2XQ4A

Pentameric ligand gated ion channel glic in complex with tetramethylarsonium (tmas)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 75
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq4A01
5HCMA 3P4WA 2XQ4A 3TLWA 5J0ZA 3GUAA 3SIOA 4HFIA 2BR7A 3UUBA 4UY2A 2WNCA 2BG9C 2LKHA 4ZZBA 3TLVA 4EZ1A 4QH1A 5HEOA 2Y54A 2UZ6A 4ALXA 3WTNA 5J5IA 3TLSA 3ZKRA 3WTIA 3RIFA 5AINA 3UU6A 3TLTA 2BG9B 5AFHA 4ZK1A 2LKGA 4QAAA 2WNJA 2XQ9A 2XZ6A 3C84A 2BG9A 3WTLA 5L4EA 2XQ5A 3SH1A 2XYSA 4HFHA 2WN9A 4AFHA 2LM2A 5AFKA 5FJVA 4F8HA 2M6IA 5HCJA 4QH4A 5CFBA 3IGQA 4TWDA 4PIRA 4ILCA 3SQ9A 3WTHA 2XQ3A 5HEJA 2BYRA 2BG9E 4BQTA 3UU4A 4Z90A 2X00A 3UU3A 2XYTA 4TWHA 3U8MA 2Y7YA 2BJ0A 5HEHA 5L4HA 3RQUA 2XQ6A 4Z91A 5AFLA 5BP0A 2BYPA 2MAWA 4LMKA 2PH9A 5HEGA 4TNWA 4ZJTA 4TWFA 5IUXA 4ZJSA 3WTJA 2XNVA 3P50A 5KZUA 5AFNA 4UM3S 4HFCA 4IL9A 4LMJA 3RQWA 1UX2A 3WIPA 2ZJVA 3WTMA 2BYSA 4ZK4A 2W8FA 2Y56A 4BFQA 2M6BA 2ZJUA 3SQ6A 4ZR6A 5AFJA 4UM3P 2KSRA 2YKSA 5J5GA 4QABA 2YOEA 5LG3A 3PMZA 5L47A 2QC1B 3RIAA 4NZBA 3UQ7A 2YN6A 5JMEA 4ILAA 4HFDA 2YMEA 4ILBA 3PEOA 3U8NA 3U8LA 5BW2A 3JADA 3EAMA 2Y57A 3EI0A 1UW6A 5BRXA 3JAFA 2YMDA 4UM1A 3RHWA 5TVCA 3U8KA 5HEUA 2W8GA 4ZRUA 2C9TA 5J5FA 4A97A 2XZ5A 3UU8A 1OEDC 2VL0A 4QH5A 1I9BA 2LLYA 3WTKA 4DBMA 4UM3A 3UQ4A 4IREA 3T4MA 4D01A 4XK9A 4HQPA 3UU5A 4HFEA 4AFTA 4ZZCA 2X00D 1OEDB 2XQAA 4HFBA 3ZDHA 5J5HA 2BYQA 2BYNA 3EHZA 2XNTA 4COFA 1UV6A 2WNLA 4QACA 2XQ8A 3TLUA 4WV9A 3LSVA 4IL4A 1OEDA 3C79A 4AFGA 3RI5A 4X5TA 4LMLA 4UXUA 4NPPA 2XQ7A 2XNUA 5LXBA 2PGZA 5CO5A 5AFMB 4A98A 4FRRA 4TNVA 3WTOA 5SYOA 1OEDE 4XHEA 5KE4A 3JAEA 2WZYA 4B5DA 2Y58A 2BR8A 5AFMA 3U8JA 3ZDGA
chains in the Genus database with same CATH superfamily
3AE4A 5LXTE 4UV8B 1XNQT 5LCYA 5HEOA 1CHUA 2FUPA 5JR9A 4LF5T 3WTNA 4DIDB 2X9HA 4EZ4A 3N9NA 2M67A 2LOPA 2IIUA 2XTLA 4PNIA 4O4HE 2WNJA 3KV6A 4AXPA 4O2BE 3CX6B 1HNZT 5FJVA 4CXXA 3ESLA 2V7MA 4PIRA 4XBFB 3AE9A 4BQTA 4DO0A 4CZZB 2QA7A 3OKQA 2MAWA 2NTYA 5HEGA 1HX1B 2DL1A 2BKOA 3SFEA 3N2OA 5EK3A 1UX4A 4YJ2E 2ZJUA 4LFBT 4H9NC 5AFJA 2H3RA 5J5GA 3J9X1 3MACA 1XZYA 3PUAA 3VRAA 4UXNB 2K9AA 4O4IE 4JI0T 1HCIA 3EVYA 4DR6T 2DCFA 5HXRA 4UVBB 1V9DA 3MK7C 3PU8A 2XQAA 2BYQA 2NP9A 3RGLA 4QACA 4UXUA 4AKLA 3JC6C 3GN5A 2X9YA 5BR8T 3WTOA 3IHRA 4XHEA 3DJBA 2Y58A 2XQ4A 3R6NA 3V5UA 5JR9B 2BR7A 4H9PC 5C2TA 3FZHB 2UZ6A 3WTIA 3RIFA 2C5IT 2BBJA 1IBMT 3RH3A 4QAAA 2N1GA 4ISSA 3C98B 3RRWA 2WZIA 3CQGB 5LOVE 1LVFA 5LMNT 1G8XA 1MMAA 3PURA 1W09A 1N36T 3E0ZA 2X00A 3O1IA 2Y7YA 4Z91A 4BJNA 2RA1A 1Y64B 2PG8A 4TNWA 2NW7A 4B3RT 3ZN0B 2JQQA 4UM3S 4IE7A 2ZLYA 3UFEA 4U31A 3I0OA 1ZEEA 3Q5WA 4B3ST 4EGWA 4U7IA 4AKRB 4ZI7E 5LMUT 4UM1A 2W8GA 2VK9A 4A97A 2JIWA 3UU8A 1OEDC 3ZJ1A 2D9DA 2YINA 1W9RA 3ZT7A 4EOZB 4HQPA 2MYSA 3LK42 1XWMA 4IE5A 3GN5B 4NIQA 3KBUA 3FZFB 2V26A 1BR2A 5JTGA 2I6HA 2E5LT 4PFOA 2H89A 5J0ZA 1BR1A 4AQGA 4JI6T 2V5DA 4HGAA 4EEBA 3I0QA 2LRKA 4ZS2A 5TAOA 3UU6A 1YXRA 2ODUA 3TLTA 5JVDE 3L3PA 4DV3T 2WDRA 2KWHA 2WS3A 2XQ9A 2E9XD 4CI3B 4AKHA 4ILUA 4PJMA 2BVMA 3AECA 3ZMTB 5J2UE 3GWHA 4QXCB 4LMKA 3M65A 1N32T 2BKNA 3PU3A 5JDFA 2Q9QD 4HFCA 3O1JA 1LRZA 3O1HA 3N9MA 3VKGA 4UM3P 2DWGA 5C8YE 2WP9A 2QC1B 4EIWA 2LE8A 3U8NA 3RIUC 2W67A 3I9YA 3ANWA 3UTKA 2A9UA 2LSGA 3SS1A 3HKCE 1NWMX 2LRLA 3ZCJA 3QUJA 2WMOA 3UQ4A 4B3TT 4J2CA 5AQTB 1MIWA 3CIRA 1JNZA 2XZEA 3AAEB 2DHRA 2D2SA 4ASKA 2FJAA 2JPFA 2WMNA 2XQ8A 3AA1B 4O2AE 5JH7E 1HX8A 5KXJA 3PUWF 4YT0A 4UF0A 3AE3A 2VQET 1I94T 2BG9C 1ZP0A 2UUAT 4ALXA 4IIJE 3KFWX 5JDGA 3K1SA 2KINB 2PBIA 1S35A 3G06A 2UXBT 2L3LA 4YY3T 2WN9A 3K8PC 3P7IA 2K5BB 1Z0PA 5IYZE 2CE7A 4MFRA 4MALA 4ZXLA 3UU3A 3NBXX 2X0LB 3BQKA 4EAHA 3RQWA 3RYCE 5LGNB 2V5CA 2Y56A 3K3OA 2V7IA 5AQQB 3ANWB 3NRYA 3HR0A 2VURA 1SA0E 2LT3A 3RLFF 3ZYLA 4QH5A 2LLYA 2NW8A 3FXDB 5CA0E 1Z8UA 4ZZCA 4YLHA 3QOFA 3AAIA 3PUSA 5CGMA 1UGOA 4UF0B 3TKLB 3LDQB 2LSJA 2PJQA 1NENA 2IHR1 3ZMZB 5LJNA 2VQFT 2DLRA 4X1IE 1KNRA 4WBOA 3RC8A 2XASB 2HN2A 4JI8T 5FYMA 3TLVA 3PUYF 3CMLA 2CWYA 3BQLA 3RKGA 5AINA 5JDLA 3HA4A 2KT9A 3PE0A 2WQYA 2XPKA 1UURA 3N9QA 2ACXA 5FXXA 1HF8A 3C84A 3C64A 4AFHA 4P09A 4HFHA 5L2LA 3OTOT 4ILCA 4X1YE 5FXZA 2BYRA 2CLYC 2L9QA 1D1BA 2BKPA 3U8MA 2HPJA 1WR0A 4E7ZA 3ZJ2A 5LJMA 1HG5A 4LMJA 1UX2A 3FBLA 4QXBB 4DBQA 2JJ9A 3ZYKA 5ABEA 4LF7T 2KXPB 2YDRA 1QLBA 3LK2B 5L47A 4NZBA 2H7VC 3AE8A 5BW2A 3EAMA 3L09A 3N5LA 2MPKA 5HXSA 2X51A 2H7OA 3R84B 1YQ4A 4JBWF 4ZOLE 3T4MA 3AA7B 2XHEB 5EK2A 4XZCA 1FEWA 2LM9A 5LBQB 4EZHA 5AQFB 2IMLA 4Q25A 5ETWA 4DV4T 4FRRA 2X66A 4P0AA 3JAEA 4I0UA 2XJ7A 3M3ZB 1ZV4X 5ABGA 5FY1A 4U74A 2IDOB 5DQVA 3DP7A 3VKHA 1XDOA 3T1HT 5LG4A 3LBXB 1W0AA 2X0YA 2XQ5A 3QC9A 4HWFA 3RKOA 5AFKA 3BK9A 4QH4A 3IGQA 3KV4A 3B57A 2V8SV 2D0UA 5AQVB 1HG2A 4U2YA 1NEKA 5BP0A 2PH9A 1D0YA 2V6YA 5IUXA 4B3MT 3UUMA 4ANJA 3ZLIA 5AFNA 3OYXA 2W4XA 3W15B 4ZK4A 4K0KT 4DV5T 1YW0A 4DUYT 2DI4A 3FXEB 2E9XC 2WDVA 3AE2A 2V1DB 1UX5A 3U8LA 1ZHCA 1UW6A 1IZNB 1DU2A 2C0SA 4AKGA 5HXEA 4JI2T 4ERRA 2D5UA 2XAGB 2F4VT 4U72A 1GQEA 5L3EB 4BJMA 4I50E 4QWNB 3MZKB 4WW0A 1FIOA 2Q9QC 3ZDHA 2WDQA 1OEDA 1H7CA 5FMNA 5ABFA 5CB4E 3F31A 2CBIA 4YHJA 1OEDE 4ZHQE 3GUAA 3SIOA 4UY2A 3BQIA 5M4YA 1HNWT 3AEAA 3AEEA 3EDUA 4O4JE 3P4QA 1XMQT 5HWXA 4IE4A 2UXXB 2YDQA 3HKEE 3JCFA 5AFHA 3LK3B 4I43B 2BS3A 3EDVA 4FJOA 1E1HB 3ZYMA 1AJ3A 2M6IA 3LFMA 3WTHA 3PV0F 3RC3A 3F57A 4L5GA 2V6YB 2L8KA 5AFLA 1T98A 2CA5A 3AE6A 4LFCT 3N9LA 4JLEA 3RYIE 3PUXF 2WBLA 5A1LA 5FL1A 3ZMUB 4EYUA 4HFVA 3IEEA 2BZBA 2ZMAA 2YKSA 3T8OA 4QXHB 4EV6A 3RIAA 3N9OA 1D0ZA 2YMEA 3ONXA 1U5PA 1LVKA 5KDMC 4HN9A 5FY0A 5BRXA 3KV5A 3ZSTA 1YKEB 4ZRUA 4GYSA 2B1EA 2XSBA 2XZ5A 4U7YA 1S94A 2W2UA 4P1NA 3U78A 4XK9A 3RIUA 1KK7A 3I9WA 4Z8XA 2BDEA 1OEDB 2PFVA 2XM2A 4COFA 5ABFB 3OVUA 2CRBA 1IAPA 4HWDA 1XNRT 5HWYA 4ADZA 4DV7T 3UUNA 4GKJT 4IDNA 3WI3A 4YTNA 3U8JA 1MMNA 5HAXA 3OPCA 4KBMB 2XUEA 2C5JA 2LSYA 2UUBT 2VKJA 4ZZBA 1WYCA 3NZPA 3U3IA 4WBNE 4PJNA 1D1CA 3KVAA 1NAFA 2QGSA 4DMVA 5AQJB 2B76A 2CHOA 2BG9A 2XYSA 3KV9A 4F8HA 4G63A 2KMFA 4GOUA 2BG9E 4EXTA 3CQXC 3MA9A 1MIVA 1J1JA 4H9SE 3RQUA 1I6ZA 4CN6A 4ZJSA 1U4QA 3GA8A 4I4TE 3DTOA 3P50A 3WTMA 2KNDA 2NR4A 3RYFE 2XAQB 2CCQA 4E7SA 3C4ZA 5L3DB 4ILBA 3PEOA 2ES0A 3RHWA 4JI1T 3AVSA 3B13A 3KINB 4DR2T 1CUNA 3ZEFB 2V7LA 2CXLA 3WTKA 4GYRA 1WFDA 4DV6T 4DV2T 2Z6EA 1WYBA 1W0BA 4DR7T 5FVLA 5DQWA 3F2EA 4LF6T 4O4LE 4MLKA 2X9WA 3AVRA 3ZSSA 5AQMB 3PJAJ 5EK4A 2UXDT 1KF6A 5LYJE 3NKZA 3UT5E 2XAJB 2A2FX 5FL0A 4OFZA 5IHYA 2BG9B 4BAYB 2W62A 4TV9E 2I59A 3SH1A 1MIYA 2J1DG 5CFBA 3E22E 4UIGA 4TWHA 2ODVA 1D1AA 4QHOA 2XQ6A 3LG7A 3MJXA 2D0TA 2CPTA 1FMVA 4AQFC 2W63A 5AQGB 4QABA 5LG3A 4DUZT 1VCTA 2LHRA 3PUGA 5JMEA 2E8IA 3PTRB 3NVOA 5KMGP 3EI0A 3C50A 2XQYA 4PJLA 1UCUA 3P4RA 4AIUA 2PTFA 4LF8T 2VB6A 4G2AA 5BMVE 4UR9A 4CXWA 4F6RC 1BR0A 1WCRA 4NXNT 3CX8B 4IL4A 1HNXT 3Q5EA 3NZQA 2LSKA 4X1KE 1Y01A 2P9BA 1XDPA 5JDHA 3ETVA 2Y48B 3EUHA 4K0UA 4KUMB 2RP4A 2WNCA 1HTJF 2J47A 3SFDA 4QH1A 2WAUA 2BBHA 4DVDA 2YU1A 4YTPA 4DR5T 2BS2A 2XZ6A 4L0RA 1KEYA 2CWOA 2QRXA 3FBZA 3UU4A 2K3WA 2CBJA 2YDSA 4CI1B 4EB6E 4Z90A 2E5VA 5HYAA 3VR8A 4KHZF 5FKYA 2EHOC 3L39A 2CLYB 4HTEA 1VCSA 4EEDA 3LJCA 4AISA 1O3XA 1MMDA 1WR6A 2BYSA 3VHLA 2WY2A 4X20E 3LBXA 2Y8DA 2RPAA 3PMZA 1WLXA 4DV1T 2X0HA 5LA6E 2HPLA 4NUUA 5C3JA 2WU5A 3JADA 2IC6A 2YMDA 1HFAA 2G0UA 2KWIB 3OBVE 2NOXA 2ZM8A 1SE7A 1XMOT 3VR9A 2E9XA 4TN7B 4HKAA 4JEHB 4TUYE 4DNDA 3CWZB 3UU5A 4AFTA 2X00D 3A7MA 4LF9T 3P8CD 3LSVA 5AQRB 5CA1E 2JQHA 2XQ7A 3K3QC 2PGZA 2UXCT 4PJJA 5KE4A 2Q9QA 3IA3A 3AEBA 5EZYE 3IF8B 4JEUB 2JRKA 4UV9B 1EZ3A 2J62A 3A8YC 3MXZA 5HXHA 3TLSA 3ZKRA 2W0GA 3C4WA 1IBLT 4ZK1A 1OXZA 3I1AA 1YD8G 2H88A 4ISTA 4OK0A 5FVKA 3E08A 3AA6B 2MOZA 4M1PA 3AE1A 3OYZA 4ZS3A 1YKHB 4GK5E 3ZC1A 3Q2MA 4H9OC 3A5XA 3WIPA 3ETUA 4CXYA 5LNKA 2HH7A 2M6BA 2JMKA 4MBQA 3HKDE 2KSRA 1KFYA 2VVNA 3L8RA 5FNVE 2Y57A 3J7Yq 4DBRA 5L3CB 5LBMA 2E9XB 4PK6A 2WCAA 5J5FA 4HWCA 2VL0A 4X66T 3KDSE 4O8SA 5ABHA 4YHHT 3WAKA 2IW5B 4DR3T 4HFEA 4NUVA 3AE5A 3ZMVB 5AFUL 3EHZA 2XNTA 3CVRA 1UV6A 2X67A 2Q9QB 2WM9A 2ACZA 4EYYR 3ZCIA 1SHZC 2BR8A 3ZN1B 2E2AA 4IT4A 2I0MA 3P4WA 2QVAA 2UXNB 4HWIB 2LKHA 4UELA 4TV8E 4YJ3E 2LJLA 5FY7A 1VRBA 1E7PA 2YEVC 3ONLC 4JV5T 3WTLA 3GMIA 5JQGE 4ZI3D 2EHOD 3CQCB 4IE0A 2CM0A 1J5WA 3UUXB 5LP6E 3RF1A 5F5WA 2X9XA 4YSYA 1IBKT 2SPCA 2FJEA 5KZUA 1QUUA 5FP3A 4C91A 1T72A 3T1YT 5H6QB 5LB7B 3UQ7A 3Q5DA 4HFDA 4JI4T 3PDYA 4KMCA 5FXWA 3CKDA 3JAFA 4L9IA 1OWAA 4UVCB 1LKXA 4H63H 4AKIA 5AQSB 4TZ4C 1MNEA 2MTQA 2AE9A 5LHHB 2MBGA 4D01A 3HKBE 1R8IA 2CHNA 2WNLA 3ZT6A 4WV9A 3O9XA 2NTXA 4LMLA 5JR9C 4KI0F 2A72A 4JYAT 3N2GE 4H9RC 1UK5A 4X62T 2WU2A 2FBWA 4AI6A 3ZDGA 4IGUA 2DWKA 4IHJE 4IDQA 4U3CA 2BVLA 2OA5A 5J5IA 1HR0T 2JQ9A 1MNDA 2NWBA 5FXVA 4KHPT 3Q9DA 4UVAB 3N2KE 3RX6A 4IDPA 5AQLB 3VRBA 4WNKA 5L4EA 3PUVF 2FJDA 3HI2A 5JRCA 4U33A 3AB3B 2UUCT 2NW9A 5L3BB 2BJ0A 3V5SA 1SUMB 3SRZA 1N34T 3H37A 5HXCA 5ADXL 4BA9A 3O4XE 3PJAA 2W00A 3H3MA 3CX7B 3SQ6A 1N33T 4GK0E 4IDZA 2N9DA 4YFSA 2AXDS 3OJAA 2JMHA 4NXMT 2KZ7B 4AQFA 3ZMSB 4ZI2D 5LHIB 3FB2A 2C9TA 4CI2B 4GKKT 4B6XA 1ZOYA 4UM3A 2IUBA 2FJBA 4ZEYA 4PFPA 5AQIB 2VVSA 1BR4A 5LGTB 3ZT5A 1X9BA 4KP3C 4WZXA 4LFAT 4X5TA 3FZKB 4JUYA 1J5ET 2IAKA 3KVBA 4B5DA 5IWAT 4GIWA 3TLWA 1KNZA 4HFIA 2YU2A 2V7JA 3B5MA 3NRXA 1VOMA 2CEAA 5CJ5A 4I55E 2J4GA 2DNXA 2ZM0A 2VWAA 5JDNA 3FHNA 3UULA 5F3JA 4FI5A 5DABA 2WWUA 5JRCB 3AEDA 4CN4A 3AA0B 4MHCA 5HEJA 3QK6A 2K24A 5HEHA 1T7SA 3HL6A 2K48A 4YXDA 2XNVA 2W61A 4CQIA 4YSZA 2ZM2A 5J1GA 4UEMA 2V7KA 2VKOA 2IC9A 4PAGA 3CK6A 1M62A 3JC6D 2EHOA 2YOEA 3VU7H 3AE7A 1M7KA 4QX7B 1IJ5A 5JREA 3ZC0A 2N2NA 4JI7T 4WYVA 1X79A 1B7TA 3C51A 1L0VA 5AQHB 3SWHA 4IREA 2OV9A 3C4XA 3P4PA 3RRCA 2LSIA 3QB5A 3AXJA 4HFBA 1ZKEA 1IJ6A 2VL8A 4IDOA 3FZMB 1FJGT 3NWIA 1HS7A 4OX9T 2BS4A 4TNVA 5E0OA 2LEHA 5F8PA 5AFMA 4N78D 3UUBA 4EZ1A 4V1Av 5GONE 2Y54A 1G73A 2CXFA 4IE6A 4CN1A 3PUQA 5L3GB 4HWHA 4P0BA 5DJQC 4X65T 2LKGA 3Q5XA 2GK9A 1MMGA 2OLTA 1YQ3A 2W66A 4YTMA 1E2AA 3ONJA 2JQKA 5HCJA 4TWDA 2XM1A 5AQUB 4HEAA 2HHHT 2X68A 2XYTA 2A3DA 4XAXB 5L4HA 3AAAB 4U2ZA 2BYPA 2ZM6T 3WTJA 3ZPOA 4C90A 1WRDA 2CMRA 2XY8B 2WZHA 2XSAA 2EHOB 2W8FA 4BFQA 4QKNA 4ZR6A 2VKDA 4AQYT 3MKDA 4OYKA 2WB5A 4ILAA 3AEFA 4ZI3C 3SOLA 5TVCA 4H9QC 2V6XA 5AQPB 1I9BA 3ABVA 4OHFA 4A5XA 3AXJB 3RYHE 4X64T 3QB5K 3EABA 2HN1A 3TLUA 2KLQA 4AFGA 3RI5A 4NPPA 5H6RB 5CO5A 5AFMB 2WZYA 3P4SA 1US7B 5JDQA 5HCMA 3FZLB 5AQOB 4A56A 4DR4T 4KX6A 4H63V 2R6GF 3KBTA 1UUSA 3IBPA 2Y6XA 5LHGB 2WWVA 2LOSA 1FMWA 4TX5A 2LM2A 3SQ9A 4DV0T 2XQ3A 4QX8B 3PUZF 2CXDA 2WSSV 4PK5A 4PK4A 3D0TA 3RPUA 4ZJTA 4TWFA 3WAJA 4JI5T 4IL9A 2ZJVA 4YSXA 3N9PA 4PW8A 5AQNB 1D0XA 5AQKB 2QYWA 1KNPA 4DMWA 4DR1T 2UU9T 2YN6A 5JDMA 3QNUA 2XAFB 3S4UA 4HE8A 2XAHB 3U8KA 5HEUA 3CPZA 2C5KT 4OYJA 4DBMA 2VASA 3H3AA 5KX5E 2LHNA 5J2TE 2VKHA 1QSDA 5J5HA 3X1DA 2BYNA 3K3NA 3C79A 3AEGA 5LGUB 2XNUA 5LXBA 4A98A 5L3FB 2YK0A 4JI3T 4LF4T 5SYOA 3UFGA 1JNRA 1T8BA 4ZI2C
chains in the Genus database with same CATH topology
5HCMA 3P4WA 2XQ4A 3TLWA 5J0ZA 3GUAA 3SIOA 4HFIA 2BR7A 3UUBA 4UY2A 2WNCA 2BG9C 2LKHA 4ZZBA 3TLVA 4EZ1A 4QH1A 5HEOA 2Y54A 2UZ6A 4ALXA 3WTNA 5J5IA 3TLSA 3ZKRA 3WTIA 3RIFA 5AINA 3UU6A 3TLTA 2BG9B 5AFHA 4ZK1A 2LKGA 4QAAA 2WNJA 2XQ9A 2XZ6A 3C84A 2BG9A 3WTLA 5L4EA 2XQ5A 3SH1A 2XYSA 4HFHA 2WN9A 4AFHA 2LM2A 5AFKA 5FJVA 4F8HA 2M6IA 5HCJA 4QH4A 5CFBA 3IGQA 4TWDA 4PIRA 4ILCA 3SQ9A 3WTHA 2XQ3A 5HEJA 2BYRA 2BG9E 4BQTA 3UU4A 4Z90A 2X00A 3UU3A 2XYTA 4TWHA 3U8MA 2Y7YA 2BJ0A 5HEHA 5L4HA 3RQUA 2XQ6A 4Z91A 5AFLA 5BP0A 2BYPA 2MAWA 4LMKA 2PH9A 5HEGA 4TNWA 4ZJTA 4TWFA 5IUXA 4ZJSA 3WTJA 2XNVA 3P50A 5KZUA 5AFNA 4UM3S 4HFCA 4IL9A 4LMJA 3RQWA 1UX2A 3WIPA 2ZJVA 3WTMA 2BYSA 4ZK4A 2W8FA 2Y56A 4BFQA 2M6BA 2ZJUA 3SQ6A 4ZR6A 5AFJA 4UM3P 2KSRA 2YKSA 5J5GA 4QABA 2YOEA 5LG3A 3PMZA 5L47A 2QC1B 3RIAA 4NZBA 3UQ7A 2YN6A 5JMEA 4ILAA 4HFDA 2YMEA 4ILBA 3PEOA 3U8NA 3U8LA 5BW2A 3JADA 3EAMA 2Y57A 3EI0A 1UW6A 5BRXA 3JAFA 2YMDA 4UM1A 3RHWA 5TVCA 3U8KA 5HEUA 2W8GA 4ZRUA 2C9TA 5J5FA 4A97A 2XZ5A 3UU8A 1OEDC 2VL0A 4QH5A 1I9BA 2LLYA 3WTKA 4DBMA 4UM3A 3UQ4A 4IREA 3T4MA 4D01A 4XK9A 4HQPA 3UU5A 4HFEA 4AFTA 4ZZCA 2X00D 1OEDB 2XQAA 4HFBA 3ZDHA 5J5HA 2BYQA 2BYNA 3EHZA 2XNTA 4COFA 1UV6A 2WNLA 4QACA 2XQ8A 3TLUA 4WV9A 3LSVA 4IL4A 1OEDA 3C79A 4AFGA 3RI5A 4X5TA 4LMLA 4UXUA 4NPPA 2XQ7A 2XNUA 5LXBA 2PGZA 5CO5A 5AFMB 4A98A 4FRRA 4TNVA 3WTOA 5SYOA 1OEDE 4XHEA 5KE4A 3JAEA 2WZYA 4B5DA 2Y58A 2BR8A 5AFMA 3U8JA 3ZDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HCM A;  3P4W A;  2XQ4 A;  3TLW A;  5J0Z A;  3GUA A;  3SIO A;  4HFI A;  2BR7 A;  3UUB A;  4UY2 A;  2WNC A;  2BG9 C;  2LKH A;  4ZZB A;  3TLV A;  4EZ1 A;  4QH1 A;  5HEO A;  2Y54 A;  2UZ6 A;  4ALX A;  3WTN A;  5J5I A;  3TLS A;  3ZKR A;  3WTI A;  3RIF A;  5AIN A;  3UU6 A;  3TLT A;  2BG9 B;  5AFH A;  4ZK1 A;  2LKG A;  4QAA A;  2WNJ A;  2XQ9 A;  2XZ6 A;  3C84 A;  2BG9 A;  3WTL A;  5L4E A;  2XQ5 A;  3SH1 A;  2XYS A;  4HFH A;  2WN9 A;  4AFH A;  2LM2 A;  5AFK A;  5FJV A;  4F8H A;  2M6I A;  5HCJ A;  4QH4 A;  5CFB A;  3IGQ A;  4TWD A;  4PIR A;  4ILC A;  3SQ9 A;  3WTH A;  2XQ3 A;  5HEJ A;  2BYR A;  2BG9 E;  4BQT A;  3UU4 A;  4Z90 A;  2X00 A;  3UU3 A;  2XYT A;  4TWH A;  3U8M A;  2Y7Y A;  2BJ0 A;  5HEH A;  5L4H A;  3RQU A;  2XQ6 A;  4Z91 A;  5AFL A;  5BP0 A;  2BYP A;  2MAW A;  4LMK A;  2PH9 A;  5HEG A;  4TNW A;  4ZJT A;  4TWF A;  5IUX A;  4ZJS A;  3WTJ A;  2XNV A;  3P50 A;  5KZU A;  5AFN A;  4UM3 S;  4HFC A;  4IL9 A;  4LMJ A;  3RQW A;  1UX2 A;  3WIP A;  2ZJV A;  3WTM A;  2BYS A;  4ZK4 A;  2W8F A;  2Y56 A;  4BFQ A;  2M6B A;  2ZJU A;  3SQ6 A;  4ZR6 A;  5AFJ A;  4UM3 P;  2KSR A;  2YKS A;  5J5G A;  4QAB A;  2YOE A;  5LG3 A;  3PMZ A;  5L47 A;  2QC1 B;  3RIA A;  4NZB A;  3UQ7 A;  2YN6 A;  5JME A;  4ILA A;  4HFD A;  2YME A;  4ILB A;  3PEO A;  3U8N A;  3U8L A;  5BW2 A;  3JAD A;  3EAM A;  2Y57 A;  3EI0 A;  1UW6 A;  5BRX A;  3JAF A;  2YMD A;  4UM1 A;  3RHW A;  5TVC A;  3U8K A;  5HEU A;  2W8G A;  4ZRU A;  2C9T A;  5J5F A;  4A97 A;  2XZ5 A;  3UU8 A;  1OED C;  2VL0 A;  4QH5 A;  1I9B A;  2LLY A;  3WTK A;  4DBM A;  4UM3 A;  3UQ4 A;  4IRE A;  3T4M A;  4D01 A;  4XK9 A;  4HQP A;  3UU5 A;  4HFE A;  4AFT A;  4ZZC A;  2X00 D;  1OED B;  2XQA A;  4HFB A;  3ZDH A;  5J5H A;  2BYQ A;  2BYN A;  3EHZ A;  2XNT A;  4COF A;  1UV6 A;  2WNL A;  4QAC A;  2XQ8 A;  3TLU A;  4WV9 A;  3LSV A;  4IL4 A;  1OED A;  3C79 A;  4AFG A;  3RI5 A;  4X5T A;  4LML A;  4UXU A;  4NPP A;  2XQ7 A;  2XNU A;  5LXB A;  2PGZ A;  5CO5 A;  5AFM B;  4A98 A;  4FRR A;  4TNV A;  3WTO A;  5SYO A;  1OED E;  4XHE A;  5KE4 A;  3JAE A;  2WZY A;  4B5D A;  2Y58 A;  2BR8 A;  5AFM A;  3U8J A;  3ZDG A; 
#chains in the Genus database with same CATH topology
 3AE4 A;  5LXT E;  4UV8 B;  1XNQ T;  5LCY A;  5HEO A;  1CHU A;  2FUP A;  5JR9 A;  4LF5 T;  3WTN A;  4DID B;  2X9H A;  4EZ4 A;  3N9N A;  2M67 A;  2LOP A;  2IIU A;  2XTL A;  4PNI A;  4O4H E;  2WNJ A;  3KV6 A;  4AXP A;  4O2B E;  3CX6 B;  1HNZ T;  5FJV A;  4CXX A;  3ESL A;  2V7M A;  4PIR A;  4XBF B;  3AE9 A;  4BQT A;  4DO0 A;  4CZZ B;  2QA7 A;  3OKQ A;  2MAW A;  2NTY A;  5HEG A;  1HX1 B;  2DL1 A;  2BKO A;  3SFE A;  3N2O A;  5EK3 A;  1UX4 A;  4YJ2 E;  2ZJU A;  4LFB T;  4H9N C;  5AFJ A;  2H3R A;  5J5G A;  3J9X 1;  3MAC A;  1XZY A;  3PUA A;  3VRA A;  4UXN B;  2K9A A;  4O4I E;  4JI0 T;  1HCI A;  3EVY A;  4DR6 T;  2DCF A;  5HXR A;  4UVB B;  1V9D A;  3MK7 C;  3PU8 A;  2XQA A;  2BYQ A;  2NP9 A;  3RGL A;  4QAC A;  4UXU A;  4AKL A;  3JC6 C;  3GN5 A;  2X9Y A;  5BR8 T;  3WTO A;  3IHR A;  4XHE A;  3DJB A;  2Y58 A;  2XQ4 A;  3R6N A;  3V5U A;  5JR9 B;  2BR7 A;  4H9P C;  5C2T A;  3FZH B;  2UZ6 A;  3WTI A;  3RIF A;  2C5I T;  2BBJ A;  1IBM T;  3RH3 A;  4QAA A;  2N1G A;  4ISS A;  3C98 B;  3RRW A;  2WZI A;  3CQG B;  5LOV E;  1LVF A;  5LMN T;  1G8X A;  1MMA A;  3PUR A;  1W09 A;  1N36 T;  3E0Z A;  2X00 A;  3O1I A;  2Y7Y A;  4Z91 A;  4BJN A;  2RA1 A;  1Y64 B;  2PG8 A;  4TNW A;  2NW7 A;  4B3R T;  3ZN0 B;  2JQQ A;  4UM3 S;  4IE7 A;  2ZLY A;  3UFE A;  4U31 A;  3I0O A;  1ZEE A;  3Q5W A;  4B3S T;  4EGW A;  4U7I A;  4AKR B;  4ZI7 E;  5LMU T;  4UM1 A;  2W8G A;  2VK9 A;  4A97 A;  2JIW A;  3UU8 A;  1OED C;  3ZJ1 A;  2D9D A;  2YIN A;  1W9R A;  3ZT7 A;  4EOZ B;  4HQP A;  2MYS A;  3LK4 2;  1XWM A;  4IE5 A;  3GN5 B;  4NIQ A;  3KBU A;  3FZF B;  2V26 A;  1BR2 A;  5JTG A;  2I6H A;  2E5L T;  4PFO A;  2H89 A;  5J0Z A;  1BR1 A;  4AQG A;  4JI6 T;  2V5D A;  4HGA A;  4EEB A;  3I0Q A;  2LRK A;  4ZS2 A;  5TAO A;  3UU6 A;  1YXR A;  2ODU A;  3TLT A;  5JVD E;  3L3P A;  4DV3 T;  2WDR A;  2KWH A;  2WS3 A;  2XQ9 A;  2E9X D;  4CI3 B;  4AKH A;  4ILU A;  4PJM A;  2BVM A;  3AEC A;  3ZMT B;  5J2U E;  3GWH A;  4QXC B;  4LMK A;  3M65 A;  1N32 T;  2BKN A;  3PU3 A;  5JDF A;  2Q9Q D;  4HFC A;  3O1J A;  1LRZ A;  3O1H A;  3N9M A;  3VKG A;  4UM3 P;  2DWG A;  5C8Y E;  2WP9 A;  2QC1 B;  4EIW A;  2LE8 A;  3U8N A;  3RIU C;  2W67 A;  3I9Y A;  3ANW A;  3UTK A;  2A9U A;  2LSG A;  3SS1 A;  3HKC E;  1NWM X;  2LRL A;  3ZCJ A;  3QUJ A;  2WMO A;  3UQ4 A;  4B3T T;  4J2C A;  5AQT B;  1MIW A;  3CIR A;  1JNZ A;  2XZE A;  3AAE B;  2DHR A;  2D2S A;  4ASK A;  2FJA A;  2JPF A;  2WMN A;  2XQ8 A;  3AA1 B;  4O2A E;  5JH7 E;  1HX8 A;  5KXJ A;  3PUW F;  4YT0 A;  4UF0 A;  3AE3 A;  2VQE T;  1I94 T;  2BG9 C;  1ZP0 A;  2UUA T;  4ALX A;  4IIJ E;  3KFW X;  5JDG A;  3K1S A;  2KIN B;  2PBI A;  1S35 A;  3G06 A;  2UXB T;  2L3L A;  4YY3 T;  2WN9 A;  3K8P C;  3P7I A;  2K5B B;  1Z0P A;  5IYZ E;  2CE7 A;  4MFR A;  4MAL A;  4ZXL A;  3UU3 A;  3NBX X;  2X0L B;  3BQK A;  4EAH A;  3RQW A;  3RYC E;  5LGN B;  2V5C A;  2Y56 A;  3K3O A;  2V7I A;  5AQQ B;  3ANW B;  3NRY A;  3HR0 A;  2VUR A;  1SA0 E;  2LT3 A;  3RLF F;  3ZYL A;  4QH5 A;  2LLY A;  2NW8 A;  3FXD B;  5CA0 E;  1Z8U A;  4ZZC A;  4YLH A;  3QOF A;  3AAI A;  3PUS A;  5CGM A;  1UGO A;  4UF0 B;  3TKL B;  3LDQ B;  2LSJ A;  2PJQ A;  1NEN A;  2IHR 1;  3ZMZ B;  5LJN A;  2VQF T;  2DLR A;  4X1I E;  1KNR A;  4WBO A;  3RC8 A;  2XAS B;  2HN2 A;  4JI8 T;  5FYM A;  3TLV A;  3PUY F;  3CML A;  2CWY A;  3BQL A;  3RKG A;  5AIN A;  5JDL A;  3HA4 A;  2KT9 A;  3PE0 A;  2WQY A;  2XPK A;  1UUR A;  3N9Q A;  2ACX A;  5FXX A;  1HF8 A;  3C84 A;  3C64 A;  4AFH A;  4P09 A;  4HFH A;  5L2L A;  3OTO T;  4ILC A;  4X1Y E;  5FXZ A;  2BYR A;  2CLY C;  2L9Q A;  1D1B A;  2BKP A;  3U8M A;  2HPJ A;  1WR0 A;  4E7Z A;  3ZJ2 A;  5LJM A;  1HG5 A;  4LMJ A;  1UX2 A;  3FBL A;  4QXB B;  4DBQ A;  2JJ9 A;  3ZYK A;  5ABE A;  4LF7 T;  2KXP B;  2YDR A;  1QLB A;  3LK2 B;  5L47 A;  4NZB A;  2H7V C;  3AE8 A;  5BW2 A;  3EAM A;  3L09 A;  3N5L A;  2MPK A;  5HXS A;  2X51 A;  2H7O A;  3R84 B;  1YQ4 A;  4JBW F;  4ZOL E;  3T4M A;  3AA7 B;  2XHE B;  5EK2 A;  4XZC A;  1FEW A;  2LM9 A;  5LBQ B;  4EZH A;  5AQF B;  2IML A;  4Q25 A;  5ETW A;  4DV4 T;  4FRR A;  2X66 A;  4P0A A;  3JAE A;  4I0U A;  2XJ7 A;  3M3Z B;  1ZV4 X;  5ABG A;  5FY1 A;  4U74 A;  2IDO B;  5DQV A;  3DP7 A;  3VKH A;  1XDO A;  3T1H T;  5LG4 A;  3LBX B;  1W0A A;  2X0Y A;  2XQ5 A;  3QC9 A;  4HWF A;  3RKO A;  5AFK A;  3BK9 A;  4QH4 A;  3IGQ A;  3KV4 A;  3B57 A;  2V8S V;  2D0U A;  5AQV B;  1HG2 A;  4U2Y A;  1NEK A;  5BP0 A;  2PH9 A;  1D0Y A;  2V6Y A;  5IUX A;  4B3M T;  3UUM A;  4ANJ A;  3ZLI A;  5AFN A;  3OYX A;  2W4X A;  3W15 B;  4ZK4 A;  4K0K T;  4DV5 T;  1YW0 A;  4DUY T;  2DI4 A;  3FXE B;  2E9X C;  2WDV A;  3AE2 A;  2V1D B;  1UX5 A;  3U8L A;  1ZHC A;  1UW6 A;  1IZN B;  1DU2 A;  2C0S A;  4AKG A;  5HXE A;  4JI2 T;  4ERR A;  2D5U A;  2XAG B;  2F4V T;  4U72 A;  1GQE A;  5L3E B;  4BJM A;  4I50 E;  4QWN B;  3MZK B;  4WW0 A;  1FIO A;  2Q9Q C;  3ZDH A;  2WDQ A;  1OED A;  1H7C A;  5FMN A;  5ABF A;  5CB4 E;  3F31 A;  2CBI A;  4YHJ A;  1OED E;  4ZHQ E;  3GUA A;  3SIO A;  4UY2 A;  3BQI A;  5M4Y A;  1HNW T;  3AEA A;  3AEE A;  3EDU A;  4O4J E;  3P4Q A;  1XMQ T;  5HWX A;  4IE4 A;  2UXX B;  2YDQ A;  3HKE E;  3JCF A;  5AFH A;  3LK3 B;  4I43 B;  2BS3 A;  3EDV A;  4FJO A;  1E1H B;  3ZYM A;  1AJ3 A;  2M6I A;  3LFM A;  3WTH A;  3PV0 F;  3RC3 A;  3F57 A;  4L5G A;  2V6Y B;  2L8K A;  5AFL A;  1T98 A;  2CA5 A;  3AE6 A;  4LFC T;  3N9L A;  4JLE A;  3RYI E;  3PUX F;  2WBL A;  5A1L A;  5FL1 A;  3ZMU B;  4EYU A;  4HFV A;  3IEE A;  2BZB A;  2ZMA A;  2YKS A;  3T8O A;  4QXH B;  4EV6 A;  3RIA A;  3N9O A;  1D0Z A;  2YME A;  3ONX A;  1U5P A;  1LVK A;  5KDM C;  4HN9 A;  5FY0 A;  5BRX A;  3KV5 A;  3ZST A;  1YKE B;  4ZRU A;  4GYS A;  2B1E A;  2XSB A;  2XZ5 A;  4U7Y A;  1S94 A;  2W2U A;  4P1N A;  3U78 A;  4XK9 A;  3RIU A;  1KK7 A;  3I9W A;  4Z8X A;  2BDE A;  1OED B;  2PFV A;  2XM2 A;  4COF A;  5ABF B;  3OVU A;  2CRB A;  1IAP A;  4HWD A;  1XNR T;  5HWY A;  4ADZ A;  4DV7 T;  3UUN A;  4GKJ T;  4IDN A;  3WI3 A;  4YTN A;  3U8J A;  1MMN A;  5HAX A;  3OPC A;  4KBM B;  2XUE A;  2C5J A;  2LSY A;  2UUB T;  2VKJ A;  4ZZB A;  1WYC A;  3NZP A;  3U3I A;  4WBN E;  4PJN A;  1D1C A;  3KVA A;  1NAF A;  2QGS A;  4DMV A;  5AQJ B;  2B76 A;  2CHO A;  2BG9 A;  2XYS A;  3KV9 A;  4F8H A;  4G63 A;  2KMF A;  4GOU A;  2BG9 E;  4EXT A;  3CQX C;  3MA9 A;  1MIV A;  1J1J A;  4H9S E;  3RQU A;  1I6Z A;  4CN6 A;  4ZJS A;  1U4Q A;  3GA8 A;  4I4T E;  3DTO A;  3P50 A;  3WTM A;  2KND A;  2NR4 A;  3RYF E;  2XAQ B;  2CCQ A;  4E7S A;  3C4Z A;  5L3D B;  4ILB A;  3PEO A;  2ES0 A;  3RHW A;  4JI1 T;  3AVS A;  3B13 A;  3KIN B;  4DR2 T;  1CUN A;  3ZEF B;  2V7L A;  2CXL A;  3WTK A;  4GYR A;  1WFD A;  4DV6 T;  4DV2 T;  2Z6E A;  1WYB A;  1W0B A;  4DR7 T;  5FVL A;  5DQW A;  3F2E A;  4LF6 T;  4O4L E;  4MLK A;  2X9W A;  3AVR A;  3ZSS A;  5AQM B;  3PJA J;  5EK4 A;  2UXD T;  1KF6 A;  5LYJ E;  3NKZ A;  3UT5 E;  2XAJ B;  2A2F X;  5FL0 A;  4OFZ A;  5IHY A;  2BG9 B;  4BAY B;  2W62 A;  4TV9 E;  2I59 A;  3SH1 A;  1MIY A;  2J1D G;  5CFB A;  3E22 E;  4UIG A;  4TWH A;  2ODV A;  1D1A A;  4QHO A;  2XQ6 A;  3LG7 A;  3MJX A;  2D0T A;  2CPT A;  1FMV A;  4AQF C;  2W63 A;  5AQG B;  4QAB A;  5LG3 A;  4DUZ T;  1VCT A;  2LHR A;  3PUG A;  5JME A;  2E8I A;  3PTR B;  3NVO A;  5KMG P;  3EI0 A;  3C50 A;  2XQY A;  4PJL A;  1UCU A;  3P4R A;  4AIU A;  2PTF A;  4LF8 T;  2VB6 A;  4G2A A;  5BMV E;  4UR9 A;  4CXW A;  4F6R C;  1BR0 A;  1WCR A;  4NXN T;  3CX8 B;  4IL4 A;  1HNX T;  3Q5E A;  3NZQ A;  2LSK A;  4X1K E;  1Y01 A;  2P9B A;  1XDP A;  5JDH A;  3ETV A;  2Y48 B;  3EUH A;  4K0U A;  4KUM B;  2RP4 A;  2WNC A;  1HTJ F;  2J47 A;  3SFD A;  4QH1 A;  2WAU A;  2BBH A;  4DVD A;  2YU1 A;  4YTP A;  4DR5 T;  2BS2 A;  2XZ6 A;  4L0R A;  1KEY A;  2CWO A;  2QRX A;  3FBZ A;  3UU4 A;  2K3W A;  2CBJ A;  2YDS A;  4CI1 B;  4EB6 E;  4Z90 A;  2E5V A;  5HYA A;  3VR8 A;  4KHZ F;  5FKY A;  2EHO C;  3L39 A;  2CLY B;  4HTE A;  1VCS A;  4EED A;  3LJC A;  4AIS A;  1O3X A;  1MMD A;  1WR6 A;  2BYS A;  3VHL A;  2WY2 A;  4X20 E;  3LBX A;  2Y8D A;  2RPA A;  3PMZ A;  1WLX A;  4DV1 T;  2X0H A;  5LA6 E;  2HPL A;  4NUU A;  5C3J A;  2WU5 A;  3JAD A;  2IC6 A;  2YMD A;  1HFA A;  2G0U A;  2KWI B;  3OBV E;  2NOX A;  2ZM8 A;  1SE7 A;  1XMO T;  3VR9 A;  2E9X A;  4TN7 B;  4HKA A;  4JEH B;  4TUY E;  4DND A;  3CWZ B;  3UU5 A;  4AFT A;  2X00 D;  3A7M A;  4LF9 T;  3P8C D;  3LSV A;  5AQR B;  5CA1 E;  2JQH A;  2XQ7 A;  3K3Q C;  2PGZ A;  2UXC T;  4PJJ A;  5KE4 A;  2Q9Q A;  3IA3 A;  3AEB A;  5EZY E;  3IF8 B;  4JEU B;  2JRK A;  4UV9 B;  1EZ3 A;  2J62 A;  3A8Y C;  3MXZ A;  5HXH A;  3TLS A;  3ZKR A;  2W0G A;  3C4W A;  1IBL T;  4ZK1 A;  1OXZ A;  3I1A A;  1YD8 G;  2H88 A;  4IST A;  4OK0 A;  5FVK A;  3E08 A;  3AA6 B;  2MOZ A;  4M1P A;  3AE1 A;  3OYZ A;  4ZS3 A;  1YKH B;  4GK5 E;  3ZC1 A;  3Q2M A;  4H9O C;  3A5X A;  3WIP A;  3ETU A;  4CXY A;  5LNK A;  2HH7 A;  2M6B A;  2JMK A;  4MBQ A;  3HKD E;  2KSR A;  1KFY A;  2VVN A;  3L8R A;  5FNV E;  2Y57 A;  3J7Y q;  4DBR A;  5L3C B;  5LBM A;  2E9X B;  4PK6 A;  2WCA A;  5J5F A;  4HWC A;  2VL0 A;  4X66 T;  3KDS E;  4O8S A;  5ABH A;  4YHH T;  3WAK A;  2IW5 B;  4DR3 T;  4HFE A;  4NUV A;  3AE5 A;  3ZMV B;  5AFU L;  3EHZ A;  2XNT A;  3CVR A;  1UV6 A;  2X67 A;  2Q9Q B;  2WM9 A;  2ACZ A;  4EYY R;  3ZCI A;  1SHZ C;  2BR8 A;  3ZN1 B;  2E2A A;  4IT4 A;  2I0M A;  3P4W A;  2QVA A;  2UXN B;  4HWI B;  2LKH A;  4UEL A;  4TV8 E;  4YJ3 E;  2LJL A;  5FY7 A;  1VRB A;  1E7P A;  2YEV C;  3ONL C;  4JV5 T;  3WTL A;  3GMI A;  5JQG E;  4ZI3 D;  2EHO D;  3CQC B;  4IE0 A;  2CM0 A;  1J5W A;  3UUX B;  5LP6 E;  3RF1 A;  5F5W A;  2X9X A;  4YSY A;  1IBK T;  2SPC A;  2FJE A;  5KZU A;  1QUU A;  5FP3 A;  4C91 A;  1T72 A;  3T1Y T;  5H6Q B;  5LB7 B;  3UQ7 A;  3Q5D A;  4HFD A;  4JI4 T;  3PDY A;  4KMC A;  5FXW A;  3CKD A;  3JAF A;  4L9I A;  1OWA A;  4UVC B;  1LKX A;  4H63 H;  4AKI A;  5AQS B;  4TZ4 C;  1MNE A;  2MTQ A;  2AE9 A;  5LHH B;  2MBG A;  4D01 A;  3HKB E;  1R8I A;  2CHN A;  2WNL A;  3ZT6 A;  4WV9 A;  3O9X A;  2NTX A;  4LML A;  5JR9 C;  4KI0 F;  2A72 A;  4JYA T;  3N2G E;  4H9R C;  1UK5 A;  4X62 T;  2WU2 A;  2FBW A;  4AI6 A;  3ZDG A;  4IGU A;  2DWK A;  4IHJ E;  4IDQ A;  4U3C A;  2BVL A;  2OA5 A;  5J5I A;  1HR0 T;  2JQ9 A;  1MND A;  2NWB A;  5FXV A;  4KHP T;  3Q9D A;  4UVA B;  3N2K E;  3RX6 A;  4IDP A;  5AQL B;  3VRB A;  4WNK A;  5L4E A;  3PUV F;  2FJD A;  3HI2 A;  5JRC A;  4U33 A;  3AB3 B;  2UUC T;  2NW9 A;  5L3B B;  2BJ0 A;  3V5S A;  1SUM B;  3SRZ A;  1N34 T;  3H37 A;  5HXC A;  5ADX L;  4BA9 A;  3O4X E;  3PJA A;  2W00 A;  3H3M A;  3CX7 B;  3SQ6 A;  1N33 T;  4GK0 E;  4IDZ A;  2N9D A;  4YFS A;  2AXD S;  3OJA A;  2JMH A;  4NXM T;  2KZ7 B;  4AQF A;  3ZMS B;  4ZI2 D;  5LHI B;  3FB2 A;  2C9T A;  4CI2 B;  4GKK T;  4B6X A;  1ZOY A;  4UM3 A;  2IUB A;  2FJB A;  4ZEY A;  4PFP A;  5AQI B;  2VVS A;  1BR4 A;  5LGT B;  3ZT5 A;  1X9B A;  4KP3 C;  4WZX A;  4LFA T;  4X5T A;  3FZK B;  4JUY A;  1J5E T;  2IAK A;  3KVB A;  4B5D A;  5IWA T;  4GIW A;  3TLW A;  1KNZ A;  4HFI A;  2YU2 A;  2V7J A;  3B5M A;  3NRX A;  1VOM A;  2CEA A;  5CJ5 A;  4I55 E;  2J4G A;  2DNX A;  2ZM0 A;  2VWA A;  5JDN A;  3FHN A;  3UUL A;  5F3J A;  4FI5 A;  5DAB A;  2WWU A;  5JRC B;  3AED A;  4CN4 A;  3AA0 B;  4MHC A;  5HEJ A;  3QK6 A;  2K24 A;  5HEH A;  1T7S A;  3HL6 A;  2K48 A;  4YXD A;  2XNV A;  2W61 A;  4CQI A;  4YSZ A;  2ZM2 A;  5J1G A;  4UEM A;  2V7K A;  2VKO A;  2IC9 A;  4PAG A;  3CK6 A;  1M62 A;  3JC6 D;  2EHO A;  2YOE A;  3VU7 H;  3AE7 A;  1M7K A;  4QX7 B;  1IJ5 A;  5JRE A;  3ZC0 A;  2N2N A;  4JI7 T;  4WYV A;  1X79 A;  1B7T A;  3C51 A;  1L0V A;  5AQH B;  3SWH A;  4IRE A;  2OV9 A;  3C4X A;  3P4P A;  3RRC A;  2LSI A;  3QB5 A;  3AXJ A;  4HFB A;  1ZKE A;  1IJ6 A;  2VL8 A;  4IDO A;  3FZM B;  1FJG T;  3NWI A;  1HS7 A;  4OX9 T;  2BS4 A;  4TNV A;  5E0O A;  2LEH A;  5F8P A;  5AFM A;  4N78 D;  3UUB A;  4EZ1 A;  4V1A v;  5GON E;  2Y54 A;  1G73 A;  2CXF A;  4IE6 A;  4CN1 A;  3PUQ A;  5L3G B;  4HWH A;  4P0B A;  5DJQ C;  4X65 T;  2LKG A;  3Q5X A;  2GK9 A;  1MMG A;  2OLT A;  1YQ3 A;  2W66 A;  4YTM A;  1E2A A;  3ONJ A;  2JQK A;  5HCJ A;  4TWD A;  2XM1 A;  5AQU B;  4HEA A;  2HHH T;  2X68 A;  2XYT A;  2A3D A;  4XAX B;  5L4H A;  3AAA B;  4U2Z A;  2BYP A;  2ZM6 T;  3WTJ A;  3ZPO A;  4C90 A;  1WRD A;  2CMR A;  2XY8 B;  2WZH A;  2XSA A;  2EHO B;  2W8F A;  4BFQ A;  4QKN A;  4ZR6 A;  2VKD A;  4AQY T;  3MKD A;  4OYK A;  2WB5 A;  4ILA A;  3AEF A;  4ZI3 C;  3SOL A;  5TVC A;  4H9Q C;  2V6X A;  5AQP B;  1I9B A;  3ABV A;  4OHF A;  4A5X A;  3AXJ B;  3RYH E;  4X64 T;  3QB5 K;  3EAB A;  2HN1 A;  3TLU A;  2KLQ A;  4AFG A;  3RI5 A;  4NPP A;  5H6R B;  5CO5 A;  5AFM B;  2WZY A;  3P4S A;  1US7 B;  5JDQ A;  5HCM A;  3FZL B;  5AQO B;  4A56 A;  4DR4 T;  4KX6 A;  4H63 V;  2R6G F;  3KBT A;  1UUS A;  3IBP A;  2Y6X A;  5LHG B;  2WWV A;  2LOS A;  1FMW A;  4TX5 A;  2LM2 A;  3SQ9 A;  4DV0 T;  2XQ3 A;  4QX8 B;  3PUZ F;  2CXD A;  2WSS V;  4PK5 A;  4PK4 A;  3D0T A;  3RPU A;  4ZJT A;  4TWF A;  3WAJ A;  4JI5 T;  4IL9 A;  2ZJV A;  4YSX A;  3N9P A;  4PW8 A;  5AQN B;  1D0X A;  5AQK B;  2QYW A;  1KNP A;  4DMW A;  4DR1 T;  2UU9 T;  2YN6 A;  5JDM A;  3QNU A;  2XAF B;  3S4U A;  4HE8 A;  2XAH B;  3U8K A;  5HEU A;  3CPZ A;  2C5K T;  4OYJ A;  4DBM A;  2VAS A;  3H3A A;  5KX5 E;  2LHN A;  5J2T E;  2VKH A;  1QSD A;  5J5H A;  3X1D A;  2BYN A;  3K3N A;  3C79 A;  3AEG A;  5LGU B;  2XNU A;  5LXB A;  4A98 A;  5L3F B;  2YK0 A;  4JI3 T;  4LF4 T;  5SYO A;  3UFG A;  1JNR A;  1T8B A;  4ZI2 C; 
#chains in the Genus database with same CATH homology
 5HCM A;  3P4W A;  2XQ4 A;  3TLW A;  5J0Z A;  3GUA A;  3SIO A;  4HFI A;  2BR7 A;  3UUB A;  4UY2 A;  2WNC A;  2BG9 C;  2LKH A;  4ZZB A;  3TLV A;  4EZ1 A;  4QH1 A;  5HEO A;  2Y54 A;  2UZ6 A;  4ALX A;  3WTN A;  5J5I A;  3TLS A;  3ZKR A;  3WTI A;  3RIF A;  5AIN A;  3UU6 A;  3TLT A;  2BG9 B;  5AFH A;  4ZK1 A;  2LKG A;  4QAA A;  2WNJ A;  2XQ9 A;  2XZ6 A;  3C84 A;  2BG9 A;  3WTL A;  5L4E A;  2XQ5 A;  3SH1 A;  2XYS A;  4HFH A;  2WN9 A;  4AFH A;  2LM2 A;  5AFK A;  5FJV A;  4F8H A;  2M6I A;  5HCJ A;  4QH4 A;  5CFB A;  3IGQ A;  4TWD A;  4PIR A;  4ILC A;  3SQ9 A;  3WTH A;  2XQ3 A;  5HEJ A;  2BYR A;  2BG9 E;  4BQT A;  3UU4 A;  4Z90 A;  2X00 A;  3UU3 A;  2XYT A;  4TWH A;  3U8M A;  2Y7Y A;  2BJ0 A;  5HEH A;  5L4H A;  3RQU A;  2XQ6 A;  4Z91 A;  5AFL A;  5BP0 A;  2BYP A;  2MAW A;  4LMK A;  2PH9 A;  5HEG A;  4TNW A;  4ZJT A;  4TWF A;  5IUX A;  4ZJS A;  3WTJ A;  2XNV A;  3P50 A;  5KZU A;  5AFN A;  4UM3 S;  4HFC A;  4IL9 A;  4LMJ A;  3RQW A;  1UX2 A;  3WIP A;  2ZJV A;  3WTM A;  2BYS A;  4ZK4 A;  2W8F A;  2Y56 A;  4BFQ A;  2M6B A;  2ZJU A;  3SQ6 A;  4ZR6 A;  5AFJ A;  4UM3 P;  2KSR A;  2YKS A;  5J5G A;  4QAB A;  2YOE A;  5LG3 A;  3PMZ A;  5L47 A;  2QC1 B;  3RIA A;  4NZB A;  3UQ7 A;  2YN6 A;  5JME A;  4ILA A;  4HFD A;  2YME A;  4ILB A;  3PEO A;  3U8N A;  3U8L A;  5BW2 A;  3JAD A;  3EAM A;  2Y57 A;  3EI0 A;  1UW6 A;  5BRX A;  3JAF A;  2YMD A;  4UM1 A;  3RHW A;  5TVC A;  3U8K A;  5HEU A;  2W8G A;  4ZRU A;  2C9T A;  5J5F A;  4A97 A;  2XZ5 A;  3UU8 A;  1OED C;  2VL0 A;  4QH5 A;  1I9B A;  2LLY A;  3WTK A;  4DBM A;  4UM3 A;  3UQ4 A;  4IRE A;  3T4M A;  4D01 A;  4XK9 A;  4HQP A;  3UU5 A;  4HFE A;  4AFT A;  4ZZC A;  2X00 D;  1OED B;  2XQA A;  4HFB A;  3ZDH A;  5J5H A;  2BYQ A;  2BYN A;  3EHZ A;  2XNT A;  4COF A;  1UV6 A;  2WNL A;  4QAC A;  2XQ8 A;  3TLU A;  4WV9 A;  3LSV A;  4IL4 A;  1OED A;  3C79 A;  4AFG A;  3RI5 A;  4X5T A;  4LML A;  4UXU A;  4NPP A;  2XQ7 A;  2XNU A;  5LXB A;  2PGZ A;  5CO5 A;  5AFM B;  4A98 A;  4FRR A;  4TNV A;  3WTO A;  5SYO A;  1OED E;  4XHE A;  5KE4 A;  3JAE A;  2WZY A;  4B5D A;  2Y58 A;  2BR8 A;  5AFM A;  3U8J A;  3ZDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...