4F8HA

X-ray structure of the anesthetic ketamine bound to the glic pentameric ligand-gated ion channel
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structure of the Pentameric Ligand-Gated Ion Channel GLIC Bound with Anesthetic Ketamine.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 89
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4f8hA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4f8hA01
2W8FA 3WTOA 3JAFA 4QH5A 5HEUA 4HFEA 4LMKA 4UM3P 2YOEA 4A98A 3PEOA 2Y54A 5CO5A 4NPPA 2XQ4A 3WIPA 2XQ7A 3UU5A 4ZZBA 4QACA 4WV9A 5CFBA 2VL0A 4UXUA 3UU8A 4ZR6A 4UY2A 4QABA 2BYPA 5BP0A 5HCMA 3WTJA 2BYQA 3RQUA 3UU4A 5AFHA 2LM2A 2XQ6A 2XQ3A 3TLWA 4COFA 4HFCA 4F8HA 5LXBA 5AFMB 4ZZCA 3WTNA 5BW2A 5KZUA 3JAEA 3SQ9A 4AFHA 5AFMA 4HQPA 4HFDA 2QC1B 2PGZA 2XZ6A 3P50A 2WNCA 5TVCA 4QH4A 5J5GA 4IL9A 2UZ6A 5AFKA 2XQAA 4IL4A 2BYNA 2WNLA 2BR7A 4Z91A 4ILBA 4TNWA 3TLTA 3U8KA 5J5IA 2XZ5A 2M6IA 3SH1A 5HEHA 2BR8A 2X00D 4ZJTA 3JADA 4HFBA 4ZJSA 2BYRA 3IGQA 3UQ4A 3UU3A 4IREA 2XQ8A 4Z90A 2Y7YA 3EI0A 5AFLA 5AINA 5LG3A 2XNTA 3ZDGA 3WTKA 2X00A 5JMEA 5KE4A 3EHZA 3WTMA 3U8MA 3WTLA 3TLSA 1OEDE 2BG9E 2YN6A 2XYTA 5L4HA 3C84A 5J5HA 4ZK1A 3TLUA 3TLVA 4DBMA 3RIAA 4TWDA 1I9BA 2BYSA 2YMEA 2LKGA 2MAWA 4HFIA 3ZKRA 1OEDC 1UV6A 2BG9C 4AFTA 4UM3A 3EAMA 5AFJA 5AFNA 5IUXA 1OEDB 5HEOA 2BG9B 2BJ0A 2Y56A 2PH9A 4EZ1A 3U8JA 3U8NA 3UUBA 2ZJVA 1OEDA 4BQTA 5HCJA 2BG9A 5SYOA 4A97A 1UX2A 4BFQA 3WTHA 3P4WA 4ILAA 2XNUA 4ZRUA 3UU6A 3T4MA 2KSRA 2M6BA 2XYSA 4UM3S 3RHWA 4PIRA 3WTIA 3LSVA 4NZBA 4TWFA 4X5TA 3GUAA 4XK9A 2ZJUA 3U8LA 4B5DA 4ILCA 4TNVA 2W8GA 3C79A 4UM1A 4TWHA 5L47A 4QAAA 5BRXA 3PMZA 4ZK4A 2Y58A 2C9TA 4HFHA 2LLYA 2YMDA 4QH1A 5HEJA 5J5FA 4AFGA 5HEGA 5FJVA 4LMJA 2LKHA 4D01A 2WN9A 2XNVA 1UW6A 2XQ9A 2YKSA 3RIFA 3RI5A 4XHEA 4FRRA 2Y57A 2WNJA 3SQ6A 4ALXA 3ZDHA 5J0ZA 2XQ5A 3RQWA 2WZYA 5L4EA 3UQ7A 3SIOA 4LMLA
chains in the Genus database with same CATH superfamily
4QH5A 3I9WA 3CPZA 3VRBA 3RC3A 2XQ7A 4HWCA 4CI2B 2VL0A 3OTOT 3J9X1 3LDQB 2XQ6A 3H3MA 2C5JA 2J4GA 4NXNT 1XMOT 2X51A 3TLTA 5J5IA 2N2NA 1T98A 2V7JA 1L0VA 3UUNA 2Y6XA 4H9NC 3EI0A 2NWBA 3I1AA 4QKNA 2X00A 2BS3A 3RPUA 3U8MA 3KINB 3AEFA 3TLSA 2CWYA 5JRCA 3OJAA 2YMEA 2HN1A 4HFIA 5JDNA 5JDFA 3PUWF 4WYVA 3CWZB 4O4LE 2JJ9A 4GKJT 3FXEB 1UX2A 2CLYC 2W00A 1CUNA 4CXXA 2R6GF 1QSDA 1ZOYA 4ISSA 3E08A 4B5DA 1HFAA 5AQRB 4TWHA 2M67A 4ZK4A 2Y58A 4OYJA 3FZMB 4UV8B 5JR9B 3AB3B 2NTYA 3F31A 3AE9A 4HGAA 3GMIA 2WQYA 2XQ9A 4NUVA 5KXJA 3K3OA 4N78D 3SQ6A 1HX1B 1V9DA 4AXPA 5JDMA 2V8SV 2AXDS 4UM3P 2Z6EA 3H37A 2XHEB 2HN2A 4YTNA 1NEKA 2BYQA 4U31A 2QRXA 5L2LA 1HX8A 5LHGB 3F2EA 3RLFF 1AJ3A 2Y8DA 3ZPOA 4EAHA 3HKBE 5BR8T 3AE5A 3Q5WA 2DNXA 5FMNA 2CRBA 5FVKA 5DABA 1XNQT 2ZM2A 2H7OA 3L39A 4EYUA 1QUUA 2XJ7A 2W66A 4Z90A 4KHZF 2Y7YA 4LF5T 3NRYA 2KMFA 2UUAT 5KE4A 1S35A 2FJEA 3KVBA 3IBPA 3WTMA 5HWYA 3KBTA 4JLEA 3MKDA 2EHOD 2Y56A 2F4VT 3Q5XA 2JMKA 3W15B 4BFQA 4YY3T 4YHHT 1UUSA 5LMUT 2M6BA 5LJMA 3KV9A 3S4UA 2WDVA 4L9IA 3FB2A 5JR9C 1UCUA 3RYIE 4DR5T 2LLYA 5AFUL 4Q25A 4LF6T 4PW8A 5J1GA 4HTEA 3PU3A 1XZYA 2IMLA 4ALXA 5J0ZA 4TV8E 3SIOA 1SE7A 3UULA 4PJNA 3AE3A 5AQVB 5JH7E 5LA6E 3C51A 3L3PA 5L3FB 1E2AA 3RQUA 4MFRA 1Z8UA 4UV9B 3ZN0B 3PE0A 3FZFB 2ZM6T 5J5GA 3SWHA 4ZOLE 1G73A 2VQET 4LF9T 3OYZA 2YU1A 2JRKA 3JADA 4ZJSA 3OBVE 4XBFB 4DR2T 5AQQB 3F57A 1LVKA 1FIOA 5M4YA 2BKNA 2FJAA 4L5GA 4B3TT 3PUYF 1HNZT 2XAFB 4ZI7E 3ONXA 4ZI3D 3K3NA 2XYTA 2XTLA 3EDUA 4IDOA 2YU2A 1ZP0A 4PFOA 2DHRA 5AFJA 3JC6C 5HYAA 1JNZA 2NP9A 2ZJVA 4A5XA 4A97A 1IJ6A 2KWHA 1T72A 3FXDB 4TNVA 4CXWA 4F6RC 1MIWA 2MOZA 3AVRA 5JVDE 3AEDA 4JI0T 4AIUA 3CVRA 2HPJA 3LK42 1HG2A 2D5UA 4JI3T 3RQWA 4KHPT 3U3IA 3WTOA 4GIWA 3PEOA 3ZMZB 2XQ4A 2D0TA 5KX5E 3ZSSA 3WTJA 2CBJA 4QX7B 3TLWA 3UUMA 1UX4A 5AQMB 3P8CD 1VCSA 3L8RA 3ZJ1A 4OK0A 4YLHA 4AQYT 4QH4A 2VKJA 2ODUA 1XMQT 2XQAA 4IL4A 2VVNA 2IAKA 1IZNB 3AEEA 5F5WA 4K0UA 4Z91A 2ZM0A 4AISA 5HEHA 4MLKA 2LRKA 2IC9A 3UU3A 2BBHA 1T7SA 1UGOA 2WMOA 4MBQA 2V7IA 3H3AA 2WB5A 5L3GB 2AE9A 3RIAA 4JI8T 4WW0A 1FMWA 2MAWA 3P4QA 2XAHB 4G63A 1NWMX 2H89A 2CEAA 3EVYA 2V6XA 4YXDA 4DR4T 1BR1A 2PG8A 2EHOA 4AKHA 3LSVA 4HEAA 3FHNA 2Q9QB 3NWIA 1MMNA 4UELA 2X9YA 4HFHA 2VKOA 4DBQA 2CWOA 2JQQA 2UUBT 4H9QC 2GK9A 2DI4A 5JDLA 3O9XA 1HR0T 4WV9A 4ZR6A 2ZLYA 2CHOA 2W67A 3PUGA 4X20E 3CX8B 4IE6A 3WTNA 4DR1T 5FP3A 3N9OA 4EB6E 1U5PA 3X1DA 4NUUA 5LCYA 1KNRA 2I0MA 5AQIB 2RPAA 4LFCT 5AQFB 5CGMA 2K3WA 3ZMUB 2CM0A 2BYRA 2UUCT 2WS3A 3ZJ2A 5LBQB 2K48A 2E9XB 1KFYA 4O2BE 1XDOA 1D0ZA 3HL6A 3AXJA 4AKIA 2W61A 3BK9A 1I9BA 5LP6E 2UXBT 4DV5T 3P7IA 4FJOA 2LSYA 3K3QC 4QWNB 1OEDA 2BG9A 5CA0E 1YQ4A 1OWAA 2MYSA 3CK6A 2E5VA 4HWHA 2Y48B 2XYSA 2RA1A 2Q9QC 4UM3S 3WTIA 4BAYB 2HPLA 3ETUA 4UM1A 4UVCB 4CI1B 3ONJA 2YMDA 5HEJA 1XDPA 3RC8A 1I6ZA 2WMNA 3VRAA 2YDQA 2NR4A 1QLBA 4EOZB 3ZDHA 2XQ5A 2WZYA 5FXVA 3AE8A 3NRXA 3M65A 3P4RA 3PUSA 4CXYA 4UXUA 4PJLA 2UU9T 1E1HB 5FXXA 2BBJA 5AFHA 3O1IA 4HFCA 4ZZCA 3AAEB 4AFHA 5AFMA 3ZN1B 2XAGB 2JQKA 4G2AA 2I59A 3ESLA 5DQWA 4DNDA 2ZM8A 3ZLIA 3UT5E 2KT9A 1MNDA 4PJJA 2LJLA 1N32T 3UQ4A 2JMHA 5ABGA 1HF8A 3QUJA 2E9XC 3LBXB 3C64A 3RYHE 5JMEA 2H7VC 2BVMA 3UFGA 4U7IA 3WTLA 5KMGP 2UXNB 4XZCA 4ZK1A 4XAXB 2LKGA 4BJNA 3EAMA 2VKDA 3QOFA 5JTGA 4IE0A 1IJ5A 2MBGA 3ETVA 2BS4A 2E8IA 4QH1A 4B3RT 1CHUA 2X0LB 2NTXA 2LKHA 4D01A 1FJGT 2W4XA 4I4TE 2JQHA 5LHHB 2X9HA 5AFNA 2VASA 1YD8G 4EXTA 2DL1A 2PJQA 4ADZA 3WIPA 5EZYE 4AKRB 3N9NA 1T8BA 3QC9A 4CQIA 5HCMA 4O4HE 3B5MA 2P9BA 5ABFA 3ZC1A 2X68A 3RX6A 4IGUA 2W0GA 3IHRA 1N34T 5AQTB 4ANJA 3N9LA 1MIVA 2C0SA 3ZYLA 3T1YT 4ZI2C 3RKGA 3IGQA 2MTQA 3WAJA 1D1AA 2V1DB 2V7LA 4DR6T 4AQGA 3PUZF 1WFDA 4LF7T 5F3JA 2YN6A 4DV6T 3TLUA 1BR4A 3JC6D 1WYCA 2CE7A 3QK6A 4C90A 2OLTA 4HE8A 1N33T 3P4WA 4HFVA 5FXZA 3AAIA 2YDSA 4DBRA 3OYXA 5HXHA 4UXNB 3UTKA 3OVUA 5CB4E 2ZJUA 5JQGE 1ZHCA 3AAAB 4JI7T 2B76A 2XASB 2KXPB 4AFGA 4U2ZA 2W2UA 3M3ZB 4UEMA 3AE2A 1O3XA 3RI5A 5FL0A 3NBXX 2W8FA 3JAFA 1KK7A 2W63A 5AQHB 2DWGA 4O4IE 4JI6T 4COFA 2QGSA 4JUYA 2WDQA 3ANWB 4X66T 4C91A 3GN5B 4HFDA 4YFSA 2QC1B 4IDNA 3LBXA 5J2TE 1BR0A 3RRCA 1ZKEA 2BR7A 2K9AA 3MZKB 4ILBA 5LBMA 4MHCA 4IIJE 5FYMA 3IF8B 4FI5A 1UX5A 4IREA 4DMVA 3TKLB 3ZDGA 2PBIA 5HWXA 2JQ9A 2X0YA 3HKCE 2FUPA 4JBWF 1YKEB 5LNKA 2LSJA 2WSSV 3ZKRA 4AFTA 5A1LA 4NXMT 5IUXA 2DCFA 3RH3A 2YDRA 5EK3A 4YSXA 3CQGB 3HR0A 2DLRA 2D2SA 3KFWX 3C4ZA 5IHYA 3AVSA 4V1Av 5FKYA 3A7MA 4KUMB 3Q2MA 4HWFA 3K1SA 5EK4A 4PNIA 4IDZA 3KDSE 3LG7A 4TN7B 5L3CB 2CMRA 4I55E 3PMZA 2BZBA 5H6QB 5JR9A 4BJMA 1VOMA 4L0RA 2ACXA 3KV4A 5FXWA 4CN4A 2V7KA 4U74A 3QB5K 2WNJA 1OXZA 3AEAA 2V6YB 4DV3T 2ZMAA 1YW0A 3PUXF 2V5CA 4UF0B 5BP0A 4Z8XA 2LM2A 4HN9A 2IDOB 3J7Yq 4F8HA 1Y01A 4BA9A 5EK2A 3HKDE 2VURA 4GK0E 2PTFA 4JI4T 3EABA 4UR9A 3NZPA 4QXHB 2HH7A 3PUVF 2BYNA 1N36T 3I9YA 2XZ5A 2M6IA 3AECA 4QX8B 4CN1A 4O2AE 2YEVC 5BMVE 3CMLA 3RIUC 1JNRA 5C3JA 3O1JA 2A72A 2XM1A 3RF1A 4DV4T 5J5HA 1HG5A 3AA7B 2VB6A 4IDQA 1UV6A 3P4PA 3N2OA 1KNPA 4TUYE 2KNDA 3U8JA 4GKKT 1FEWA 2Q9QD 1NAFA 2CXFA 2WWUA 3ZMVB 4U33A 2IW5B 5KDMC 4PIRA 4X5TA 5L3BB 3U8LA 5ADXL 4OX9T 3E0ZA 2WU2A 4QXCB 3OKQA 2N9DA 3N2GE 5LGNB 5TAOA 1YXRA 3KV6A 4FRRA 3CX7B 2PGZA 2YINA 4PK5A 5HEUA 1J5WA 3I0QA 1E7PA 4ZZBA 4QACA 4PAGA 3SFEA 5DJQC 4UY2A 4QABA 1GQEA 1DU2A 3HI2A 3RKOA 1SA0E 4AI6A 5AQUB 5LXTE 5JDGA 2D0UA 2KZ7B 5TVCA 5CA1E 1MMAA 4TNWA 3A5XA 2ES0A 3PV0F 2XQ8A 2E9XD 5FY7A 4JI1T 2ACZA 4X1IE 2XNTA 2VQFT 1B7TA 2IUBA 5JRCB 2C5KT 3N9QA 3PUQA 2BJ0A 2PH9A 5HCJA 4ZEYA 1UK5A 2HHHT 4GYSA 3SFDA 4DR7T 1Z0PA 2LE8A 3B57A 4E7SA 3O4XE 2LHRA 2CXDA 3T8OA 5HEGA 2WZHA 1EZ3A 2X9XA 3C4WA 2WN9A 3QB5A 4AKGA 3BQLA 4UVBB 1IBKT 2Y57A 4B3ST 5AQGB 5ABEA 5FVLA 4A98A 4YSYA 2Y54A 4PK4A 4KI0F 4OFZA 2ODVA 4H9OC 1G8XA 2PFVA 4WZXA 5AQSB 3VHLA 3A8YC 1VRBA 3T1HT 5BW2A 5KZUA 2XM2A 4HQPA 2JPFA 4B6XA 1VCTA 4IL9A 5AFKA 2FBWA 4YSZA 4GYRA 3PURA 5GONE 3N9PA 4ZI2D 4JEHB 4LF8T 4TX5A 2WBLA 4HFBA 3FZLB 3E22E 3Q9DA 3ZC0A 4EEDA 4O8SA 1WLXA 5AINA 5AQLB 5L4HA 1MMGA 2BKPA 4DV2T 2L9QA 3SS1A 4DUZT 3I0OA 2KLQA 1US7B 2XAQB 5HEOA 4EZ1A 5SYOA 2LSKA 2FJDA 3WTHA 4A56A 3PTRB 3T4MA 2KSRA 4PFPA 3N2KE 3PU8A 4TWFA 4WBNE 2Q9QA 5LMNT 3ONLC 4YJ2E 4JI2T 4DUYT 4O4JE 3CQCB 5HXSA 2WWVA 3CKDA 3OPCA 3NVOA 3RYCE 1XNRT 2YOEA 4JYAT 4AKLA 1J5ET 3IA3A 5AQKB 4HWIB 4KX6A 3CIRA 5LYJE 3LJCA 3FBZA 4IT4A 4AQFC 3ZMTB 2BS2A 1FMVA 5AQOB 3NKZA 3ZMSB 2XZ6A 5F8PA 4U2YA 4EZHA 2WNLA 3U8KA 4EV6A 4UVAB 2KINB 2BVLA 3HKEE 2LRLA 5LG3A 4DR3T 4HKAA 3KV5A 4CZZB 5LGUB 4OYKA 1S94A 2E9XA 3FBLA 1IAPA 2A9UA 1WCRA 5LJNA 3ZCJA 2LOSA 1HTJF 1MMDA 2X67A 4M1PA 2NW8A 3U8NA 2J62A 4X1KE 4ZRUA 3P4SA 4HWDA 3RHWA 4NZBA 2WY2A 4XK9A 2X0HA 4YTPA 1SHZC 1H7CA 2W8GA 3R6NA 3VR8A 3AA1B 4QXBB 1U4QA 1HNXT 4H63V 1HS7A 1UW6A 4I0UA 2YKSA 4E7ZA 4AQFA 5E0OA 3BQIA 3ZT6A 1X79A 1LRZA 3RRWA 4HFEA 4LMKA 3IEEA 3UU5A 5CFBA 4ISTA 3UU8A 4EZ4A 2V26A 3MXZA 4X64T 4PK6A 2J1DG 3AA0B 3WI3A 2OV9A 3V5SA 1ZV4X 1KEYA 2VVSA 3C98B 1SUMB 5C2TA 3ABVA 5LG4A 2X9WA 1HCIA 2UXCT 4ZJTA 2LEHA 4LF4T 4U72A 4ZS2A 2A3DA 1D1BA 4GOUA 1WYBA 3QNUA 4ILUA 4X1YE 3EHZA 3MK7C 2XUEA 3AA6B 3CX6B 3Q5DA 2L3LA 3SRZA 4U3CA 2EHOB 4ILAA 2IHR1 2XNUA 1X9BA 3UUXB 5HXCA 4U7YA 1LVFA 4CN6A 4P0BA 3VKGA 4X65T 1I94T 3CQXC 4EGWA 5L47A 1W0AA 2WU5A 2CXLA 5L3EB 5FJVA 2V5DA 4UIGA 4ASKA 2J47A 5H6RB 2CPTA 4P0AA 4XHEA 3ZT7A 4ZHQE 5L4EA 3L09A 5LOVE 3UQ7A 1WR6A 4DV0T 3VR9A 3NZQA 1KF6A 4NPPA 4JI5T 1D0XA 1WRDA 5DQVA 4ERRA 1W09A 2RP4A 2CCQA 4JEUB 1IBLT 5LXBA 2XQ3A 3DJBA 2WAUA 3JAEA 1ZEEA 4EYYR 1M7KA 4MALA 3AE6A 5JREA 5IYZE 3AE7A 2D9DA 4DVDA 4B3MT 2UXDT 4YHJA 4DMWA 5J2UE 2FJBA 2K24A 5C8YE 2C5IT 2NW7A 2XSAA 5AFLA 4TZ4C 4PJMA 3LK3B 4DV1T 3G06A 2CBIA 4KP3C 5IWAT 5HAXA 3AXJB 5AQPB 1OEDE 2I6HA 2BG9E 2WP9A 4IE7A 3C84A 3TLVA 2BKOA 4TWDA 4H9RC 3N9MA 4TV9E 1OEDB 2BG9B 2QA7A 3D0TA 3KVAA 3ZYMA 2EHOC 3UFEA 3PDYA 5JDHA 1IBMT 3SOLA 4DIDB 3GUAA 4ILCA 3VU7H 3C79A 4H9PC 3VKHA 2BDEA 3K8PC 4OHFA 4QAAA 2L8KA 2OA5A 3RYFE 3N5LA 4KMCA 2WDRA 2UXXB 5LGTB 2JIWA 2IIUA 3RIFA 2XAJB 4DO0A 4WNKA 4J2CA 4ZS3A 3ZT5A 3MACA 3MJXA 4QHOA 2K5BB 3FZKB 5FNVE 3GWHA 3BQKA 1BR2A 3ZSTA 2X66A 2WZIA 5AFMB 5ETWA 1HNWT 2IC6A 3R84B 5FL1A 3ANWA 3P50A 3KBUA 1WR0A 3GN5A 2LHNA 4NIQA 3DTOA 3AE1A 3AE4A 1D0YA 3Q5EA 5L3DB 2BR8A 2X00D 1W9RA 5CJ5A 1XWMA 2KWIB 1UURA 2YK0A 2VKHA 2VWAA 1D1CA 3RIUA 5HXEA 3ZCIA 2LSIA 2VK9A 4YTMA 2MPKA 4ZI3C 4IE5A 1OEDC 2BG9C 4UM3A 2CHNA 3UUBA 2LT3A 3JCFA 5JDQA 3DP7A 4H63H 3UU6A 2XZEA 3EDVA 3U78A 4IE4A 4YT0A 3LK2B 2E2AA 4WBOA 4I50E 5LHIB 4DV7T 2E5LT 3FZHB 5BRXA 2LSGA 2WM9A 3B13A 5HXRA 2NW9A 3PJAJ 3ZYKA 2XNVA 4H9SE 4K0KT 4ZXLA 5CO5A 1MIYA 2V6YA 2W62A 2XSBA 2BYPA 2XY8B 4UF0A 3UU4A 2QVAA 5AQNB 2DWKA 2N1GA 4IHJE 5ABFB 3SQ9A 2QYWA 1W0BA 2XQYA 4YJ3E 3WAKA 2WNCA 3GA8A 2UZ6A 5FY1A 4GK5E 1NENA 1YQ3A 4KBMB 4LFAT 3SH1A 2VL8A 4CI3B 5ABHA 2B1EA 1LKXA 2H88A 2A2FX 4IDPA 2WCAA 2V7MA 1R8IA 1M62A 3PUAA 3C50A 1YKHB 2H3RA 4P1NA 2XPKA 4EIWA 4DBMA 3C4XA 2BYSA 3PJAA 2NOXA 4LFBT 3EUHA 4X62T 4BQTA 4EEBA 2SPCA 4P09A 1KNZA 3ZEFB 5FY0A 1Y64B 3RGLA 2CLYB 3O1HA 3AEGA 4JV5T 1MNEA 2CA5A 5LB7B 3LFMA 2LOPA 3AEBA 3V5UA 2C9TA 2G0UA 3HA4A 5J5FA 1J1JA 4I43B 3MA9A 4LMJA 2LM9A 5AQJB 3WTKA 4LMLA
chains in the Genus database with same CATH topology
2W8FA 3WTOA 3JAFA 4QH5A 5HEUA 4HFEA 4LMKA 4UM3P 2YOEA 4A98A 3PEOA 2Y54A 5CO5A 4NPPA 2XQ4A 3WIPA 2XQ7A 3UU5A 4ZZBA 4QACA 4WV9A 5CFBA 2VL0A 4UXUA 3UU8A 4ZR6A 4UY2A 4QABA 2BYPA 5BP0A 5HCMA 3WTJA 2BYQA 3RQUA 3UU4A 5AFHA 2LM2A 2XQ6A 2XQ3A 3TLWA 4COFA 4HFCA 4F8HA 5LXBA 5AFMB 4ZZCA 3WTNA 5BW2A 5KZUA 3JAEA 3SQ9A 4AFHA 5AFMA 4HQPA 4HFDA 2QC1B 2PGZA 2XZ6A 3P50A 2WNCA 5TVCA 4QH4A 5J5GA 4IL9A 2UZ6A 5AFKA 2XQAA 4IL4A 2BYNA 2WNLA 2BR7A 4Z91A 4ILBA 4TNWA 3TLTA 3U8KA 5J5IA 2XZ5A 2M6IA 3SH1A 5HEHA 2BR8A 2X00D 4ZJTA 3JADA 4HFBA 4ZJSA 2BYRA 3IGQA 3UQ4A 3UU3A 4IREA 2XQ8A 4Z90A 2Y7YA 3EI0A 5AFLA 5AINA 5LG3A 2XNTA 3ZDGA 3WTKA 2X00A 5JMEA 5KE4A 3EHZA 3WTMA 3U8MA 3WTLA 3TLSA 1OEDE 2BG9E 2YN6A 2XYTA 5L4HA 3C84A 5J5HA 4ZK1A 3TLUA 3TLVA 4DBMA 3RIAA 4TWDA 1I9BA 2BYSA 2YMEA 2LKGA 2MAWA 4HFIA 3ZKRA 1OEDC 1UV6A 2BG9C 4AFTA 4UM3A 3EAMA 5AFJA 5AFNA 5IUXA 1OEDB 5HEOA 2BG9B 2BJ0A 2Y56A 2PH9A 4EZ1A 3U8JA 3U8NA 3UUBA 2ZJVA 1OEDA 4BQTA 5HCJA 2BG9A 5SYOA 4A97A 1UX2A 4BFQA 3WTHA 3P4WA 4ILAA 2XNUA 4ZRUA 3UU6A 3T4MA 2KSRA 2M6BA 2XYSA 4UM3S 3RHWA 4PIRA 3WTIA 3LSVA 4NZBA 4TWFA 4X5TA 3GUAA 4XK9A 2ZJUA 3U8LA 4B5DA 4ILCA 4TNVA 2W8GA 3C79A 4UM1A 4TWHA 5L47A 4QAAA 5BRXA 3PMZA 4ZK4A 2Y58A 2C9TA 4HFHA 2LLYA 2YMDA 4QH1A 5HEJA 5J5FA 4AFGA 5HEGA 5FJVA 4LMJA 2LKHA 4D01A 2WN9A 2XNVA 1UW6A 2XQ9A 2YKSA 3RIFA 3RI5A 4XHEA 4FRRA 2Y57A 2WNJA 3SQ6A 4ALXA 3ZDHA 5J0ZA 2XQ5A 3RQWA 2WZYA 5L4EA 3UQ7A 3SIOA 4LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8F A;  3WTO A;  3JAF A;  4QH5 A;  5HEU A;  4HFE A;  4LMK A;  4UM3 P;  2YOE A;  4A98 A;  3PEO A;  2Y54 A;  5CO5 A;  4NPP A;  2XQ4 A;  3WIP A;  2XQ7 A;  3UU5 A;  4ZZB A;  4QAC A;  4WV9 A;  5CFB A;  2VL0 A;  4UXU A;  3UU8 A;  4ZR6 A;  4UY2 A;  4QAB A;  2BYP A;  5BP0 A;  5HCM A;  3WTJ A;  2BYQ A;  3RQU A;  3UU4 A;  5AFH A;  2LM2 A;  2XQ6 A;  2XQ3 A;  3TLW A;  4COF A;  4HFC A;  4F8H A;  5LXB A;  5AFM B;  4ZZC A;  3WTN A;  5BW2 A;  5KZU A;  3JAE A;  3SQ9 A;  4AFH A;  5AFM A;  4HQP A;  4HFD A;  2QC1 B;  2PGZ A;  2XZ6 A;  3P50 A;  2WNC A;  5TVC A;  4QH4 A;  5J5G A;  4IL9 A;  2UZ6 A;  5AFK A;  2XQA A;  4IL4 A;  2BYN A;  2WNL A;  2BR7 A;  4Z91 A;  4ILB A;  4TNW A;  3TLT A;  3U8K A;  5J5I A;  2XZ5 A;  2M6I A;  3SH1 A;  5HEH A;  2BR8 A;  2X00 D;  4ZJT A;  3JAD A;  4HFB A;  4ZJS A;  2BYR A;  3IGQ A;  3UQ4 A;  3UU3 A;  4IRE A;  2XQ8 A;  4Z90 A;  2Y7Y A;  3EI0 A;  5AFL A;  5AIN A;  5LG3 A;  2XNT A;  3ZDG A;  3WTK A;  2X00 A;  5JME A;  5KE4 A;  3EHZ A;  3WTM A;  3U8M A;  3WTL A;  3TLS A;  1OED E;  2BG9 E;  2YN6 A;  2XYT A;  5L4H A;  3C84 A;  5J5H A;  4ZK1 A;  3TLU A;  3TLV A;  4DBM A;  3RIA A;  4TWD A;  1I9B A;  2BYS A;  2YME A;  2LKG A;  2MAW A;  4HFI A;  3ZKR A;  1OED C;  1UV6 A;  2BG9 C;  4AFT A;  4UM3 A;  3EAM A;  5AFJ A;  5AFN A;  5IUX A;  1OED B;  5HEO A;  2BG9 B;  2BJ0 A;  2Y56 A;  2PH9 A;  4EZ1 A;  3U8J A;  3U8N A;  3UUB A;  2ZJV A;  1OED A;  4BQT A;  5HCJ A;  2BG9 A;  5SYO A;  4A97 A;  1UX2 A;  4BFQ A;  3WTH A;  3P4W A;  4ILA A;  2XNU A;  4ZRU A;  3UU6 A;  3T4M A;  2KSR A;  2M6B A;  2XYS A;  4UM3 S;  3RHW A;  4PIR A;  3WTI A;  3LSV A;  4NZB A;  4TWF A;  4X5T A;  3GUA A;  4XK9 A;  2ZJU A;  3U8L A;  4B5D A;  4ILC A;  4TNV A;  2W8G A;  3C79 A;  4UM1 A;  4TWH A;  5L47 A;  4QAA A;  5BRX A;  3PMZ A;  4ZK4 A;  2Y58 A;  2C9T A;  4HFH A;  2LLY A;  2YMD A;  4QH1 A;  5HEJ A;  5J5F A;  4AFG A;  5HEG A;  5FJV A;  4LMJ A;  2LKH A;  4D01 A;  2WN9 A;  2XNV A;  1UW6 A;  2XQ9 A;  2YKS A;  3RIF A;  3RI5 A;  4XHE A;  4FRR A;  2Y57 A;  2WNJ A;  3SQ6 A;  4ALX A;  3ZDH A;  5J0Z A;  2XQ5 A;  3RQW A;  2WZY A;  5L4E A;  3UQ7 A;  3SIO A;  4LML A; 
#chains in the Genus database with same CATH topology
 4QH5 A;  3I9W A;  3CPZ A;  3VRB A;  3RC3 A;  2XQ7 A;  4HWC A;  4CI2 B;  2VL0 A;  3OTO T;  3J9X 1;  3LDQ B;  2XQ6 A;  3H3M A;  2C5J A;  2J4G A;  4NXN T;  1XMO T;  2X51 A;  3TLT A;  5J5I A;  2N2N A;  1T98 A;  2V7J A;  1L0V A;  3UUN A;  2Y6X A;  4H9N C;  3EI0 A;  2NWB A;  3I1A A;  4QKN A;  2X00 A;  2BS3 A;  3RPU A;  3U8M A;  3KIN B;  3AEF A;  3TLS A;  2CWY A;  5JRC A;  3OJA A;  2YME A;  2HN1 A;  4HFI A;  5JDN A;  5JDF A;  3PUW F;  4WYV A;  3CWZ B;  4O4L E;  2JJ9 A;  4GKJ T;  3FXE B;  1UX2 A;  2CLY C;  2W00 A;  1CUN A;  4CXX A;  2R6G F;  1QSD A;  1ZOY A;  4ISS A;  3E08 A;  4B5D A;  1HFA A;  5AQR B;  4TWH A;  2M67 A;  4ZK4 A;  2Y58 A;  4OYJ A;  3FZM B;  4UV8 B;  5JR9 B;  3AB3 B;  2NTY A;  3F31 A;  3AE9 A;  4HGA A;  3GMI A;  2WQY A;  2XQ9 A;  4NUV A;  5KXJ A;  3K3O A;  4N78 D;  3SQ6 A;  1HX1 B;  1V9D A;  4AXP A;  5JDM A;  2V8S V;  2AXD S;  4UM3 P;  2Z6E A;  3H37 A;  2XHE B;  2HN2 A;  4YTN A;  1NEK A;  2BYQ A;  4U31 A;  2QRX A;  5L2L A;  1HX8 A;  5LHG B;  3F2E A;  3RLF F;  1AJ3 A;  2Y8D A;  3ZPO A;  4EAH A;  3HKB E;  5BR8 T;  3AE5 A;  3Q5W A;  2DNX A;  5FMN A;  2CRB A;  5FVK A;  5DAB A;  1XNQ T;  2ZM2 A;  2H7O A;  3L39 A;  4EYU A;  1QUU A;  2XJ7 A;  2W66 A;  4Z90 A;  4KHZ F;  2Y7Y A;  4LF5 T;  3NRY A;  2KMF A;  2UUA T;  5KE4 A;  1S35 A;  2FJE A;  3KVB A;  3IBP A;  3WTM A;  5HWY A;  3KBT A;  4JLE A;  3MKD A;  2EHO D;  2Y56 A;  2F4V T;  3Q5X A;  2JMK A;  3W15 B;  4BFQ A;  4YY3 T;  4YHH T;  1UUS A;  5LMU T;  2M6B A;  5LJM A;  3KV9 A;  3S4U A;  2WDV A;  4L9I A;  3FB2 A;  5JR9 C;  1UCU A;  3RYI E;  4DR5 T;  2LLY A;  5AFU L;  4Q25 A;  4LF6 T;  4PW8 A;  5J1G A;  4HTE A;  3PU3 A;  1XZY A;  2IML A;  4ALX A;  5J0Z A;  4TV8 E;  3SIO A;  1SE7 A;  3UUL A;  4PJN A;  3AE3 A;  5AQV B;  5JH7 E;  5LA6 E;  3C51 A;  3L3P A;  5L3F B;  1E2A A;  3RQU A;  4MFR A;  1Z8U A;  4UV9 B;  3ZN0 B;  3PE0 A;  3FZF B;  2ZM6 T;  5J5G A;  3SWH A;  4ZOL E;  1G73 A;  2VQE T;  4LF9 T;  3OYZ A;  2YU1 A;  2JRK A;  3JAD A;  4ZJS A;  3OBV E;  4XBF B;  4DR2 T;  5AQQ B;  3F57 A;  1LVK A;  1FIO A;  5M4Y A;  2BKN A;  2FJA A;  4L5G A;  4B3T T;  3PUY F;  1HNZ T;  2XAF B;  4ZI7 E;  3ONX A;  4ZI3 D;  3K3N A;  2XYT A;  2XTL A;  3EDU A;  4IDO A;  2YU2 A;  1ZP0 A;  4PFO A;  2DHR A;  5AFJ A;  3JC6 C;  5HYA A;  1JNZ A;  2NP9 A;  2ZJV A;  4A5X A;  4A97 A;  1IJ6 A;  2KWH A;  1T72 A;  3FXD B;  4TNV A;  4CXW A;  4F6R C;  1MIW A;  2MOZ A;  3AVR A;  5JVD E;  3AED A;  4JI0 T;  4AIU A;  3CVR A;  2HPJ A;  3LK4 2;  1HG2 A;  2D5U A;  4JI3 T;  3RQW A;  4KHP T;  3U3I A;  3WTO A;  4GIW A;  3PEO A;  3ZMZ B;  2XQ4 A;  2D0T A;  5KX5 E;  3ZSS A;  3WTJ A;  2CBJ A;  4QX7 B;  3TLW A;  3UUM A;  1UX4 A;  5AQM B;  3P8C D;  1VCS A;  3L8R A;  3ZJ1 A;  4OK0 A;  4YLH A;  4AQY T;  4QH4 A;  2VKJ A;  2ODU A;  1XMQ T;  2XQA A;  4IL4 A;  2VVN A;  2IAK A;  1IZN B;  3AEE A;  5F5W A;  4K0U A;  4Z91 A;  2ZM0 A;  4AIS A;  5HEH A;  4MLK A;  2LRK A;  2IC9 A;  3UU3 A;  2BBH A;  1T7S A;  1UGO A;  2WMO A;  4MBQ A;  2V7I A;  3H3A A;  2WB5 A;  5L3G B;  2AE9 A;  3RIA A;  4JI8 T;  4WW0 A;  1FMW A;  2MAW A;  3P4Q A;  2XAH B;  4G63 A;  1NWM X;  2H89 A;  2CEA A;  3EVY A;  2V6X A;  4YXD A;  4DR4 T;  1BR1 A;  2PG8 A;  2EHO A;  4AKH A;  3LSV A;  4HEA A;  3FHN A;  2Q9Q B;  3NWI A;  1MMN A;  4UEL A;  2X9Y A;  4HFH A;  2VKO A;  4DBQ A;  2CWO A;  2JQQ A;  2UUB T;  4H9Q C;  2GK9 A;  2DI4 A;  5JDL A;  3O9X A;  1HR0 T;  4WV9 A;  4ZR6 A;  2ZLY A;  2CHO A;  2W67 A;  3PUG A;  4X20 E;  3CX8 B;  4IE6 A;  3WTN A;  4DR1 T;  5FP3 A;  3N9O A;  4EB6 E;  1U5P A;  3X1D A;  4NUU A;  5LCY A;  1KNR A;  2I0M A;  5AQI B;  2RPA A;  4LFC T;  5AQF B;  5CGM A;  2K3W A;  3ZMU B;  2CM0 A;  2BYR A;  2UUC T;  2WS3 A;  3ZJ2 A;  5LBQ B;  2K48 A;  2E9X B;  1KFY A;  4O2B E;  1XDO A;  1D0Z A;  3HL6 A;  3AXJ A;  4AKI A;  2W61 A;  3BK9 A;  1I9B A;  5LP6 E;  2UXB T;  4DV5 T;  3P7I A;  4FJO A;  2LSY A;  3K3Q C;  4QWN B;  1OED A;  2BG9 A;  5CA0 E;  1YQ4 A;  1OWA A;  2MYS A;  3CK6 A;  2E5V A;  4HWH A;  2Y48 B;  2XYS A;  2RA1 A;  2Q9Q C;  4UM3 S;  3WTI A;  4BAY B;  2HPL A;  3ETU A;  4UM1 A;  4UVC B;  4CI1 B;  3ONJ A;  2YMD A;  5HEJ A;  1XDP A;  3RC8 A;  1I6Z A;  2WMN A;  3VRA A;  2YDQ A;  2NR4 A;  1QLB A;  4EOZ B;  3ZDH A;  2XQ5 A;  2WZY A;  5FXV A;  3AE8 A;  3NRX A;  3M65 A;  3P4R A;  3PUS A;  4CXY A;  4UXU A;  4PJL A;  2UU9 T;  1E1H B;  5FXX A;  2BBJ A;  5AFH A;  3O1I A;  4HFC A;  4ZZC A;  3AAE B;  4AFH A;  5AFM A;  3ZN1 B;  2XAG B;  2JQK A;  4G2A A;  2I59 A;  3ESL A;  5DQW A;  4DND A;  2ZM8 A;  3ZLI A;  3UT5 E;  2KT9 A;  1MND A;  4PJJ A;  2LJL A;  1N32 T;  3UQ4 A;  2JMH A;  5ABG A;  1HF8 A;  3QUJ A;  2E9X C;  3LBX B;  3C64 A;  3RYH E;  5JME A;  2H7V C;  2BVM A;  3UFG A;  4U7I A;  3WTL A;  5KMG P;  2UXN B;  4XZC A;  4ZK1 A;  4XAX B;  2LKG A;  4BJN A;  3EAM A;  2VKD A;  3QOF A;  5JTG A;  4IE0 A;  1IJ5 A;  2MBG A;  3ETV A;  2BS4 A;  2E8I A;  4QH1 A;  4B3R T;  1CHU A;  2X0L B;  2NTX A;  2LKH A;  4D01 A;  1FJG T;  2W4X A;  4I4T E;  2JQH A;  5LHH B;  2X9H A;  5AFN A;  2VAS A;  1YD8 G;  4EXT A;  2DL1 A;  2PJQ A;  4ADZ A;  3WIP A;  5EZY E;  4AKR B;  3N9N A;  1T8B A;  3QC9 A;  4CQI A;  5HCM A;  4O4H E;  3B5M A;  2P9B A;  5ABF A;  3ZC1 A;  2X68 A;  3RX6 A;  4IGU A;  2W0G A;  3IHR A;  1N34 T;  5AQT B;  4ANJ A;  3N9L A;  1MIV A;  2C0S A;  3ZYL A;  3T1Y T;  4ZI2 C;  3RKG A;  3IGQ A;  2MTQ A;  3WAJ A;  1D1A A;  2V1D B;  2V7L A;  4DR6 T;  4AQG A;  3PUZ F;  1WFD A;  4LF7 T;  5F3J A;  2YN6 A;  4DV6 T;  3TLU A;  1BR4 A;  3JC6 D;  1WYC A;  2CE7 A;  3QK6 A;  4C90 A;  2OLT A;  4HE8 A;  1N33 T;  3P4W A;  4HFV A;  5FXZ A;  3AAI A;  2YDS A;  4DBR A;  3OYX A;  5HXH A;  4UXN B;  3UTK A;  3OVU A;  5CB4 E;  2ZJU A;  5JQG E;  1ZHC A;  3AAA B;  4JI7 T;  2B76 A;  2XAS B;  2KXP B;  4AFG A;  4U2Z A;  2W2U A;  3M3Z B;  4UEM A;  3AE2 A;  1O3X A;  3RI5 A;  5FL0 A;  3NBX X;  2W8F A;  3JAF A;  1KK7 A;  2W63 A;  5AQH B;  2DWG A;  4O4I E;  4JI6 T;  4COF A;  2QGS A;  4JUY A;  2WDQ A;  3ANW B;  4X66 T;  4C91 A;  3GN5 B;  4HFD A;  4YFS A;  2QC1 B;  4IDN A;  3LBX A;  5J2T E;  1BR0 A;  3RRC A;  1ZKE A;  2BR7 A;  2K9A A;  3MZK B;  4ILB A;  5LBM A;  4MHC A;  4IIJ E;  5FYM A;  3IF8 B;  4FI5 A;  1UX5 A;  4IRE A;  4DMV A;  3TKL B;  3ZDG A;  2PBI A;  5HWX A;  2JQ9 A;  2X0Y A;  3HKC E;  2FUP A;  4JBW F;  1YKE B;  5LNK A;  2LSJ A;  2WSS V;  3ZKR A;  4AFT A;  5A1L A;  4NXM T;  5IUX A;  2DCF A;  3RH3 A;  2YDR A;  5EK3 A;  4YSX A;  3CQG B;  3HR0 A;  2DLR A;  2D2S A;  3KFW X;  3C4Z A;  5IHY A;  3AVS A;  4V1A v;  5FKY A;  3A7M A;  4KUM B;  3Q2M A;  4HWF A;  3K1S A;  5EK4 A;  4PNI A;  4IDZ A;  3KDS E;  3LG7 A;  4TN7 B;  5L3C B;  2CMR A;  4I55 E;  3PMZ A;  2BZB A;  5H6Q B;  5JR9 A;  4BJM A;  1VOM A;  4L0R A;  2ACX A;  3KV4 A;  5FXW A;  4CN4 A;  2V7K A;  4U74 A;  3QB5 K;  2WNJ A;  1OXZ A;  3AEA A;  2V6Y B;  4DV3 T;  2ZMA A;  1YW0 A;  3PUX F;  2V5C A;  4UF0 B;  5BP0 A;  4Z8X A;  2LM2 A;  4HN9 A;  2IDO B;  3J7Y q;  4F8H A;  1Y01 A;  4BA9 A;  5EK2 A;  3HKD E;  2VUR A;  4GK0 E;  2PTF A;  4JI4 T;  3EAB A;  4UR9 A;  3NZP A;  4QXH B;  2HH7 A;  3PUV F;  2BYN A;  1N36 T;  3I9Y A;  2XZ5 A;  2M6I A;  3AEC A;  4QX8 B;  4CN1 A;  4O2A E;  2YEV C;  5BMV E;  3CML A;  3RIU C;  1JNR A;  5C3J A;  3O1J A;  2A72 A;  2XM1 A;  3RF1 A;  4DV4 T;  5J5H A;  1HG5 A;  3AA7 B;  2VB6 A;  4IDQ A;  1UV6 A;  3P4P A;  3N2O A;  1KNP A;  4TUY E;  2KND A;  3U8J A;  4GKK T;  1FEW A;  2Q9Q D;  1NAF A;  2CXF A;  2WWU A;  3ZMV B;  4U33 A;  2IW5 B;  5KDM C;  4PIR A;  4X5T A;  5L3B B;  3U8L A;  5ADX L;  4OX9 T;  3E0Z A;  2WU2 A;  4QXC B;  3OKQ A;  2N9D A;  3N2G E;  5LGN B;  5TAO A;  1YXR A;  3KV6 A;  4FRR A;  3CX7 B;  2PGZ A;  2YIN A;  4PK5 A;  5HEU A;  1J5W A;  3I0Q A;  1E7P A;  4ZZB A;  4QAC A;  4PAG A;  3SFE A;  5DJQ C;  4UY2 A;  4QAB A;  1GQE A;  1DU2 A;  3HI2 A;  3RKO A;  1SA0 E;  4AI6 A;  5AQU B;  5LXT E;  5JDG A;  2D0U A;  2KZ7 B;  5TVC A;  5CA1 E;  1MMA A;  4TNW A;  3A5X A;  2ES0 A;  3PV0 F;  2XQ8 A;  2E9X D;  5FY7 A;  4JI1 T;  2ACZ A;  4X1I E;  2XNT A;  2VQF T;  1B7T A;  2IUB A;  5JRC B;  2C5K T;  3N9Q A;  3PUQ A;  2BJ0 A;  2PH9 A;  5HCJ A;  4ZEY A;  1UK5 A;  2HHH T;  4GYS A;  3SFD A;  4DR7 T;  1Z0P A;  2LE8 A;  3B57 A;  4E7S A;  3O4X E;  2LHR A;  2CXD A;  3T8O A;  5HEG A;  2WZH A;  1EZ3 A;  2X9X A;  3C4W A;  2WN9 A;  3QB5 A;  4AKG A;  3BQL A;  4UVB B;  1IBK T;  2Y57 A;  4B3S T;  5AQG B;  5ABE A;  5FVL A;  4A98 A;  4YSY A;  2Y54 A;  4PK4 A;  4KI0 F;  4OFZ A;  2ODV A;  4H9O C;  1G8X A;  2PFV A;  4WZX A;  5AQS B;  3VHL A;  3A8Y C;  1VRB A;  3T1H T;  5BW2 A;  5KZU A;  2XM2 A;  4HQP A;  2JPF A;  4B6X A;  1VCT A;  4IL9 A;  5AFK A;  2FBW A;  4YSZ A;  4GYR A;  3PUR A;  5GON E;  3N9P A;  4ZI2 D;  4JEH B;  4LF8 T;  4TX5 A;  2WBL A;  4HFB A;  3FZL B;  3E22 E;  3Q9D A;  3ZC0 A;  4EED A;  4O8S A;  1WLX A;  5AIN A;  5AQL B;  5L4H A;  1MMG A;  2BKP A;  4DV2 T;  2L9Q A;  3SS1 A;  4DUZ T;  3I0O A;  2KLQ A;  1US7 B;  2XAQ B;  5HEO A;  4EZ1 A;  5SYO A;  2LSK A;  2FJD A;  3WTH A;  4A56 A;  3PTR B;  3T4M A;  2KSR A;  4PFP A;  3N2K E;  3PU8 A;  4TWF A;  4WBN E;  2Q9Q A;  5LMN T;  3ONL C;  4YJ2 E;  4JI2 T;  4DUY T;  4O4J E;  3CQC B;  5HXS A;  2WWV A;  3CKD A;  3OPC A;  3NVO A;  3RYC E;  1XNR T;  2YOE A;  4JYA T;  4AKL A;  1J5E T;  3IA3 A;  5AQK B;  4HWI B;  4KX6 A;  3CIR A;  5LYJ E;  3LJC A;  3FBZ A;  4IT4 A;  4AQF C;  3ZMT B;  2BS2 A;  1FMV A;  5AQO B;  3NKZ A;  3ZMS B;  2XZ6 A;  5F8P A;  4U2Y A;  4EZH A;  2WNL A;  3U8K A;  4EV6 A;  4UVA B;  2KIN B;  2BVL A;  3HKE E;  2LRL A;  5LG3 A;  4DR3 T;  4HKA A;  3KV5 A;  4CZZ B;  5LGU B;  4OYK A;  1S94 A;  2E9X A;  3FBL A;  1IAP A;  2A9U A;  1WCR A;  5LJN A;  3ZCJ A;  2LOS A;  1HTJ F;  1MMD A;  2X67 A;  4M1P A;  2NW8 A;  3U8N A;  2J62 A;  4X1K E;  4ZRU A;  3P4S A;  4HWD A;  3RHW A;  4NZB A;  2WY2 A;  4XK9 A;  2X0H A;  4YTP A;  1SHZ C;  1H7C A;  2W8G A;  3R6N A;  3VR8 A;  3AA1 B;  4QXB B;  1U4Q A;  1HNX T;  4H63 V;  1HS7 A;  1UW6 A;  4I0U A;  2YKS A;  4E7Z A;  4AQF A;  5E0O A;  3BQI A;  3ZT6 A;  1X79 A;  1LRZ A;  3RRW A;  4HFE A;  4LMK A;  3IEE A;  3UU5 A;  5CFB A;  4IST A;  3UU8 A;  4EZ4 A;  2V26 A;  3MXZ A;  4X64 T;  4PK6 A;  2J1D G;  3AA0 B;  3WI3 A;  2OV9 A;  3V5S A;  1ZV4 X;  1KEY A;  2VVS A;  3C98 B;  1SUM B;  5C2T A;  3ABV A;  5LG4 A;  2X9W A;  1HCI A;  2UXC T;  4ZJT A;  2LEH A;  4LF4 T;  4U72 A;  4ZS2 A;  2A3D A;  1D1B A;  4GOU A;  1WYB A;  3QNU A;  4ILU A;  4X1Y E;  3EHZ A;  3MK7 C;  2XUE A;  3AA6 B;  3CX6 B;  3Q5D A;  2L3L A;  3SRZ A;  4U3C A;  2EHO B;  4ILA A;  2IHR 1;  2XNU A;  1X9B A;  3UUX B;  5HXC A;  4U7Y A;  1LVF A;  4CN6 A;  4P0B A;  3VKG A;  4X65 T;  1I94 T;  3CQX C;  4EGW A;  5L47 A;  1W0A A;  2WU5 A;  2CXL A;  5L3E B;  5FJV A;  2V5D A;  4UIG A;  4ASK A;  2J47 A;  5H6R B;  2CPT A;  4P0A A;  4XHE A;  3ZT7 A;  4ZHQ E;  5L4E A;  3L09 A;  5LOV E;  3UQ7 A;  1WR6 A;  4DV0 T;  3VR9 A;  3NZQ A;  1KF6 A;  4NPP A;  4JI5 T;  1D0X A;  1WRD A;  5DQV A;  4ERR A;  1W09 A;  2RP4 A;  2CCQ A;  4JEU B;  1IBL T;  5LXB A;  2XQ3 A;  3DJB A;  2WAU A;  3JAE A;  1ZEE A;  4EYY R;  1M7K A;  4MAL A;  3AE6 A;  5JRE A;  5IYZ E;  3AE7 A;  2D9D A;  4DVD A;  4B3M T;  2UXD T;  4YHJ A;  4DMW A;  5J2U E;  2FJB A;  2K24 A;  5C8Y E;  2C5I T;  2NW7 A;  2XSA A;  5AFL A;  4TZ4 C;  4PJM A;  3LK3 B;  4DV1 T;  3G06 A;  2CBI A;  4KP3 C;  5IWA T;  5HAX A;  3AXJ B;  5AQP B;  1OED E;  2I6H A;  2BG9 E;  2WP9 A;  4IE7 A;  3C84 A;  3TLV A;  2BKO A;  4TWD A;  4H9R C;  3N9M A;  4TV9 E;  1OED B;  2BG9 B;  2QA7 A;  3D0T A;  3KVA A;  3ZYM A;  2EHO C;  3UFE A;  3PDY A;  5JDH A;  1IBM T;  3SOL A;  4DID B;  3GUA A;  4ILC A;  3VU7 H;  3C79 A;  4H9P C;  3VKH A;  2BDE A;  3K8P C;  4OHF A;  4QAA A;  2L8K A;  2OA5 A;  3RYF E;  3N5L A;  4KMC A;  2WDR A;  2UXX B;  5LGT B;  2JIW A;  2IIU A;  3RIF A;  2XAJ B;  4DO0 A;  4WNK A;  4J2C A;  4ZS3 A;  3ZT5 A;  3MAC A;  3MJX A;  4QHO A;  2K5B B;  3FZK B;  5FNV E;  3GWH A;  3BQK A;  1BR2 A;  3ZST A;  2X66 A;  2WZI A;  5AFM B;  5ETW A;  1HNW T;  2IC6 A;  3R84 B;  5FL1 A;  3ANW A;  3P50 A;  3KBU A;  1WR0 A;  3GN5 A;  2LHN A;  4NIQ A;  3DTO A;  3AE1 A;  3AE4 A;  1D0Y A;  3Q5E A;  5L3D B;  2BR8 A;  2X00 D;  1W9R A;  5CJ5 A;  1XWM A;  2KWI B;  1UUR A;  2YK0 A;  2VKH A;  2VWA A;  1D1C A;  3RIU A;  5HXE A;  3ZCI A;  2LSI A;  2VK9 A;  4YTM A;  2MPK A;  4ZI3 C;  4IE5 A;  1OED C;  2BG9 C;  4UM3 A;  2CHN A;  3UUB A;  2LT3 A;  3JCF A;  5JDQ A;  3DP7 A;  4H63 H;  3UU6 A;  2XZE A;  3EDV A;  3U78 A;  4IE4 A;  4YT0 A;  3LK2 B;  2E2A A;  4WBO A;  4I50 E;  5LHI B;  4DV7 T;  2E5L T;  3FZH B;  5BRX A;  2LSG A;  2WM9 A;  3B13 A;  5HXR A;  2NW9 A;  3PJA J;  3ZYK A;  2XNV A;  4H9S E;  4K0K T;  4ZXL A;  5CO5 A;  1MIY A;  2V6Y A;  2W62 A;  2XSB A;  2BYP A;  2XY8 B;  4UF0 A;  3UU4 A;  2QVA A;  5AQN B;  2DWK A;  2N1G A;  4IHJ E;  5ABF B;  3SQ9 A;  2QYW A;  1W0B A;  2XQY A;  4YJ3 E;  3WAK A;  2WNC A;  3GA8 A;  2UZ6 A;  5FY1 A;  4GK5 E;  1NEN A;  1YQ3 A;  4KBM B;  4LFA T;  3SH1 A;  2VL8 A;  4CI3 B;  5ABH A;  2B1E A;  1LKX A;  2H88 A;  2A2F X;  4IDP A;  2WCA A;  2V7M A;  1R8I A;  1M62 A;  3PUA A;  3C50 A;  1YKH B;  2H3R A;  4P1N A;  2XPK A;  4EIW A;  4DBM A;  3C4X A;  2BYS A;  3PJA A;  2NOX A;  4LFB T;  3EUH A;  4X62 T;  4BQT A;  4EEB A;  2SPC A;  4P09 A;  1KNZ A;  3ZEF B;  5FY0 A;  1Y64 B;  3RGL A;  2CLY B;  3O1H A;  3AEG A;  4JV5 T;  1MNE A;  2CA5 A;  5LB7 B;  3LFM A;  2LOP A;  3AEB A;  3V5U A;  2C9T A;  2G0U A;  3HA4 A;  5J5F A;  1J1J A;  4I43 B;  3MA9 A;  4LMJ A;  2LM9 A;  5AQJ B;  3WTK A;  4LML A; 
#chains in the Genus database with same CATH homology
 2W8F A;  3WTO A;  3JAF A;  4QH5 A;  5HEU A;  4HFE A;  4LMK A;  4UM3 P;  2YOE A;  4A98 A;  3PEO A;  2Y54 A;  5CO5 A;  4NPP A;  2XQ4 A;  3WIP A;  2XQ7 A;  3UU5 A;  4ZZB A;  4QAC A;  4WV9 A;  5CFB A;  2VL0 A;  4UXU A;  3UU8 A;  4ZR6 A;  4UY2 A;  4QAB A;  2BYP A;  5BP0 A;  5HCM A;  3WTJ A;  2BYQ A;  3RQU A;  3UU4 A;  5AFH A;  2LM2 A;  2XQ6 A;  2XQ3 A;  3TLW A;  4COF A;  4HFC A;  4F8H A;  5LXB A;  5AFM B;  4ZZC A;  3WTN A;  5BW2 A;  5KZU A;  3JAE A;  3SQ9 A;  4AFH A;  5AFM A;  4HQP A;  4HFD A;  2QC1 B;  2PGZ A;  2XZ6 A;  3P50 A;  2WNC A;  5TVC A;  4QH4 A;  5J5G A;  4IL9 A;  2UZ6 A;  5AFK A;  2XQA A;  4IL4 A;  2BYN A;  2WNL A;  2BR7 A;  4Z91 A;  4ILB A;  4TNW A;  3TLT A;  3U8K A;  5J5I A;  2XZ5 A;  2M6I A;  3SH1 A;  5HEH A;  2BR8 A;  2X00 D;  4ZJT A;  3JAD A;  4HFB A;  4ZJS A;  2BYR A;  3IGQ A;  3UQ4 A;  3UU3 A;  4IRE A;  2XQ8 A;  4Z90 A;  2Y7Y A;  3EI0 A;  5AFL A;  5AIN A;  5LG3 A;  2XNT A;  3ZDG A;  3WTK A;  2X00 A;  5JME A;  5KE4 A;  3EHZ A;  3WTM A;  3U8M A;  3WTL A;  3TLS A;  1OED E;  2BG9 E;  2YN6 A;  2XYT A;  5L4H A;  3C84 A;  5J5H A;  4ZK1 A;  3TLU A;  3TLV A;  4DBM A;  3RIA A;  4TWD A;  1I9B A;  2BYS A;  2YME A;  2LKG A;  2MAW A;  4HFI A;  3ZKR A;  1OED C;  1UV6 A;  2BG9 C;  4AFT A;  4UM3 A;  3EAM A;  5AFJ A;  5AFN A;  5IUX A;  1OED B;  5HEO A;  2BG9 B;  2BJ0 A;  2Y56 A;  2PH9 A;  4EZ1 A;  3U8J A;  3U8N A;  3UUB A;  2ZJV A;  1OED A;  4BQT A;  5HCJ A;  2BG9 A;  5SYO A;  4A97 A;  1UX2 A;  4BFQ A;  3WTH A;  3P4W A;  4ILA A;  2XNU A;  4ZRU A;  3UU6 A;  3T4M A;  2KSR A;  2M6B A;  2XYS A;  4UM3 S;  3RHW A;  4PIR A;  3WTI A;  3LSV A;  4NZB A;  4TWF A;  4X5T A;  3GUA A;  4XK9 A;  2ZJU A;  3U8L A;  4B5D A;  4ILC A;  4TNV A;  2W8G A;  3C79 A;  4UM1 A;  4TWH A;  5L47 A;  4QAA A;  5BRX A;  3PMZ A;  4ZK4 A;  2Y58 A;  2C9T A;  4HFH A;  2LLY A;  2YMD A;  4QH1 A;  5HEJ A;  5J5F A;  4AFG A;  5HEG A;  5FJV A;  4LMJ A;  2LKH A;  4D01 A;  2WN9 A;  2XNV A;  1UW6 A;  2XQ9 A;  2YKS A;  3RIF A;  3RI5 A;  4XHE A;  4FRR A;  2Y57 A;  2WNJ A;  3SQ6 A;  4ALX A;  3ZDH A;  5J0Z A;  2XQ5 A;  3RQW A;  2WZY A;  5L4E A;  3UQ7 A;  3SIO A;  4LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...