4F8HA

X-ray structure of the anesthetic ketamine bound to the glic pentameric ligand-gated ion channel
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Pentameric Ligand-Gated Ion Channel GLIC Bound with Anesthetic Ketamine.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 89
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4f8hA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4f8hA01
1OEDE 4TWFA 2BR7A 3WTIA 4TNWA 4ZJTA 5AFMB 3EAMA 3ZDGA 2LLYA 3SQ6A 4ZK1A 2XQ9A 5LG3A 3U8KA 4UY2A 2PGZA 4NZBA 2W8FA 2BJ0A 2X00D 4DBMA 2WN9A 3U8LA 4UM3S 3SQ9A 2KSRA 3UU8A 2UZ6A 2XNTA 2PH9A 4ZJSA 3WTNA 5BW2A 2BR8A 1OEDC 5SYOA 1OEDB 4ALXA 2XZ6A 4TWHA 3U8MA 4A98A 3UQ4A 5FJVA 3U8JA 2YOEA 5HEUA 3UU4A 2XZ5A 2XQAA 3JAFA 2YMDA 2Y57A 3TLVA 5L47A 3LSVA 4ILCA 4X5TA 2XYSA 2WNLA 2LKGA 3RI5A 2XQ8A 3EHZA 2QC1B 5KE4A 1OEDA 4ZK4A 2LKHA 3UQ7A 4UM3P 4QAAA 4TNVA 3RHWA 3GUAA 4XK9A 3WTHA 3P4WA 3PMZA 2WZYA 4UM3A 4B5DA 3WTLA 5AFHA 1I9BA 2XQ7A 4HFBA 3UU5A 4ZZBA 2X00A 4TWDA 4EZ1A 5CFBA 2BYRA 3SIOA 4AFGA 2MAWA 3EI0A 5HCJA 3WTOA 2BG9E 2BG9A 3P50A 2BYSA 4ZZCA 3UUBA 3TLTA 2BYQA 5AFLA 3SH1A 2Y7YA 5AFKA 5KZUA 1UX2A 5J0ZA 3WTJA 5L4EA 2XQ5A 4QH5A 4ZR6A 4NPPA 4IL4A 3RIFA 3T4MA 5TVCA 5HEJA 5HEOA 2Y58A 4IREA 4A97A 4ZRUA 3ZKRA 5IUXA 2YMEA 1UW6A 2M6IA 3ZDHA 3TLSA 3JADA 3IGQA 3RQWA 2BYNA 3WTKA 3RQUA 4PIRA 4QH4A 4HFIA 1UV6A 2XNUA 3PEOA 4AFTA 2W8GA 5AFNA 2XYTA 4UXUA 4ILBA 2YKSA 3C84A 5J5IA 3C79A 3WIPA 3RIAA 3U8NA 2BG9C 4COFA 2LM2A 2M6BA 3TLWA 4ILAA 4BQTA 5AFMA 4BFQA 4XHEA 5J5FA 4F8HA 2XQ6A 2C9TA 2ZJUA 4AFHA 4LMLA 2WNCA 4HFEA 2BYPA 4LMKA 5LXBA 2XQ4A 4HQPA 4WV9A 2Y54A 4HFDA 4IL9A 4LMJA 4HFCA 4Z91A 4HFHA 5J5HA 5BRXA 4Z90A 5HEHA 2YN6A 5AFJA 4QH1A 3UU3A 3TLUA 2XNVA 5L4HA 5HEGA 2ZJVA 5BP0A 4QABA 2VL0A 3UU6A 2BG9B 4D01A 2WNJA 2Y56A 5AINA 2XQ3A 4UM1A 3JAEA 3WTMA 4QACA 5JMEA 4FRRA 5HCMA 5CO5A 5J5GA
chains in the Genus database with same CATH superfamily
2IDOB 2CM0A 5IWAT 4EZ4A 4F6RC 4HWFA 2VQET 3LK2B 3FHNA 4PK4A 3PUAA 1S94A 3DP7A 4GK5E 3FZHB 4PNIA 4DO0A 3KBUA 5LJMA 1T8BA 4PJLA 4XBFB 4XZCA 3GMIA 2D2SA 2R6GF 3AE9A 4DBRA 3RC3A 1MNDA 2KLQA 1WR6A 2DWKA 4AISA 4DR6T 4IT4A 3MKDA 4ZI7E 3FZFB 3TLSA 3T8OA 5C3JA 4EB6E 5FXWA 4O4IE 2XYTA 2YKSA 5HWXA 4IDQA 4Q25A 4PK6A 1NENA 2LHNA 3ZT7A 2XY8B 3L8RA 4HFHA 3P4RA 5AFJA 3UT5E 2LEHA 3C4ZA 5BP0A 2V8SV 4JI1T 4ZOLE 4UM1A 1X79A 5JMEA 5HCMA 1B7TA 5FNVE 3WI3A 2VASA 3ZCIA 4B6XA 2ZM0A 2XAHB 1YXRA 4YT0A 2UZ6A 5HAXA 3Q5WA 2WBLA 4H9QC 4A98A 3KV9A 3Q5EA 4WW0A 4YSZA 2Y57A 2WDRA 3TLVA 3LSVA 5L47A 4LFCT 3RI5A 5AQHB 4KP3C 4NXMT 1UX4A 3RKOA 2X67A 5CFBA 3H37A 3AAAB 4AI6A 4J2CA 3ZPOA 4H9RC 2Q9QD 2IC9A 3VU7H 2OA5A 1J1JA 1XDPA 2X9XA 3AA1B 1KK7A 4ILUA 2WQYA 3NVOA 4WZXA 2XAJB 3DTOA 3ZMTB 5JDHA 3HKEE 4BQTA 3AE5A 3PDYA 3J9X1 3K3QC 4Z8XA 3CPZA 4U72A 2J47A 4GYSA 3U78A 4HTEA 5AQMB 4B3TT 3MA9A 5JREA 5AINA 5HWYA 4BJNA 3HL6A 5JQGE 3ZSSA 5LA6E 3T1HT 3WTIA 2G0UA 3L09A 4H9NC 3AXJB 3SQ6A 3BQLA 3S4UA 4UVBB 2WN9A 2ZMAA 3QNUA 3UULA 2PH9A 2K9AA 4ALXA 3FBLA 2WNLA 3EHZA 4O4HE 4LF9T 1OEDA 2CRBA 3H3MA 4XK9A 2ODVA 4QXBB 2CWOA 4YJ2E 3FXEB 4AFGA 3EDVA 3EI0A 2M67A 2X51A 3HKCE 2WDVA 2X0LB 3VKHA 4LF4T 3EABA 1Z0PA 5AQLB 3I9YA 5FMNA 2WMNA 5LP6E 4GKKT 3AAEB 4UV8B 4DV1T 4EEDA 1LVKA 1UW6A 3IGQA 2L8KA 2BYNA 4HGAA 5LHGB 4DVDA 1XDOA 4AXPA 2KZ7B 5AQUB 2I0MA 5EK4A 2V26A 4CZZB 2W00A 4CQIA 2JQ9A 2W61A 4BFQA 4EYUA 4LFAT 4AFHA 2W4XA 4LMKA 4HWDA 2W67A 3CQXC 4HFDA 4P0BA 1D1CA 4YXDA 1D0ZA 2N2NA 4CXWA 3E22E 2W62A 1SUMB 4HWIB 3AEDA 4IIJE 2UXBT 4TWFA 3QUJA 2HHHT 2UU9T 2LT3A 3ZDGA 3N9LA 4X1KE 3UU8A 1ZOYA 3R6NA 1OEDB 1MIYA 3RGLA 1XZYA 4DV3T 1W0AA 3IEEA 1YD8G 2N9DA 4DV6T 3FZMB 3AEEA 4KBMB 2VVSA 3ETUA 2WB5A 3PMZA 4C91A 5LGUB 4UVAB 3CQCB 2V1DB 4EZ1A 4DV7T 3LBXA 2BG9A 2JRKA 4OHFA 2NR4A 1IJ6A 3N9QA 2V7MA 2QYWA 5FY7A 1HCIA 3FBZA 4QH5A 4EXTA 2WM9A 4ZI3C 2NOXA 4DNDA 2V7IA 4M1PA 4DR4T 1LRZA 2C5KT 4HFIA 2W8GA 4U33A 2JQHA 2BG9C 4DR2T 3F2EA 5TAOA 2LHRA 3I9WA 1YKHB 5L2LA 4LMLA 2LM9A 1V9DA 1ZHCA 5JH7E 5FVLA 5J5HA 3L39A 5DQVA 4JEUB 3K1SA 1IBKT 3TLUA 2DWGA 2ZJVA 3AXJA 3DJBA 4B3MT 3PUXF 2VURA 2HPLA 2W66A 1U5PA 2BS2A 3UTKA 3M3ZB 2JQKA 2YEVC 5L3BB 1US7B 4IE5A 4DBMA 3VHLA 2VKOA 5BW2A 4QX8B 1DU2A 4DR1T 3UU4A 4JI0T 4X5TA 4ERRA 2LKGA 2XQ8A 4U74A 5FY0A 1WLXA 2HH7A 1FIOA 3RHWA 2MTQA 1UCUA 2IUBA 5AFHA 3B5MA 3L3PA 4ZS2A 3UUXB 4WYVA 1WR0A 3V5SA 3SFDA 5HXCA 2JPFA 5FL1A 4EOZB 2UXCT 2E5VA 5J0ZA 4UR9A 2XQ5A 3SOLA 3ZMVB 2BBJA 1T72A 2B76A 5HEJA 1FMVA 5HEOA 4DR7T 4IDOA 4DBQA 2L9QA 2IMLA 1E7PA 5LBMA 3U8NA 1U4QA 4GKJT 1SE7A 5AQSB 3KV6A 2HN2A 2KWIB 1M62A 2LSKA 2V7JA 4U2YA 5HEHA 5AQJB 2AE9A 4B3RT 2E9XC 1HNWT 4X20E 1XNRT 3U3IA 3ZEFB 3F31A 3AE1A 3CKDA 3UUNA 4YTMA 3KINB 1MNEA 4EIWA 4ZK1A 2W0GA 3C50A 2E9XB 3MACA 4UELA 3U8LA 2C5IT 3SQ9A 4YHHT 4ZJSA 2FBWA 5AQQB 2YOEA 4A5XA 5EK2A 4X62T 4ZHQE 4IDZA 5KDMC 4AQFA 5FL0A 1D1AA 3P4WA 4IHJE 4LF6T 5HCJA 2BYSA 3TLTA 2IW5B 2Z6EA 4UF0B 3PUGA 2KXPB 3AAIA 4BAYB 3P4QA 3Q9DA 2UUAT 1UK5A 3RIUA 5JRCA 1HFAA 2QRXA 3QB5K 4DR5T 4AFTA 3VR8A 2UXNB 2M6BA 2XASB 3EDUA 1WFDA 4C90A 4DMWA 1HG5A 3PE0A 4Z91A 4MBQA 1MMGA 4BA9A 5H6QB 5FXZA 4ZI2C 2WZIA 4EEBA 3PUZF 3CX7B 4AQYT 4DIDB 1KNRA 5JDLA 5LMNT 4OX9T 3N2KE 5ADXL 3HA4A 4MFRA 3ESLA 3U8KA 5JDFA 2LRKA 5FXVA 4HE8A 4FJOA 3I0QA 4O4LE 3N9PA 4NIQA 2XZ5A 5EZYE 3CMLA 4O4JE 2QC1B 3AE6A 4ZEYA 1E1HB 2XJ7A 2JMKA 4B5DA 2XQYA 2V5CA 3OVUA 3SIOA 2Y6XA 2PBIA 2MAWA 1W0BA 2WP9A 2MYSA 3PV0F 5KZUA 3P8CD 3GA8A 3KV5A 3AA0B 5E0OA 1FJGT 1N34T 1CUNA 3E0ZA 3UFEA 4G63A 2YMEA 2H3RA 2JIWA 2FJEA 4CXYA 5F3JA 3RQUA 4K0UA 3ZN0B 5DQWA 4ANJA 2OLTA 4ILBA 3C84A 1I6ZA 5AQGB 2LRLA 4ILAA 5AFMA 2DL1A 2NW9A 2NTYA 1MMDA 3HKBE 2Q9QC 3ZMSB 2WNCA 3KVAA 3SFEA 2KT9A 3PUSA 4WV9A 3N2OA 3MJXA 4MLKA 4CN4A 4IE7A 3UU3A 2XAQB 2VVNA 4JI2T 5LGNB 4JEHB 1BR4A 3AEFA 1BR0A 2BBHA 2WNJA 4QACA 4NXNT 2B1EA 2A9UA 4O8SA 3NWIA 3WAJA 4NUVA 4LF5T 3N9NA 2W8FA 2XNTA 2BR8A 5ABHA 4JI4T 4TV8E 3JC6C 5A1LA 3JAFA 2BZBA 3LJCA 3F57A 2XYSA 3AA6B 4PK5A 3HI2A 3QB5A 5AQNB 5HYAA 3NZQA 1N36T 1X9BA 1WCRA 1UURA 2ZM2A 4TZ4C 2BYRA 3KV4A 5LNKA 2BG9E 4YSYA 2VKHA 4JI5T 1OXZA 2WWVA 3ZYKA 1QLBA 2H88A 3PTRB 3RIFA 4KI0F 3VKGA 4LF8T 4MALA 5J1GA 2X9HA 4ZRUA 2Y48B 1L0VA 3H3AA 4PJNA 2LOSA 5HXSA 2IHR1 4H9OC 4H9PC 5J5IA 4CN1A 5J2UE 2CXFA 1SHZC 1HNZT 1WRDA 1J5ET 4MHCA 4IL9A 3TKLB 3N2GE 2EHOB 2YN6A 4EZHA 5JR9C 4PW8A 4U3CA 2K3WA 2CXLA 1IBLT 3VRAA 3JCFA 5AQFB 4P09A 2UXDT 3BQIA 1HNXT 3CVRA 2AXDS 3GWHA 1I94T 4CI2B 1BR2A 4H63H 3WTNA 1OEDC 2XZ6A 3CX6B 3OBVE 4I50E 4DUYT 4KMCA 2WU5A 3NRYA 5ETWA 4QHOA 3QOFA 4UM3P 4QAAA 4IE6A 1KEYA 3GN5A 4I0UA 3GUAA 3VRBA 4YY3T 2WMOA 3ZN1B 4TV9E 4EV6A 4E7SA 3PURA 2X00A 4TWDA 5LBQB 3WTOA 2IAKA 3P50A 1HG2A 4X66T 4EGWA 3UUBA 4KHPT 4N78D 4ZS3A 4QXCB 2Y8DA 2CLYC 5L3FB 4DV4T 3RPUA 4PFPA 2XSAA 4QWNB 3KDSE 2MBGA 5LXTE 2A3DA 3W15B 2Q9QA 4JV5T 2RPAA 2VKJA 2HN1A 3PUVF 5KXJA 5L3CB 4AIUA 4AKIA 2YDSA 5AFUL 3ONLC 3ZJ1A 2ZM6T 3WIPA 2CMRA 5C2TA 1ZKEA 3KBTA 2C9TA 2XQ4A 4L5GA 3AEAA 4WNKA 4EAHA 5JTGA 4FRRA 3A5XA 4UXNB 3QC9A 3LK42 4YHJA 3E08A 3CX8B 2V5DA 2RP4A 4CI1B 1MIWA 4NZBA 5KMGP 2BKOA 4JBWF 4L9IA 3NRXA 1KNPA 3U8MA 2W63A 4P0AA 2PTFA 1M7KA 4DMVA 5LJNA 2QGSA 2V6YB 3WTHA 2WSSV 5CJ5A 2DI4A 2QVAA 1YQ4A 2YDRA 2XQ7A 4ZI2D 3UU5A 3ZMUB 2BS3A 4QKNA 1WYCA 4U7YA 5AQTB 5FVKA 1XNQT 1YQ3A 5L3EB 3FXDB 4YLHA 5AFLA 3SH1A 2Y7YA 5AFKA 2WWUA 2FUPA 5LB7B 3T4MA 4HFVA 4WBOA 5DABA 4HWCA 3AE8A 3ZLIA 5CA0E 1KFYA 3ZC1A 5BMVE 3RH3A 1UV6A 1IBMT 2UXXB 2WCAA 2D0UA 3GN5B 4U7IA 5IHYA 2V7KA 2ZJUA 3T1YT 3RF1A 5AQPB 2J4GA 2JQQA 2ACZA 1Z8UA 2XAGB 1AJ3A 2Y54A 3IA3A 3LK3B 2RA1A 2N1GA 5JDQA 5HEGA 4YTPA 2VL0A 4CI3B 3AVSA 5H6RB 3EVYA 4IGUA 3UUMA 2CXDA 3O1JA 1MIVA 2WAUA 1O3XA 4HN9A 1VCTA 4UM3S 3C4WA 1WYBA 3ANWA 2E8IA 5JR9B 5FJVA 2EHOA 3AEBA 2XQAA 3PUYF 4ILCA 3I1AA 2EHOD 4ASKA 3EUHA 3UFGA 1HX8A 1OWAA 4UM3A 1Y64B 3WTLA 4TUYE 1I9BA 2CE7A 2XSBA 4PFOA 5CGMA 1IZNB 4O2AE 1HX1B 2X0YA 2W2UA 4P1NA 4NPPA 3ZYMA 2YDQA 2LSJA 4X65T 4A97A 3ZDHA 3RQWA 4PIRA 3ZT6A 3RC8A 5AFNA 4UXUA 1H7CA 3RIAA 5DJQC 3SS1A 2KNDA 2CPTA 2BKNA 2YINA 2PJQA 3AA7B 5J5FA 3AECA 2BYPA 3SWHA 5L3DB 3J7Yq 2X66A 2XPKA 3ZYLA 3MZKB 2XNVA 2VL8A 4DR3T 1QSDA 5C8YE 2XM1A 1QUUA 1VRBA 4D01A 2SPCA 5JVDE 4O2BE 5AFMB 4A56A 4NUUA 2PGZA 2V7LA 3C51A 3NKZA 4AQFC 2XZEA 3C64A 4UV9B 4OFZA 1ZEEA 2LSYA 4BJMA 2CBIA 4KUMB 1ZV4X 2IC6A 4HKAA 1XMOT 2FJDA 2KINB 2XTLA 3Q5XA 5ABFB 3RYCE 3MXZA 3RRWA 1FEWA 2DHRA 4ZZBA 3SRZA 3IHRA 1LKXA 3ZSTA 3G06A 1VOMA 2BYQA 4KX6A 5L4EA 2YK0A 2NP9A 3HR0A 3ZT5A 4ZR6A 4IL4A 1NEKA 5AQVB 2V6YA 1D1BA 5TVCA 2CWYA 3O1IA 5ABFA 1VCSA 1D0YA 2QA7A 4ZXLA 1XWMA 4TX5A 4GK0E 4IE0A 4DV0T 3AE7A 2NWBA 2LM2A 4XHEA 1G73A 3RIUC 5HXEA 3B57A 4GIWA 2GK9A 2MPKA 2L3LA 1G8XA 5LMUT 5JDMA 2OV9A 4PJMA 5L4HA 2NW8A 2IIUA 4JI7T 3UU6A 2I59A 2KWHA 3JAEA 1BR1A 5CO5A 2CLYB 1OEDE 2ZM8A 4OK0A 2BR7A 5ABEA 4TNWA 3ZC0A 2MOZA 4LFBT 3FB2A 2LLYA 3AVRA 4U2ZA 2X00D 3M65A 2KSRA 3ETVA 3LBXB 2VB6A 3UQ4A 2H89A 1S35A 5CA1E 4UVCB 5KE4A 5LG4A 3AE2A 3FZKB 3VR9A 2WZYA 2LSGA 2WDQA 1HTJF 3P7IA 2PFVA 5J5GA 4UEMA 2E2AA 1UX2A 3WTJA 5HXHA 3FZLB 3ZCJA 3ABVA 2J1DG 2FJBA 3K3OA 3CK6A 1T98A 1IJ5A 2I6HA 3RX6A 3AE4A 5LOVE 2UUCT 5AQKB 3ONJA 2VK9A 4COFA 2ODUA 3I0OA 2H7OA 1ZP0A 4DV5T 2DCFA 5AQRB 4ISSA 3ANWB 4HFEA 5JR9A 3D0TA 5JDNA 3RYHE 2H7VC 3CWZB 4QH1A 5AQOB 4JLEA 2Y56A 4HEAA 3WTMA 2E5LT 4ZJTA 3EAMA 4JI8T 3PU3A 2XQ9A 4IDNA 2K48A 3JC6D 4ADZA 1R8IA 4WBNE 2BJ0A 3PJAA 5SYOA 3OYXA 4GOUA 2PG8A 3MK7C 3ONXA 2YMDA 3O4XE 4FI5A 3Q2MA 2VQFT 4CN6A 2BVMA 4JI6T 4AKHA 3OPCA 3ZJ2A 4B3ST 3K3NA 4JI3T 3CIRA 2J62A 3OTOT 3LG7A 1D0XA 4I43B 1W9RA 4YTNA 2CCQA 2XHEB 1IAPA 5L3GB 4DUZT 2LE8A 4HWHA 5ABGA 3CQGB 4EYYR 4AKGA 2D9DA 2C5JA 5IUXA 3LFMA 5AQIB 2M6IA 2KMFA 3IF8B 3P4PA 2K24A 1LVFA 3RYFE 1FMWA 4QH4A 3N9MA 2XNUA 1Y01A 3C79A 3PUQA 2NW7A 4AKLA 2ES0A 1EZ3A 4XAXB 1CHUA 1T7SA 1JNZA 4HQPA 1NWMX 2NTXA 2K5BB 2A2FX 5F8PA 4IE4A 4AQGA 3PJAJ 5HXRA 1UX5A 5JRCB 4QABA 4TN7B 5LGTB 1HR0T 2XM2A 2WU2A 2XQ3A 1MMAA 3N5LA 5FY1A 2CEAA 2UUBT 4H9SE 3BQKA 2BDEA 3Q5DA 2CHOA 3R84B 5FKYA 2E9XD 4AKRB 3A7MA 2A72A 2F4VT 3U8JA 2V6XA 3C4XA 5HEUA 2CBJA 2LJLA 3O1HA 3OJAA 4CXXA 2FJAA 2CA5A 4X1YE 2YU1A 4PAGA 2ZLYA 3K8PC 5LHIB 4X1IE 1UGOA 4H63V 2LKHA 2YU2A 2XAFB 1JNRA 3UQ7A 1KNZA 3N9OA 5KX5E 2Q9QB 4HFBA 5JDGA 3HKDE 3OKQA 4K0KT 2X0HA 4ZZCA 5IYZE 4GYRA 4LF7T 1SA0E 4UIGA 2VKDA 2BVLA 2C0SA 5LYJE 2P9BA 1E2AA 2JJ9A 2X68A 4IREA 2D0TA 3JADA 3WTKA 1KF6A 2WS3A 2X9WA 1MMNA 3PEOA 3LDQB 4IDPA 4E7ZA 2EHOC 2XQ6A 1YW0A 2WZHA 4QXHB 3QK6A 2X9YA 4L0RA 3RLFF 5M4YA 5LXBA 1UUSA 3A8YC 4LMJA 3RRCA 4HFCA 3KVBA 5BRXA 3X1DA 3BK9A 2BKPA 3B13A 4G2AA 5FP3A 2BG9B 3RKGA 2XUEA 2BS4A 3O9XA 2DNXA 5BR8T 2LOPA 3P4SA 3OYZA 5LG3A 4UY2A 5FXXA 4YJ3E 4TWHA 5LHHB 1HS7A 5EK3A 3KFWX 4OYKA 2VWAA 4I4TE 4JYAT 4ZK4A 4TNVA 4U31A 4OYJA 4ZI3D 4X64T 5FYMA 3V5UA 4PJJA 3C98B 4UF0A 4YSXA 2DLRA 3PUWF 3NZPA 3PU8A 3RYIE 4V1Av 2Y58A 5GONE 1YKEB 4DV2T 4JUYA 3WAKA 3ZKRA 2HPJA 1N32T 4YFSA 5LCYA 3ZMZB 1NAFA 1GQEA 3IBPA 1W09A 2WY2A 2LSIA 3AE3A 2E9XA 3TLWA 4ISTA 1XMQT 2ACXA 5CB4E 4F8HA 2D5UA 4KHZF 1N33T 4I55E 4Z90A 2CHNA 5F5WA 4QX7B 5J2TE 2JMHA 3AB3B 1HF8A 1J5WA 3AEGA 3NBXX
chains in the Genus database with same CATH topology
1OEDE 4TWFA 2BR7A 3WTIA 4TNWA 4ZJTA 5AFMB 3EAMA 3ZDGA 2LLYA 3SQ6A 4ZK1A 2XQ9A 5LG3A 3U8KA 4UY2A 2PGZA 4NZBA 2W8FA 2BJ0A 2X00D 4DBMA 2WN9A 3U8LA 4UM3S 3SQ9A 2KSRA 3UU8A 2UZ6A 2XNTA 2PH9A 4ZJSA 3WTNA 5BW2A 2BR8A 1OEDC 5SYOA 1OEDB 4ALXA 2XZ6A 4TWHA 3U8MA 4A98A 3UQ4A 5FJVA 3U8JA 2YOEA 5HEUA 3UU4A 2XZ5A 2XQAA 3JAFA 2YMDA 2Y57A 3TLVA 5L47A 3LSVA 4ILCA 4X5TA 2XYSA 2WNLA 2LKGA 3RI5A 2XQ8A 3EHZA 2QC1B 5KE4A 1OEDA 4ZK4A 2LKHA 3UQ7A 4UM3P 4QAAA 4TNVA 3RHWA 3GUAA 4XK9A 3WTHA 3P4WA 3PMZA 2WZYA 4UM3A 4B5DA 3WTLA 5AFHA 1I9BA 2XQ7A 4HFBA 3UU5A 4ZZBA 2X00A 4TWDA 4EZ1A 5CFBA 2BYRA 3SIOA 4AFGA 2MAWA 3EI0A 5HCJA 3WTOA 2BG9E 2BG9A 3P50A 2BYSA 4ZZCA 3UUBA 3TLTA 2BYQA 5AFLA 3SH1A 2Y7YA 5AFKA 5KZUA 1UX2A 5J0ZA 3WTJA 5L4EA 2XQ5A 4QH5A 4ZR6A 4NPPA 4IL4A 3RIFA 3T4MA 5TVCA 5HEJA 5HEOA 2Y58A 4IREA 4A97A 4ZRUA 3ZKRA 5IUXA 2YMEA 1UW6A 2M6IA 3ZDHA 3TLSA 3JADA 3IGQA 3RQWA 2BYNA 3WTKA 3RQUA 4PIRA 4QH4A 4HFIA 1UV6A 2XNUA 3PEOA 4AFTA 2W8GA 5AFNA 2XYTA 4UXUA 4ILBA 2YKSA 3C84A 5J5IA 3C79A 3WIPA 3RIAA 3U8NA 2BG9C 4COFA 2LM2A 2M6BA 3TLWA 4ILAA 4BQTA 5AFMA 4BFQA 4XHEA 5J5FA 4F8HA 2XQ6A 2C9TA 2ZJUA 4AFHA 4LMLA 2WNCA 4HFEA 2BYPA 4LMKA 5LXBA 2XQ4A 4HQPA 4WV9A 2Y54A 4HFDA 4IL9A 4LMJA 4HFCA 4Z91A 4HFHA 5J5HA 5BRXA 4Z90A 5HEHA 2YN6A 5AFJA 4QH1A 3UU3A 3TLUA 2XNVA 5L4HA 5HEGA 2ZJVA 5BP0A 4QABA 2VL0A 3UU6A 2BG9B 4D01A 2WNJA 2Y56A 5AINA 2XQ3A 4UM1A 3JAEA 3WTMA 4QACA 5JMEA 4FRRA 5HCMA 5CO5A 5J5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OED E;  4TWF A;  2BR7 A;  3WTI A;  4TNW A;  4ZJT A;  5AFM B;  3EAM A;  3ZDG A;  2LLY A;  3SQ6 A;  4ZK1 A;  2XQ9 A;  5LG3 A;  3U8K A;  4UY2 A;  2PGZ A;  4NZB A;  2W8F A;  2BJ0 A;  2X00 D;  4DBM A;  2WN9 A;  3U8L A;  4UM3 S;  3SQ9 A;  2KSR A;  3UU8 A;  2UZ6 A;  2XNT A;  2PH9 A;  4ZJS A;  3WTN A;  5BW2 A;  2BR8 A;  1OED C;  5SYO A;  1OED B;  4ALX A;  2XZ6 A;  4TWH A;  3U8M A;  4A98 A;  3UQ4 A;  5FJV A;  3U8J A;  2YOE A;  5HEU A;  3UU4 A;  2XZ5 A;  2XQA A;  3JAF A;  2YMD A;  2Y57 A;  3TLV A;  5L47 A;  3LSV A;  4ILC A;  4X5T A;  2XYS A;  2WNL A;  2LKG A;  3RI5 A;  2XQ8 A;  3EHZ A;  2QC1 B;  5KE4 A;  1OED A;  4ZK4 A;  2LKH A;  3UQ7 A;  4UM3 P;  4QAA A;  4TNV A;  3RHW A;  3GUA A;  4XK9 A;  3WTH A;  3P4W A;  3PMZ A;  2WZY A;  4UM3 A;  4B5D A;  3WTL A;  5AFH A;  1I9B A;  2XQ7 A;  4HFB A;  3UU5 A;  4ZZB A;  2X00 A;  4TWD A;  4EZ1 A;  5CFB A;  2BYR A;  3SIO A;  4AFG A;  2MAW A;  3EI0 A;  5HCJ A;  3WTO A;  2BG9 E;  2BG9 A;  3P50 A;  2BYS A;  4ZZC A;  3UUB A;  3TLT A;  2BYQ A;  5AFL A;  3SH1 A;  2Y7Y A;  5AFK A;  5KZU A;  1UX2 A;  5J0Z A;  3WTJ A;  5L4E A;  2XQ5 A;  4QH5 A;  4ZR6 A;  4NPP A;  4IL4 A;  3RIF A;  3T4M A;  5TVC A;  5HEJ A;  5HEO A;  2Y58 A;  4IRE A;  4A97 A;  4ZRU A;  3ZKR A;  5IUX A;  2YME A;  1UW6 A;  2M6I A;  3ZDH A;  3TLS A;  3JAD A;  3IGQ A;  3RQW A;  2BYN A;  3WTK A;  3RQU A;  4PIR A;  4QH4 A;  4HFI A;  1UV6 A;  2XNU A;  3PEO A;  4AFT A;  2W8G A;  5AFN A;  2XYT A;  4UXU A;  4ILB A;  2YKS A;  3C84 A;  5J5I A;  3C79 A;  3WIP A;  3RIA A;  3U8N A;  2BG9 C;  4COF A;  2LM2 A;  2M6B A;  3TLW A;  4ILA A;  4BQT A;  5AFM A;  4BFQ A;  4XHE A;  5J5F A;  4F8H A;  2XQ6 A;  2C9T A;  2ZJU A;  4AFH A;  4LML A;  2WNC A;  4HFE A;  2BYP A;  4LMK A;  5LXB A;  2XQ4 A;  4HQP A;  4WV9 A;  2Y54 A;  4HFD A;  4IL9 A;  4LMJ A;  4HFC A;  4Z91 A;  4HFH A;  5J5H A;  5BRX A;  4Z90 A;  5HEH A;  2YN6 A;  5AFJ A;  4QH1 A;  3UU3 A;  3TLU A;  2XNV A;  5L4H A;  5HEG A;  2ZJV A;  5BP0 A;  4QAB A;  2VL0 A;  3UU6 A;  2BG9 B;  4D01 A;  2WNJ A;  2Y56 A;  5AIN A;  2XQ3 A;  4UM1 A;  3JAE A;  3WTM A;  4QAC A;  5JME A;  4FRR A;  5HCM A;  5CO5 A;  5J5G A; 
#chains in the Genus database with same CATH topology
 2IDO B;  2CM0 A;  5IWA T;  4EZ4 A;  4F6R C;  4HWF A;  2VQE T;  3LK2 B;  3FHN A;  4PK4 A;  3PUA A;  1S94 A;  3DP7 A;  4GK5 E;  3FZH B;  4PNI A;  4DO0 A;  3KBU A;  5LJM A;  1T8B A;  4PJL A;  4XBF B;  4XZC A;  3GMI A;  2D2S A;  2R6G F;  3AE9 A;  4DBR A;  3RC3 A;  1MND A;  2KLQ A;  1WR6 A;  2DWK A;  4AIS A;  4DR6 T;  4IT4 A;  3MKD A;  4ZI7 E;  3FZF B;  3TLS A;  3T8O A;  5C3J A;  4EB6 E;  5FXW A;  4O4I E;  2XYT A;  2YKS A;  5HWX A;  4IDQ A;  4Q25 A;  4PK6 A;  1NEN A;  2LHN A;  3ZT7 A;  2XY8 B;  3L8R A;  4HFH A;  3P4R A;  5AFJ A;  3UT5 E;  2LEH A;  3C4Z A;  5BP0 A;  2V8S V;  4JI1 T;  4ZOL E;  4UM1 A;  1X79 A;  5JME A;  5HCM A;  1B7T A;  5FNV E;  3WI3 A;  2VAS A;  3ZCI A;  4B6X A;  2ZM0 A;  2XAH B;  1YXR A;  4YT0 A;  2UZ6 A;  5HAX A;  3Q5W A;  2WBL A;  4H9Q C;  4A98 A;  3KV9 A;  3Q5E A;  4WW0 A;  4YSZ A;  2Y57 A;  2WDR A;  3TLV A;  3LSV A;  5L47 A;  4LFC T;  3RI5 A;  5AQH B;  4KP3 C;  4NXM T;  1UX4 A;  3RKO A;  2X67 A;  5CFB A;  3H37 A;  3AAA B;  4AI6 A;  4J2C A;  3ZPO A;  4H9R C;  2Q9Q D;  2IC9 A;  3VU7 H;  2OA5 A;  1J1J A;  1XDP A;  2X9X A;  3AA1 B;  1KK7 A;  4ILU A;  2WQY A;  3NVO A;  4WZX A;  2XAJ B;  3DTO A;  3ZMT B;  5JDH A;  3HKE E;  4BQT A;  3AE5 A;  3PDY A;  3J9X 1;  3K3Q C;  4Z8X A;  3CPZ A;  4U72 A;  2J47 A;  4GYS A;  3U78 A;  4HTE A;  5AQM B;  4B3T T;  3MA9 A;  5JRE A;  5AIN A;  5HWY A;  4BJN A;  3HL6 A;  5JQG E;  3ZSS A;  5LA6 E;  3T1H T;  3WTI A;  2G0U A;  3L09 A;  4H9N C;  3AXJ B;  3SQ6 A;  3BQL A;  3S4U A;  4UVB B;  2WN9 A;  2ZMA A;  3QNU A;  3UUL A;  2PH9 A;  2K9A A;  4ALX A;  3FBL A;  2WNL A;  3EHZ A;  4O4H E;  4LF9 T;  1OED A;  2CRB A;  3H3M A;  4XK9 A;  2ODV A;  4QXB B;  2CWO A;  4YJ2 E;  3FXE B;  4AFG A;  3EDV A;  3EI0 A;  2M67 A;  2X51 A;  3HKC E;  2WDV A;  2X0L B;  3VKH A;  4LF4 T;  3EAB A;  1Z0P A;  5AQL B;  3I9Y A;  5FMN A;  2WMN A;  5LP6 E;  4GKK T;  3AAE B;  4UV8 B;  4DV1 T;  4EED A;  1LVK A;  1UW6 A;  3IGQ A;  2L8K A;  2BYN A;  4HGA A;  5LHG B;  4DVD A;  1XDO A;  4AXP A;  2KZ7 B;  5AQU B;  2I0M A;  5EK4 A;  2V26 A;  4CZZ B;  2W00 A;  4CQI A;  2JQ9 A;  2W61 A;  4BFQ A;  4EYU A;  4LFA T;  4AFH A;  2W4X A;  4LMK A;  4HWD A;  2W67 A;  3CQX C;  4HFD A;  4P0B A;  1D1C A;  4YXD A;  1D0Z A;  2N2N A;  4CXW A;  3E22 E;  2W62 A;  1SUM B;  4HWI B;  3AED A;  4IIJ E;  2UXB T;  4TWF A;  3QUJ A;  2HHH T;  2UU9 T;  2LT3 A;  3ZDG A;  3N9L A;  4X1K E;  3UU8 A;  1ZOY A;  3R6N A;  1OED B;  1MIY A;  3RGL A;  1XZY A;  4DV3 T;  1W0A A;  3IEE A;  1YD8 G;  2N9D A;  4DV6 T;  3FZM B;  3AEE A;  4KBM B;  2VVS A;  3ETU A;  2WB5 A;  3PMZ A;  4C91 A;  5LGU B;  4UVA B;  3CQC B;  2V1D B;  4EZ1 A;  4DV7 T;  3LBX A;  2BG9 A;  2JRK A;  4OHF A;  2NR4 A;  1IJ6 A;  3N9Q A;  2V7M A;  2QYW A;  5FY7 A;  1HCI A;  3FBZ A;  4QH5 A;  4EXT A;  2WM9 A;  4ZI3 C;  2NOX A;  4DND A;  2V7I A;  4M1P A;  4DR4 T;  1LRZ A;  2C5K T;  4HFI A;  2W8G A;  4U33 A;  2JQH A;  2BG9 C;  4DR2 T;  3F2E A;  5TAO A;  2LHR A;  3I9W A;  1YKH B;  5L2L A;  4LML A;  2LM9 A;  1V9D A;  1ZHC A;  5JH7 E;  5FVL A;  5J5H A;  3L39 A;  5DQV A;  4JEU B;  3K1S A;  1IBK T;  3TLU A;  2DWG A;  2ZJV A;  3AXJ A;  3DJB A;  4B3M T;  3PUX F;  2VUR A;  2HPL A;  2W66 A;  1U5P A;  2BS2 A;  3UTK A;  3M3Z B;  2JQK A;  2YEV C;  5L3B B;  1US7 B;  4IE5 A;  4DBM A;  3VHL A;  2VKO A;  5BW2 A;  4QX8 B;  1DU2 A;  4DR1 T;  3UU4 A;  4JI0 T;  4X5T A;  4ERR A;  2LKG A;  2XQ8 A;  4U74 A;  5FY0 A;  1WLX A;  2HH7 A;  1FIO A;  3RHW A;  2MTQ A;  1UCU A;  2IUB A;  5AFH A;  3B5M A;  3L3P A;  4ZS2 A;  3UUX B;  4WYV A;  1WR0 A;  3V5S A;  3SFD A;  5HXC A;  2JPF A;  5FL1 A;  4EOZ B;  2UXC T;  2E5V A;  5J0Z A;  4UR9 A;  2XQ5 A;  3SOL A;  3ZMV B;  2BBJ A;  1T72 A;  2B76 A;  5HEJ A;  1FMV A;  5HEO A;  4DR7 T;  4IDO A;  4DBQ A;  2L9Q A;  2IML A;  1E7P A;  5LBM A;  3U8N A;  1U4Q A;  4GKJ T;  1SE7 A;  5AQS B;  3KV6 A;  2HN2 A;  2KWI B;  1M62 A;  2LSK A;  2V7J A;  4U2Y A;  5HEH A;  5AQJ B;  2AE9 A;  4B3R T;  2E9X C;  1HNW T;  4X20 E;  1XNR T;  3U3I A;  3ZEF B;  3F31 A;  3AE1 A;  3CKD A;  3UUN A;  4YTM A;  3KIN B;  1MNE A;  4EIW A;  4ZK1 A;  2W0G A;  3C50 A;  2E9X B;  3MAC A;  4UEL A;  3U8L A;  2C5I T;  3SQ9 A;  4YHH T;  4ZJS A;  2FBW A;  5AQQ B;  2YOE A;  4A5X A;  5EK2 A;  4X62 T;  4ZHQ E;  4IDZ A;  5KDM C;  4AQF A;  5FL0 A;  1D1A A;  3P4W A;  4IHJ E;  4LF6 T;  5HCJ A;  2BYS A;  3TLT A;  2IW5 B;  2Z6E A;  4UF0 B;  3PUG A;  2KXP B;  3AAI A;  4BAY B;  3P4Q A;  3Q9D A;  2UUA T;  1UK5 A;  3RIU A;  5JRC A;  1HFA A;  2QRX A;  3QB5 K;  4DR5 T;  4AFT A;  3VR8 A;  2UXN B;  2M6B A;  2XAS B;  3EDU A;  1WFD A;  4C90 A;  4DMW A;  1HG5 A;  3PE0 A;  4Z91 A;  4MBQ A;  1MMG A;  4BA9 A;  5H6Q B;  5FXZ A;  4ZI2 C;  2WZI A;  4EEB A;  3PUZ F;  3CX7 B;  4AQY T;  4DID B;  1KNR A;  5JDL A;  5LMN T;  4OX9 T;  3N2K E;  5ADX L;  3HA4 A;  4MFR A;  3ESL A;  3U8K A;  5JDF A;  2LRK A;  5FXV A;  4HE8 A;  4FJO A;  3I0Q A;  4O4L E;  3N9P A;  4NIQ A;  2XZ5 A;  5EZY E;  3CML A;  4O4J E;  2QC1 B;  3AE6 A;  4ZEY A;  1E1H B;  2XJ7 A;  2JMK A;  4B5D A;  2XQY A;  2V5C A;  3OVU A;  3SIO A;  2Y6X A;  2PBI A;  2MAW A;  1W0B A;  2WP9 A;  2MYS A;  3PV0 F;  5KZU A;  3P8C D;  3GA8 A;  3KV5 A;  3AA0 B;  5E0O A;  1FJG T;  1N34 T;  1CUN A;  3E0Z A;  3UFE A;  4G63 A;  2YME A;  2H3R A;  2JIW A;  2FJE A;  4CXY A;  5F3J A;  3RQU A;  4K0U A;  3ZN0 B;  5DQW A;  4ANJ A;  2OLT A;  4ILB A;  3C84 A;  1I6Z A;  5AQG B;  2LRL A;  4ILA A;  5AFM A;  2DL1 A;  2NW9 A;  2NTY A;  1MMD A;  3HKB E;  2Q9Q C;  3ZMS B;  2WNC A;  3KVA A;  3SFE A;  2KT9 A;  3PUS A;  4WV9 A;  3N2O A;  3MJX A;  4MLK A;  4CN4 A;  4IE7 A;  3UU3 A;  2XAQ B;  2VVN A;  4JI2 T;  5LGN B;  4JEH B;  1BR4 A;  3AEF A;  1BR0 A;  2BBH A;  2WNJ A;  4QAC A;  4NXN T;  2B1E A;  2A9U A;  4O8S A;  3NWI A;  3WAJ A;  4NUV A;  4LF5 T;  3N9N A;  2W8F A;  2XNT A;  2BR8 A;  5ABH A;  4JI4 T;  4TV8 E;  3JC6 C;  5A1L A;  3JAF A;  2BZB A;  3LJC A;  3F57 A;  2XYS A;  3AA6 B;  4PK5 A;  3HI2 A;  3QB5 A;  5AQN B;  5HYA A;  3NZQ A;  1N36 T;  1X9B A;  1WCR A;  1UUR A;  2ZM2 A;  4TZ4 C;  2BYR A;  3KV4 A;  5LNK A;  2BG9 E;  4YSY A;  2VKH A;  4JI5 T;  1OXZ A;  2WWV A;  3ZYK A;  1QLB A;  2H88 A;  3PTR B;  3RIF A;  4KI0 F;  3VKG A;  4LF8 T;  4MAL A;  5J1G A;  2X9H A;  4ZRU A;  2Y48 B;  1L0V A;  3H3A A;  4PJN A;  2LOS A;  5HXS A;  2IHR 1;  4H9O C;  4H9P C;  5J5I A;  4CN1 A;  5J2U E;  2CXF A;  1SHZ C;  1HNZ T;  1WRD A;  1J5E T;  4MHC A;  4IL9 A;  3TKL B;  3N2G E;  2EHO B;  2YN6 A;  4EZH A;  5JR9 C;  4PW8 A;  4U3C A;  2K3W A;  2CXL A;  1IBL T;  3VRA A;  3JCF A;  5AQF B;  4P09 A;  2UXD T;  3BQI A;  1HNX T;  3CVR A;  2AXD S;  3GWH A;  1I94 T;  4CI2 B;  1BR2 A;  4H63 H;  3WTN A;  1OED C;  2XZ6 A;  3CX6 B;  3OBV E;  4I50 E;  4DUY T;  4KMC A;  2WU5 A;  3NRY A;  5ETW A;  4QHO A;  3QOF A;  4UM3 P;  4QAA A;  4IE6 A;  1KEY A;  3GN5 A;  4I0U A;  3GUA A;  3VRB A;  4YY3 T;  2WMO A;  3ZN1 B;  4TV9 E;  4EV6 A;  4E7S A;  3PUR A;  2X00 A;  4TWD A;  5LBQ B;  3WTO A;  2IAK A;  3P50 A;  1HG2 A;  4X66 T;  4EGW A;  3UUB A;  4KHP T;  4N78 D;  4ZS3 A;  4QXC B;  2Y8D A;  2CLY C;  5L3F B;  4DV4 T;  3RPU A;  4PFP A;  2XSA A;  4QWN B;  3KDS E;  2MBG A;  5LXT E;  2A3D A;  3W15 B;  2Q9Q A;  4JV5 T;  2RPA A;  2VKJ A;  2HN1 A;  3PUV F;  5KXJ A;  5L3C B;  4AIU A;  4AKI A;  2YDS A;  5AFU L;  3ONL C;  3ZJ1 A;  2ZM6 T;  3WIP A;  2CMR A;  5C2T A;  1ZKE A;  3KBT A;  2C9T A;  2XQ4 A;  4L5G A;  3AEA A;  4WNK A;  4EAH A;  5JTG A;  4FRR A;  3A5X A;  4UXN B;  3QC9 A;  3LK4 2;  4YHJ A;  3E08 A;  3CX8 B;  2V5D A;  2RP4 A;  4CI1 B;  1MIW A;  4NZB A;  5KMG P;  2BKO A;  4JBW F;  4L9I A;  3NRX A;  1KNP A;  3U8M A;  2W63 A;  4P0A A;  2PTF A;  1M7K A;  4DMV A;  5LJN A;  2QGS A;  2V6Y B;  3WTH A;  2WSS V;  5CJ5 A;  2DI4 A;  2QVA A;  1YQ4 A;  2YDR A;  2XQ7 A;  4ZI2 D;  3UU5 A;  3ZMU B;  2BS3 A;  4QKN A;  1WYC A;  4U7Y A;  5AQT B;  5FVK A;  1XNQ T;  1YQ3 A;  5L3E B;  3FXD B;  4YLH A;  5AFL A;  3SH1 A;  2Y7Y A;  5AFK A;  2WWU A;  2FUP A;  5LB7 B;  3T4M A;  4HFV A;  4WBO A;  5DAB A;  4HWC A;  3AE8 A;  3ZLI A;  5CA0 E;  1KFY A;  3ZC1 A;  5BMV E;  3RH3 A;  1UV6 A;  1IBM T;  2UXX B;  2WCA A;  2D0U A;  3GN5 B;  4U7I A;  5IHY A;  2V7K A;  2ZJU A;  3T1Y T;  3RF1 A;  5AQP B;  2J4G A;  2JQQ A;  2ACZ A;  1Z8U A;  2XAG B;  1AJ3 A;  2Y54 A;  3IA3 A;  3LK3 B;  2RA1 A;  2N1G A;  5JDQ A;  5HEG A;  4YTP A;  2VL0 A;  4CI3 B;  3AVS A;  5H6R B;  3EVY A;  4IGU A;  3UUM A;  2CXD A;  3O1J A;  1MIV A;  2WAU A;  1O3X A;  4HN9 A;  1VCT A;  4UM3 S;  3C4W A;  1WYB A;  3ANW A;  2E8I A;  5JR9 B;  5FJV A;  2EHO A;  3AEB A;  2XQA A;  3PUY F;  4ILC A;  3I1A A;  2EHO D;  4ASK A;  3EUH A;  3UFG A;  1HX8 A;  1OWA A;  4UM3 A;  1Y64 B;  3WTL A;  4TUY E;  1I9B A;  2CE7 A;  2XSB A;  4PFO A;  5CGM A;  1IZN B;  4O2A E;  1HX1 B;  2X0Y A;  2W2U A;  4P1N A;  4NPP A;  3ZYM A;  2YDQ A;  2LSJ A;  4X65 T;  4A97 A;  3ZDH A;  3RQW A;  4PIR A;  3ZT6 A;  3RC8 A;  5AFN A;  4UXU A;  1H7C A;  3RIA A;  5DJQ C;  3SS1 A;  2KND A;  2CPT A;  2BKN A;  2YIN A;  2PJQ A;  3AA7 B;  5J5F A;  3AEC A;  2BYP A;  3SWH A;  5L3D B;  3J7Y q;  2X66 A;  2XPK A;  3ZYL A;  3MZK B;  2XNV A;  2VL8 A;  4DR3 T;  1QSD A;  5C8Y E;  2XM1 A;  1QUU A;  1VRB A;  4D01 A;  2SPC A;  5JVD E;  4O2B E;  5AFM B;  4A56 A;  4NUU A;  2PGZ A;  2V7L A;  3C51 A;  3NKZ A;  4AQF C;  2XZE A;  3C64 A;  4UV9 B;  4OFZ A;  1ZEE A;  2LSY A;  4BJM A;  2CBI A;  4KUM B;  1ZV4 X;  2IC6 A;  4HKA A;  1XMO T;  2FJD A;  2KIN B;  2XTL A;  3Q5X A;  5ABF B;  3RYC E;  3MXZ A;  3RRW A;  1FEW A;  2DHR A;  4ZZB A;  3SRZ A;  3IHR A;  1LKX A;  3ZST A;  3G06 A;  1VOM A;  2BYQ A;  4KX6 A;  5L4E A;  2YK0 A;  2NP9 A;  3HR0 A;  3ZT5 A;  4ZR6 A;  4IL4 A;  1NEK A;  5AQV B;  2V6Y A;  1D1B A;  5TVC A;  2CWY A;  3O1I A;  5ABF A;  1VCS A;  1D0Y A;  2QA7 A;  4ZXL A;  1XWM A;  4TX5 A;  4GK0 E;  4IE0 A;  4DV0 T;  3AE7 A;  2NWB A;  2LM2 A;  4XHE A;  1G73 A;  3RIU C;  5HXE A;  3B57 A;  4GIW A;  2GK9 A;  2MPK A;  2L3L A;  1G8X A;  5LMU T;  5JDM A;  2OV9 A;  4PJM A;  5L4H A;  2NW8 A;  2IIU A;  4JI7 T;  3UU6 A;  2I59 A;  2KWH A;  3JAE A;  1BR1 A;  5CO5 A;  2CLY B;  1OED E;  2ZM8 A;  4OK0 A;  2BR7 A;  5ABE A;  4TNW A;  3ZC0 A;  2MOZ A;  4LFB T;  3FB2 A;  2LLY A;  3AVR A;  4U2Z A;  2X00 D;  3M65 A;  2KSR A;  3ETV A;  3LBX B;  2VB6 A;  3UQ4 A;  2H89 A;  1S35 A;  5CA1 E;  4UVC B;  5KE4 A;  5LG4 A;  3AE2 A;  3FZK B;  3VR9 A;  2WZY A;  2LSG A;  2WDQ A;  1HTJ F;  3P7I A;  2PFV A;  5J5G A;  4UEM A;  2E2A A;  1UX2 A;  3WTJ A;  5HXH A;  3FZL B;  3ZCJ A;  3ABV A;  2J1D G;  2FJB A;  3K3O A;  3CK6 A;  1T98 A;  1IJ5 A;  2I6H A;  3RX6 A;  3AE4 A;  5LOV E;  2UUC T;  5AQK B;  3ONJ A;  2VK9 A;  4COF A;  2ODU A;  3I0O A;  2H7O A;  1ZP0 A;  4DV5 T;  2DCF A;  5AQR B;  4ISS A;  3ANW B;  4HFE A;  5JR9 A;  3D0T A;  5JDN A;  3RYH E;  2H7V C;  3CWZ B;  4QH1 A;  5AQO B;  4JLE A;  2Y56 A;  4HEA A;  3WTM A;  2E5L T;  4ZJT A;  3EAM A;  4JI8 T;  3PU3 A;  2XQ9 A;  4IDN A;  2K48 A;  3JC6 D;  4ADZ A;  1R8I A;  4WBN E;  2BJ0 A;  3PJA A;  5SYO A;  3OYX A;  4GOU A;  2PG8 A;  3MK7 C;  3ONX A;  2YMD A;  3O4X E;  4FI5 A;  3Q2M A;  2VQF T;  4CN6 A;  2BVM A;  4JI6 T;  4AKH A;  3OPC A;  3ZJ2 A;  4B3S T;  3K3N A;  4JI3 T;  3CIR A;  2J62 A;  3OTO T;  3LG7 A;  1D0X A;  4I43 B;  1W9R A;  4YTN A;  2CCQ A;  2XHE B;  1IAP A;  5L3G B;  4DUZ T;  2LE8 A;  4HWH A;  5ABG A;  3CQG B;  4EYY R;  4AKG A;  2D9D A;  2C5J A;  5IUX A;  3LFM A;  5AQI B;  2M6I A;  2KMF A;  3IF8 B;  3P4P A;  2K24 A;  1LVF A;  3RYF E;  1FMW A;  4QH4 A;  3N9M A;  2XNU A;  1Y01 A;  3C79 A;  3PUQ A;  2NW7 A;  4AKL A;  2ES0 A;  1EZ3 A;  4XAX B;  1CHU A;  1T7S A;  1JNZ A;  4HQP A;  1NWM X;  2NTX A;  2K5B B;  2A2F X;  5F8P A;  4IE4 A;  4AQG A;  3PJA J;  5HXR A;  1UX5 A;  5JRC B;  4QAB A;  4TN7 B;  5LGT B;  1HR0 T;  2XM2 A;  2WU2 A;  2XQ3 A;  1MMA A;  3N5L A;  5FY1 A;  2CEA A;  2UUB T;  4H9S E;  3BQK A;  2BDE A;  3Q5D A;  2CHO A;  3R84 B;  5FKY A;  2E9X D;  4AKR B;  3A7M A;  2A72 A;  2F4V T;  3U8J A;  2V6X A;  3C4X A;  5HEU A;  2CBJ A;  2LJL A;  3O1H A;  3OJA A;  4CXX A;  2FJA A;  2CA5 A;  4X1Y E;  2YU1 A;  4PAG A;  2ZLY A;  3K8P C;  5LHI B;  4X1I E;  1UGO A;  4H63 V;  2LKH A;  2YU2 A;  2XAF B;  1JNR A;  3UQ7 A;  1KNZ A;  3N9O A;  5KX5 E;  2Q9Q B;  4HFB A;  5JDG A;  3HKD E;  3OKQ A;  4K0K T;  2X0H A;  4ZZC A;  5IYZ E;  4GYR A;  4LF7 T;  1SA0 E;  4UIG A;  2VKD A;  2BVL A;  2C0S A;  5LYJ E;  2P9B A;  1E2A A;  2JJ9 A;  2X68 A;  4IRE A;  2D0T A;  3JAD A;  3WTK A;  1KF6 A;  2WS3 A;  2X9W A;  1MMN A;  3PEO A;  3LDQ B;  4IDP A;  4E7Z A;  2EHO C;  2XQ6 A;  1YW0 A;  2WZH A;  4QXH B;  3QK6 A;  2X9Y A;  4L0R A;  3RLF F;  5M4Y A;  5LXB A;  1UUS A;  3A8Y C;  4LMJ A;  3RRC A;  4HFC A;  3KVB A;  5BRX A;  3X1D A;  3BK9 A;  2BKP A;  3B13 A;  4G2A A;  5FP3 A;  2BG9 B;  3RKG A;  2XUE A;  2BS4 A;  3O9X A;  2DNX A;  5BR8 T;  2LOP A;  3P4S A;  3OYZ A;  5LG3 A;  4UY2 A;  5FXX A;  4YJ3 E;  4TWH A;  5LHH B;  1HS7 A;  5EK3 A;  3KFW X;  4OYK A;  2VWA A;  4I4T E;  4JYA T;  4ZK4 A;  4TNV A;  4U31 A;  4OYJ A;  4ZI3 D;  4X64 T;  5FYM A;  3V5U A;  4PJJ A;  3C98 B;  4UF0 A;  4YSX A;  2DLR A;  3PUW F;  3NZP A;  3PU8 A;  3RYI E;  4V1A v;  2Y58 A;  5GON E;  1YKE B;  4DV2 T;  4JUY A;  3WAK A;  3ZKR A;  2HPJ A;  1N32 T;  4YFS A;  5LCY A;  3ZMZ B;  1NAF A;  1GQE A;  3IBP A;  1W09 A;  2WY2 A;  2LSI A;  3AE3 A;  2E9X A;  3TLW A;  4IST A;  1XMQ T;  2ACX A;  5CB4 E;  4F8H A;  2D5U A;  4KHZ F;  1N33 T;  4I55 E;  4Z90 A;  2CHN A;  5F5W A;  4QX7 B;  5J2T E;  2JMH A;  3AB3 B;  1HF8 A;  1J5W A;  3AEG A;  3NBX X; 
#chains in the Genus database with same CATH homology
 1OED E;  4TWF A;  2BR7 A;  3WTI A;  4TNW A;  4ZJT A;  5AFM B;  3EAM A;  3ZDG A;  2LLY A;  3SQ6 A;  4ZK1 A;  2XQ9 A;  5LG3 A;  3U8K A;  4UY2 A;  2PGZ A;  4NZB A;  2W8F A;  2BJ0 A;  2X00 D;  4DBM A;  2WN9 A;  3U8L A;  4UM3 S;  3SQ9 A;  2KSR A;  3UU8 A;  2UZ6 A;  2XNT A;  2PH9 A;  4ZJS A;  3WTN A;  5BW2 A;  2BR8 A;  1OED C;  5SYO A;  1OED B;  4ALX A;  2XZ6 A;  4TWH A;  3U8M A;  4A98 A;  3UQ4 A;  5FJV A;  3U8J A;  2YOE A;  5HEU A;  3UU4 A;  2XZ5 A;  2XQA A;  3JAF A;  2YMD A;  2Y57 A;  3TLV A;  5L47 A;  3LSV A;  4ILC A;  4X5T A;  2XYS A;  2WNL A;  2LKG A;  3RI5 A;  2XQ8 A;  3EHZ A;  2QC1 B;  5KE4 A;  1OED A;  4ZK4 A;  2LKH A;  3UQ7 A;  4UM3 P;  4QAA A;  4TNV A;  3RHW A;  3GUA A;  4XK9 A;  3WTH A;  3P4W A;  3PMZ A;  2WZY A;  4UM3 A;  4B5D A;  3WTL A;  5AFH A;  1I9B A;  2XQ7 A;  4HFB A;  3UU5 A;  4ZZB A;  2X00 A;  4TWD A;  4EZ1 A;  5CFB A;  2BYR A;  3SIO A;  4AFG A;  2MAW A;  3EI0 A;  5HCJ A;  3WTO A;  2BG9 E;  2BG9 A;  3P50 A;  2BYS A;  4ZZC A;  3UUB A;  3TLT A;  2BYQ A;  5AFL A;  3SH1 A;  2Y7Y A;  5AFK A;  5KZU A;  1UX2 A;  5J0Z A;  3WTJ A;  5L4E A;  2XQ5 A;  4QH5 A;  4ZR6 A;  4NPP A;  4IL4 A;  3RIF A;  3T4M A;  5TVC A;  5HEJ A;  5HEO A;  2Y58 A;  4IRE A;  4A97 A;  4ZRU A;  3ZKR A;  5IUX A;  2YME A;  1UW6 A;  2M6I A;  3ZDH A;  3TLS A;  3JAD A;  3IGQ A;  3RQW A;  2BYN A;  3WTK A;  3RQU A;  4PIR A;  4QH4 A;  4HFI A;  1UV6 A;  2XNU A;  3PEO A;  4AFT A;  2W8G A;  5AFN A;  2XYT A;  4UXU A;  4ILB A;  2YKS A;  3C84 A;  5J5I A;  3C79 A;  3WIP A;  3RIA A;  3U8N A;  2BG9 C;  4COF A;  2LM2 A;  2M6B A;  3TLW A;  4ILA A;  4BQT A;  5AFM A;  4BFQ A;  4XHE A;  5J5F A;  4F8H A;  2XQ6 A;  2C9T A;  2ZJU A;  4AFH A;  4LML A;  2WNC A;  4HFE A;  2BYP A;  4LMK A;  5LXB A;  2XQ4 A;  4HQP A;  4WV9 A;  2Y54 A;  4HFD A;  4IL9 A;  4LMJ A;  4HFC A;  4Z91 A;  4HFH A;  5J5H A;  5BRX A;  4Z90 A;  5HEH A;  2YN6 A;  5AFJ A;  4QH1 A;  3UU3 A;  3TLU A;  2XNV A;  5L4H A;  5HEG A;  2ZJV A;  5BP0 A;  4QAB A;  2VL0 A;  3UU6 A;  2BG9 B;  4D01 A;  2WNJ A;  2Y56 A;  5AIN A;  2XQ3 A;  4UM1 A;  3JAE A;  3WTM A;  4QAC A;  5JME A;  4FRR A;  5HCM A;  5CO5 A;  5J5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...