A;  5DQV A;  3CQG B;  3ESL A;  2MTQ A;  2K5B B;  3AE6 A;  4HFV A;  4UF0 B;  4DR5 T;  1Y01 A;  2V7I A;  3P4S A;  4LFB T;  4GYS A;  5E0O A;  5JDQ A;  3UQ4 A;  4I0U A;  5JH7 E;  2XNV A;  2VQF T;  2VKD A;  2BJ0 A;  4YHJ A;  3WTO A;  2ZJV A;  4JEU B;  1BR4 A;  2UUC T;  3N9O A;  4DVD A;  3P8C D;  3PUG A;  3RF1 A;  3ZEF B;  2BG9 C;  5F3J A;  2D0U A;  2LSI A;  3RRW A;  5JDN A;  3AA7 B;  4DV2 T;  3RIA A;  4I43 B;  2BG9 A;  3I9Y A;  3N5L A;  4GKJ T;  2QYW A;  2X51 A;  1XZY A;  4X65 T;  4EB6 E;  3I1A A;  4QXC B;  3ONX A;  2V7M A;  5DAB A;  5EK2 A;  2DWG A;  2XTL A;  3M65 A;  1ZV4 X;  3M3Z B;  2AXD S;  2YME A;  3ZMS B;  3RC8 A;  2JIW A;  5ETW A;  4PK4 A;  3P4P A;  1L0V A;  3C51 A;  5AQM B;  3UU8 A;  2BS4 A;  1CHU A;  1I6Z A;  3ZMU B;  3FXE B;  2WAU A;  1HF8 A;  4LF8 T;  3WAJ A;  2BBJ A;  4AFT A;  1E1H B;  3NZP A;  1YXR A;  4H9R C;  2E2A A;  2YU2 A;  2WNJ A;  4L0R A;  4U72 A;  1NEN A;  4O8S A;  1FMW A;  4TX5 A;  5L3B B;  3CVR A;  3SFD A;  5JRC B;  5AQK B;  4HWI B;  2LSJ A;  3HKE E;  4UM3 S;  5ADX L;  3AEG A;  2WDQ A;  1XWM A;  4YSY A;  5HXS A;  2X0H A;  2WBL A;  2NWB A;  4EV6 A;  3AAA B;  5FJV A;  4YTP A;  2BVM A;  5EZY E;  4GIW A;  3S4U A;  3U8M A;  3QK6 A;  2FBW A;  4GOU A;  2YDS A;  5DJQ C;  1UUS A;  3WI3 A;  2NW8 A;  1ZKE A;  4ZRU A;  2M6B A;  5BR8 T;  5HCJ A;  4CN1 A;  2BKP A;  5FXX A;  1BR1 A;  2XNU A;  4HQP A;  2X9Y A;  2LLY A;  2DWK A;  1VRB A;  4N78 D;  2CWY A;  3U8J A;  2J62 A;  2XNT A;  2JMK A;  3FXD B;  5LYJ E;  1D1A A;  4IE6 A;  5HEG A;  4HFE A;  3R84 B;  2C0S A;  3K8P C;  3A7M A;  3KBU A;  5CFB A;  3L3P A;  4AKH A;  2H3R A;  1MMD A;  4I55 E;  3TLV A;  2OLT A;  3AE1 A;  5ABE A;  2L8K A;  5AQV B;  2FJD A;  5JDF A;  4IGU A;  4WV9 A;  1HNX T;  3H3M A;  4TZ4 C;  3J9X 1;  4IDO A;  5LXT E;  4ZS2 A;  2XQ8 A;  3CQX C;  3ZC1 A;  3HKB E;  5GON E;  5AFN A;  3LK4 2;  4QXH B;  3RGL A;  1Y64 B;  2P9B A;  4GYR A;  4CN4 A;  1YD8 G;  1HX1 B;  3NVO A;  3EVY A;  1OED C;  3LJC A;  2WZH A;  2Y48 B;  2QRX A;  3AE3 A;  2BR7 A;  2LOP A;  1OED A;  2IHR 1;  2XAF B;  4X20 E;  3UU4 A;  3VR9 A;  2QVA A;  5AQU B;  4AKL A;  5L3C B;  4EXT A;  4JLE A;  3WTI A;  2LSK A;  4GK0 E;  5LJM A;  2DCF A;  5BMV E;  1U5P A;  3L8R A;  5AQN B;  3SRZ A;  3TLU A;  4CQI A;  3RQW A;  1S35 A;  2MBG A;  4QX7 B;  3KFW X;  1O3X A;  3FZK B;  4WW0 A;  1XDP A;  3NZQ A;  4NPP A;  2V6Y A;  2IML A;  1D0Y A;  4FI5 A;  1WYC A;  4DO0 A;  3SH1 A;  3RIF A;  2Q9Q B;  2X9H A;  3BQL A;  3ETU A;  2J4G A;  2I6H A;  3AED A;  3A8Y C;  1YW0 A;  1W0B A;  4LMJ A;  3PUW F;  2BKN A;  2VWA A;  5JVD E;  3QUJ A;  3AA6 B;  4IDQ A;  5JRE A;  2M67 A;  1MIY A;  5FNV E;  5L3E B;  2CLY C;  5LMU T;  4HGA A;  5IUX A;  2K48 A;  2DL1 A;  4UM1 A;  2ZMA A;  2Z6E A;  3AEB A;  2Q9Q D;  2YKS A;  4I50 E;  4A97 A;  3ZST A;  2WCA A;  4CI1 B;  4AFH A;  4ZK1 A;  4MAL A;  2OA5 A;  2NR4 A;  2VAS A;  3O1I A;  2W62 A;  2WDV A;  2D2S A;  2E9X C;  1G73 A;  3UTK A;  1VOM A;  2E5L T;  1AJ3 A;  2XQY A;  3ZSS A;  4TWF A;  2HN1 A;  2E9X A;  2X0Y A;  1UX4 A;  4B6X A;  2X67 A;  5TVC A;  3VU7 H;  3RH3 A;  2BS3 A;  1MIV A;  5LBM A;  3IEE A;  3LBX B;  2KWI B;  4ZR6 A;  2A9U A;  4JYA T;  5IWA T;  2WWV A;  5JTG A;  3F31 A;  3MA9 A;  1HG5 A;  2PBI A;  2ZM0 A;  4YY3 T;  5KMG P;  4Z8X A;  2C9T A;  4DR6 T;  4KBM B;  3HI2 A;  2MYS A;  4ZJT A;  4H9Q C;  2EHO B;  1LRZ A;  1LVK A;  3HL6 A;  2Y57 A;  4M1P A;  3IBP A;  2JPF A;  4IDZ A;  3Q5X A;  3RQU A;  2BYP A;  4X66 T;  4HWD A;  4JI5 T;  2XM1 A;  4V1A v;  5ABF A;  3ZT7 A;  2KXP B;  4O4H E;  3AE2 A;  3WTH A;  3T1H T;  2UXC T;  3ZJ1 A;  1S94 A;  2EHO D;  3SQ9 A;  5HWY A;  3CIR A;  4UM3 P;  1XMQ T;  2LT3 A;  1UGO A;  4U2Y A;  2UXN B;  5AQL B;  3RRC A;  3MKD A;  5LG4 A;  4TWH A;  2ZJU A;  2FUP A;  3N9P A;  4IE5 A;  2BR8 A;  4ISS A;  5AFJ A;  3AB3 B;  4ZK4 A;  2LM9 A;  4HFI A;  3OYZ A;  5FMN A;  1MND A;  4QAC A;  4EGW A;  1UK5 A;  3QC9 A;  4QHO A;  1HNZ T;  5H6Q B;  5AQH B;  2FJB A;  4JI0 T;  1XNR T;  2OV9 A;  5FYM A;  2JQ9 A;  3Q5E A;  4ZOL E;  2X00 D;  1JNR A;  5F5W A;  1GQE A;  4DMW A;  5AFK A;  1IJ6 A;  4LF6 T;  3AEA A;  4C91 A;  5HYA A;  3BK9 A;  3P4W A;  2VK9 A;  1HS7 A;  2X9X A;  3PE0 A;  3JAF A;  2JRK A;  1NWM X;  4BJM A;  2IDO B;  3FB2 A;  2Y56 A;  4DND A;  3AVR A;  3WTJ A;  4HE8 A;  2BG9 B;  3IHR A;  3KV5 A;  3PUZ F;  4AKG A;  3UU3 A;  5AQP B;  5LB7 B;  2LKH A;  3N9M A;  4U74 A;  3ZCJ A;  4DV5 T;  3C4X A;  3GN5 A;  1DU2 A;  4O4I E;  4IST A;  5J5I A;  1ZHC A;  3O4X E;  5J1G A;  5JR9 C;  4NUU A;  4ADZ A;  5LP6 E;  4U33 A;  1IAP A;  2K9A A;  3P50 A;  3MJX A;  3LDQ B;  4DV0 T;  2ODV A;  2LOS A;  5JR9 A;  2MAW A;  5FL0 A;  2LSY A;  4AQY T;  4PK5 A;  2IC6 A;  1NEK A;  4NXM T;  2YIN A;  2XQ6 A;  3MAC A;  1UV6 A;  5AQR B;  1U4Q A;  1D1B A;  2I0M A;  5C3J A;  4YTM A;  4QH5 A;  4PJL A;  4DBR A;  5HXR A;  1QLB A;  3UT5 E;  4LF5 T;  3ZN0 B;  3JC6 C;  5JDH A;  2XSB A;  2XQ5 A;  2YEV C;  2F4V T;  3H3A A;  3EDU A;  3VKG A;  1UW6 A;  2CBJ A;  3CQC B;  3HA4 A;  5AFM B;  3IGQ A;  3G06 A;  1UX5 A;  2PH9 A;  2CMR A;  3JAD A;  1J5W A;  2WM9 A;  2UXD T;  3C4W A;  4EZ4 A;  3FZF B;  3RYF E;  2KSR A;  2YU1 A;  4FRR A;  5LA6 E;  2PTF A;  2WU5 A;  5FY0 A;  2DI4 A;  2WDR A;  2CA5 A;  2WMO A;  4YTN A;  4OYK A;  4G2A A;  1W0A A;  3ZMT B;  4XAX B;  5CA1 E;  3QOF A;  2G0U A;  4JI4 T;  4G63 A;  3T4M A;  3D0T A;  4B3M T;  3OKQ A;  2QGS A;  2RPA A;  3C4Z A;  5LJN A;  4DR3 T;  2PGZ A;  3AE9 A;  3UUM A;  5JDL A;  5EK4 A;  5IHY A;  3X1D A;  5HXC A;  4UY2 A;  2WNL A;  2CXF A;  1N36 T;  5L47 A;  3AE4 A;  5AFM A;  4QAB A;  3ZJ2 A;  4QWN B;  3AA1 B;  2W0G A;  2KLQ A;  4X1Y E;  4O2B E;  4O2A E;  4FJO A;  3AXJ A;  5AQG B;  4PNI A;  4COF A;  2K24 A;  2LEH A;  3U3I A;  3KVB A;  4BJN A;  4A98 A;  3RYI E;  2CCQ A;  2WZY A;  3AE5 A;  2QA7 A;  3E22 E;  2NW9 A;  4GK5 E;  5CJ5 A;  1OED B;  4JEH B;  3CK6 A;  4KUM B;  2KIN B;  5LMN T;  3RI5 A;  4UXU A;  5J5H A;  3TLT A;  3UUB A;  3UUX B;  2KND A;  4IE0 A;  2SPC A;  2XSA A;  3NBX X;  5C8Y E;  1YKE B;  3UU6 A;  4ILU A;  4ZS3 A;  3QNU A;  3SIO A;  4QH4 A;  2L9Q A;  4WBO A;  5LG3 A;  3DJB A;  5FXV A;  2J47 A;  1WCR A;  4TN7 B;  5SYO A;  2XY8 B;  2WB5 A;  4AFG A;  2YOE A;  5AQS B;  2LHN A;  2JJ9 A;  2V6Y B;  4AIU A;  2C5I T;  3CKD A;  4MHC A;  4TUY E;  1IJ5 A;  4Q25 A;  1B7T A;  1ZOY A;  2V26 A;  4ANJ A;  2FJE A;  1IBK T;  2ZM8 A;  3LSV A;  3UQ7 A;  1D1C A;  3GA8 A;  4KHZ F;  2IW5 B;  4P1N A;  4ZJS A;  1SHZ C;  4J2C A;  3C98 B;  4B3R T;  5HCM A;  2LM2 A;  4HEA A;  2WMN A;  4JI8 T;  2V1D B;  3KV4 A;  1MMA A;  4LF7 T;  3IA3 A;  1T8B A;  5L3F B;  2UUA T;  1ZP0 A;  3WTK A;  2KT9 A;  5BW2 A;  2CLY B;  1J5E T;  4BFQ A;  4YHH T;  2MPK A;  3I0O A;  4F8H A;  4HWH A;  3O9X A;  1CUN A;  3PU3 A;  4UEL A;  3V5U A;  2BYR A;  2VVS A;  1T98 A;  3AA0 B;  4DID B;  3WIP A;  4NIQ A;  4U7I A;  1QSD A;  3VR8 A;  5AQO B;  3U8L A;  4LF9 T;  3ZYL A;  2E9X B;  4CXY A;  4AIS A;  4PW8 A;  4JI3 T;  5LBQ B;  4L9I A;  5HXH A;  2CE7 A;  2PG8 A;  2I59 A;  2E5V A;  2ACZ A;  2WWU A;  2BYN A;  2KWH A;  4D01 A;  3ZKR A;  4IDP A;  2NTY A;  1IZN B;  2FJA A;  3C64 A;  3FBZ A;  5L3D B;  3U8N A;  2XQA A;  1EZ3 A;  5HEH A;  4F6R C;  2YN6 A;  4UEM A;  3OVU A;  2E9X D;  2AE9 A;  1D0X A;  3MZK B;  1SE7 A;  4P09 A;  1HFA A;  4H9O C;  4PK6 A;  4UV8 B;  3JAE A;  2LJL A;  4MLK A;  1SUM B;  3PUY F;  2XQ7 A;  4YT0 A;  5HEJ A;  5LHG B;  5ABF B;  3QB5 K;  2ACX A;  3ZT5 A;  5M4Y A;  1FJG T;  2XZ5 A;  2A2F X;  2WQY A;  4L5G A;  2PJQ A;  4CXX A;  4EAH A;  4UXN B;  3RC3 A;  5FY7 A;  3MK7 C;  2BVL A;  2UU9 T;  2XJ7 A;  5HEU A;  2JQQ A;  5FKY A;  2XQ9 A;  4ALX A;  1J1J A;  3UU5 A;  3EUH A;  4ZZB A;  2ZM2 A;  4EYY R;  1WFD A;  2BKO A;  5JQG E;  3L09 A;  3ANW A;  2BZB A;  3C84 A;  2C5J A;  4DBQ A;  2CEA A;  5AFL A;  4AQG A;  5AQF B;  4HTE A;  1UX2 A;  4UM3 A;  4K0K T;  2K3W A;  2WN9 A;  2CXL A;  2M6I A;  3EI0 A;  5KZU A;  4C90 A;  5ABG A;  1OWA A;  4UR9 A;  2B76 A;  2YK0 A;  4EIW A;  4X64 T;  3SOL A;  1XMO T;  1W09 A;  3KVA A;  4TNW A;  2RP4 A;  2VL8 A;  2VUR A;  3BQK A;  3PJA A;  3ONJ A;  3ONL C;  4ZI3 C;  3PUQ A;  3TLS A;  2UZ6 A;  1KEY A;  5AFU L;  2XHE B;  4I4T E;  4DV7 T;  4X62 T;  1I94 T;  3TKL B;  3GN5 B;  3EAB A;  4ZXL A;  4WYV A;  4KHP T;  3NWI A;  4AXP A;  4ZZC A;  4IT4 A;  4IL9 A;  1T7S A;  2D5U A;  3K1S A;  1WR6 A;  2R6G F;  4LML A;  4EED A;  5JR9 B;  1LKX A;  1H7C A;  3ZYM A;  4MFR A;  3VRA A;  1ZEE A;  4HWF A;  3U8K A;  1VCT A;  3FZH B;  2XQ4 A;  1X9B A;  4LF4 T;  3LFM A;  4QXB B;  1X79 A;  3PUX F;  5HXE A;  4QAA A;  4AQF C;  1QUU A;  5LHH B;  4IL4 A;  3CX7 B;  4ZI2 C;  4A56 A;  3PEO A;  1I9B A;  4AQF A;  3F2E A;  2NP9 A;  2HPL A;  2V5D A;  2KZ7 B;  2XUE A;  3ZC0 A;  4PJM A;  4JI2 T;  3SWH A;  3V5S A;  3KV6 A;  2VKO A;  4NXN T;  4DR2 T;  2VVN A;  5LOV E;  4A5X A;  3UFG A;  2H88 A;  3FZL B;  2BDE A;  4UVC B;  2UXX B;  3Q9D A;  4PJN A;  4HFB A;  1N32 T;  2W67 A;  5J5F A;  3ZDG A;  3L39 A;  2IIU A;  2CM0 A;  2XZE A;  4IHJ E;  3U78 A;  4X1I E;  2XAG B;  1HNW T;  3RYC E;  2Y6X A;  2ODU A;  4DMV A;  3W15 B;  2LKG A;  4TWD A;  1HTJ F;  3JC6 D;  3RPU A;  3Q5W A;  4U2Z A;  3ZLI A;  5L4H A;  3N9Q A;  4X5T A;  4HFD A;  3PJA J;  3PDY A;  2W4X A;  1V9D A;  3ZCI A;  5HWX A;  3E08 A;  1HX8 A;  5BRX A;  4PFO A;  2HH7 A;  4P0A A;  4JI1 T;  3TLW A;  3FHN A;  2W61 A;  2CXD A;  4HN9 A;  3HKD E;  4QKN A;  4YJ3 E;  4UIG A;  3CWZ B;  3RIU C;  2WZI A;  4JI7 T;  1FIO A;  4XZC A;  2E8I A;  1WRD A;  2X9W A;  2ZM6 T;  3AE8 A;  3RIU A;  3N2K E;  4DR4 T;  2JQH A;  2Y8D A;  5F8P A;  4QH1 A;  2XAJ B;  4UVA B;  3ETV A;  3RKO A;  3VKH A;  3OYX A;  3AXJ B;  2XYT A;  1YKH B;  4AI6 A;  2VL0 A;  3KV9 A;  1KNZ A;  2IUB A;  3Q5D A;  4OYJ A;  5ABH A;  5FVL A;  4YJ2 E;  2BYQ A;  1KK7 A;  3ZT6 A;  3T8O A;  5LNK A;  2J1D G;  4TV9 E;  4UF0 A;  1VCS A;  5CA0 E;  4H9S E;  3Q2M A;  1M7K A;  3DP7 A;  2DNX A;  2N1G A;  3UFE A;  4ASK A;  5LGT B;  3N9L A;  4KI0 F;  3K3N A;  3ZYK A;  4ILA A;  3KBT A;  4ZEY A;  3PV0 F;  4GKK T;  4DUZ T;  5IYZ E;  1LVF A;  2DHR A;  4OX9 T;  3AEF A;  3O1H A;  3H37 A;  3C50 A;  2V8S V;  5KE4 A;  3N9N A;  3F57 A;  3N2G E;  1N33 T;  3I9W A;  5KDM C;  3FBL A;  2NTX A;  4AKR B;  5HAX A;  2NW7 A;  5H6R B;  3C79 A;  1OED E;  3GUA A;  4PIR A;  4NUV A;  4EYU A;  5JDM A;  3MXZ A;  4CI2 B;  2WNC A;  2VKH A;  2W63 A;  2QC1 B;  2X66 A;  1KF6 A;  1E7P A;  4H9P C;  2Y54 A;  2VB6 A;  5CB4 E;  3PUR A;  2H7O A;  3T1Y T;  2JMH A;  4B3T T;  3ZMV B;  5KXJ A;  3EDV A;  2XZ6 A;  5L4E A;  2N9D A;  4H63 V;  2VQE T;  5LXB A;  3GMI A;  4YLH A;  2GK9 A;  5EK3 A;  5LCY A;  5JRC A;  1T72 A;  4B3S T;  4HWC A;  1MMG A;  4DV6 T;  1FEW A;  4LMK A;  4PFP A;  1D0Z A;  2BBH A;  3WTN A;  3NRX A;  3WTL A;  2W8G A;  2XPK A;  3PU8 A;  5LGN B;  3HKC E;  3R6N A;  3WTM A;  3BQI A;  1HG2 A;  4DR7 T;  3JCF A;  4LFA T;  3ZN1 B;  3RX6 A;  2W2U A;  4JV5 T;  3I0Q A;  3FZM B;  5AQT B;  3K3O A;  2V7J A;  2XQ3 A;  4DBM A;  3SQ6 A;  4TNV A;  3KDS E;  2W8F A;  3N2O A;  1E2A A;  5KX5 E;  3B13 A;  3P4Q A;  4CN6 A;  5LHI B;  4PJJ A;  2RA1 A;  2V5C A;  2WY2 A;  2YMD A;  5TAO A;  3P4R A;  2LRL A;  3PUA A;  3J7Y q;  4NZB A;  1IBL T;  3ZMZ B;  1Z8U A;  4PAG A;  5BP0 A;  2XAS B;  3B5M A;  1UUR A;  3O1J A;  3EAM A;  4CZZ B;  4TV8 E;  2BYS A;  5C2T A;  3PTR B;  4OFZ A;  4AKI A;  4ILC A;  3QB5 A;  1HR0 T;  1WLX A;  4Z90 A;  2N2N A;  2HHH T;  4DR1 T;  2DLR A;  1R8I A;  4DV1 T;  4QX8 B;  5FP3 A;  4ZHQ E;  4B5D A;  4EZ1 A;  3NRY A;  2WSS V;  3E0Z A;  2WU2 A;  5J2U E;  5A1L A;  3B57 A;  3AAI A;  3ZPO A;  2W66 A;  5FL1 A;  2H7V C;  3ANW B;  4EOZ B;  2IC9 A;  3UUL A;  4U3C A;  2LHR A; 
#chains in the Genus database with same CATH homology
 4TWD A;  4ILA A;  2YME A;  3WTL A;  2W8G A;  2XNT A;  4NPP A;  4COF A;  4ZR6 A;  2XZ5 A;  5L4H A;  1UW6 A;  4X5T A;  4HFD A;  2X00 D;  3WTM A;  4HFC A;  5HEG A;  4HFE A;  3WTK A;  5BW2 A;  3UU8 A;  4A98 A;  2Y58 A;  4XHE A;  3U8J A;  5AFM B;  4ZZC A;  3IGQ A;  2WZY A;  3SH1 A;  2X00 A;  4BQT A;  5AFK A;  3RIF A;  5CFB A;  2PH9 A;  3JAD A;  4IL9 A;  2C9T A;  4BFQ A;  5KE4 A;  5BRX A;  4F8H A;  3P4W A;  4ZJT A;  5AIN A;  4LML A;  2XQ3 A;  1OED B;  4AFT A;  2Y7Y A;  3EHZ A;  3TLV A;  4DBM A;  3JAF A;  3SQ6 A;  5HEU A;  3TLW A;  4TNV A;  2BYR A;  2XYS A;  4LMJ A;  2WNJ A;  3U8K A;  2XQ9 A;  2W8F A;  2Y56 A;  4ALX A;  3RI5 A;  2KSR A;  2XQ4 A;  2Y57 A;  3WIP A;  3WTJ A;  3UU5 A;  5HEJ A;  4FRR A;  4UXU A;  2BG9 B;  3TLT A;  3UUB A;  5J5H A;  4ZZB A;  3UU3 A;  4QAA A;  2BYP A;  3U8L A;  3RQU A;  3C79 A;  2LKH A;  1OED E;  3GUA A;  4WV9 A;  4IL4 A;  2LKG A;  4Z91 A;  3C84 A;  4PIR A;  3PMZ A;  2YMD A;  5J0Z A;  3UU6 A;  3PEO A;  3UQ4 A;  1I9B A;  3SIO A;  4QH4 A;  2XQ8 A;  4ILB A;  2WNC A;  5AFH A;  5IUX A;  5AFN A;  5LG3 A;  4NZB A;  3T4M A;  4QH1 A;  2QC1 B;  5AFL A;  2XNV A;  4UM3 S;  5J5G A;  4UM1 A;  5BP0 A;  1UX2 A;  2Y54 A;  4UM3 A;  5J5I A;  2YKS A;  4A97 A;  2XYT A;  5SYO A;  2BYN A;  2BJ0 A;  1OED C;  2WN9 A;  2M6I A;  3WTO A;  4AFG A;  3ZDH A;  2YOE A;  2ZJV A;  3EI0 A;  3EAM A;  5CO5 A;  3WTH A;  2BYS A;  4D01 A;  2PGZ A;  3ZKR A;  2VL0 A;  5KZU A;  5JME A;  3P50 A;  4ILC A;  5FJV A;  2BR7 A;  3SQ9 A;  4AFH A;  2XZ6 A;  4UM3 P;  1OED A;  4ZK1 A;  5L4E A;  2BG9 C;  2MAW A;  4Z90 A;  4HFH A;  3U8N A;  5LXB A;  3UU4 A;  3U8M A;  2XQA A;  4UY2 A;  2WNL A;  5HEH A;  4HFB A;  2BG9 E;  4TNW A;  3RIA A;  2BYQ A;  4B5D A;  4TWH A;  2YN6 A;  4EZ1 A;  5HEO A;  2ZJU A;  4IRE A;  2BG9 A;  5L47 A;  4ZRU A;  2M6B A;  3LSV A;  2BR8 A;  3WTI A;  5HCJ A;  3UQ7 A;  5AFJ A;  5AFM A;  4ZK4 A;  4HFI A;  5J5F A;  3ZDG A;  2XQ6 A;  4QAB A;  4TWF A;  1UV6 A;  3TLS A;  4ZJS A;  4QAC A;  2UZ6 A;  4QH5 A;  3JAE A;  4LMK A;  3RHW A;  2XNU A;  4HQP A;  5HCM A;  4XK9 A;  5TVC A;  3TLU A;  2LLY A;  2LM2 A;  2XQ7 A;  3RQW A;  3WTN A;  2XQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...