2XQ4A

Pentameric ligand gated ion channel glic in complex with tetramethylarsonium (tmas)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
total genus 75
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq4A01
2XQ8A 4EZ1A 5AFMA 3WTOA 2PGZA 3WTMA 1OEDB 4FRRA 4ZK1A 5J5IA 4A98A 4Z91A 2LKGA 3UU4A 1I9BA 2UZ6A 5HCMA 4UY2A 3T4MA 4BQTA 5HEUA 2WN9A 3C79A 3RQUA 2ZJUA 4LMKA 5AFHA 3WIPA 4ZZCA 4QH5A 2PH9A 2WNCA 2YKSA 2Y54A 3U8LA 5AFKA 2Y56A 4HFDA 3EI0A 3EHZA 3RIFA 5J5HA 5KE4A 4IREA 4HFCA 4HQPA 2BR8A 5JMEA 5KZUA 2XQ6A 3SQ6A 4ZK4A 2MAWA 2LM2A 2XYTA 5HEOA 4PIRA 4UXUA 4XK9A 3WTJA 3WTHA 3P4WA 1OEDA 4LMLA 5HEJA 2XNTA 4AFGA 2BG9A 3U8JA 2XNUA 4NZBA 4ALXA 4QACA 3UUBA 3WTIA 4AFTA 2LLYA 2BG9B 4ZR6A 2X00A 2XQ5A 4LMJA 4X5TA 2M6IA 2Y57A 4HFBA 2XQ9A 4QH1A 2BYPA 2ZJVA 2BYSA 2XZ6A 1OEDE 2XQ7A 4Z90A 5J5FA 2WNJA 4HFEA 4ILCA 4QH4A 5AFLA 5CO5A 4B5DA 3SIOA 2QC1B 3UQ7A 2C9TA 4COFA 2XNVA 3ZDGA 4TWFA 2YMDA 5SYOA 3RI5A 3TLVA 4AFHA 4ILAA 4A97A 5LG3A 5L47A 4UM3P 4D01A 4UM3A 3RHWA 2BJ0A 2WZYA 3PEOA 5LXBA 1OEDC 5IUXA 3C84A 2KSRA 4BFQA 4QAAA 5AINA 3TLUA 3TLWA 4DBMA 3LSVA 5FJVA 3JAEA 4TNVA 4IL9A 2YN6A 3WTNA 4ZRUA 3EAMA 2W8GA 1UV6A 4ZJTA 2BG9E 5BP0A 3UQ4A 4TNWA 2M6BA 3U8NA 5AFNA 4HFIA 3JAFA 5J5GA 2BYRA 2XQ3A 3TLTA 5BW2A 2BYNA 5HEHA 2XQAA 5J0ZA 4HFHA 3GUAA 4WV9A 3UU3A 3WTLA 4TWDA 5HCJA 4ILBA 3IGQA 5BRXA 3UU5A 5AFJA 4QABA 2BYQA 3ZKRA 1UX2A 2LKHA 5L4EA 5AFMB 3WTKA 3TLSA 4TWHA 2X00D 2WNLA 2VL0A 3ZDHA 3JADA 2YOEA 2BG9C 2XZ5A 3SQ9A 2XQ4A 5HEGA 5TVCA 4ZZBA 1UW6A 5L4HA 3UU6A 4XHEA 3SH1A 4UM1A 3UU8A 2YMEA 4UM3S 3U8KA 2XYSA 3RQWA 3U8MA 2Y7YA 4ZJSA 2BR7A 3PMZA 2W8FA 3P50A 4IL4A 4NPPA 3RIAA 5CFBA 4F8HA 2Y58A
chains in the Genus database with same CATH superfamily
1ZP0A 4ZK1A 5F5WA 3NVOA 4B3RT 2CHOA 3IEEA 5L3CB 5FNVE 1HR0T 2LSYA 1L0VA 2CBJA 3LK2B 4HQPA 4E7ZA 4OYJA 3ZJ1A 4LF7T 3AAEB 2A72A 3WAKA 3MA9A 4CZZB 4QACA 3KVBA 3ZT5A 1O3XA 2Y57A 1HX1B 4DIDB 1NENA 2VKDA 2BYSA 4WZXA 1ZKEA 3LJCA 4AKGA 1HCIA 1US7B 3VRBA 3KV4A 4UM3P 3ZPOA 4NXMT 5JDMA 2E5VA 2CBIA 5L3BB 2OA5A 3U8NA 3KV5A 2JPFA 3WAJA 4ZI2D 1VRBA 2WZIA 3NBXX 2QRXA 2EHOD 3RF1A 4UIGA 4U7IA 4YSXA 4GKKT 4PNIA 5HEGA 4EIWA 2K48A 4O4JE 5E0OA 3LK42 3RIAA 5FMNA 2JQKA 2D0UA 2VVNA 5J2TE 4A98A 2PJQA 4IHJE 1KNZA 1Y01A 3RRCA 2C5IT 3OYXA 5EK3A 5ABEA 3HR0A 1WR0A 2WSSV 3LG7A 3U8LA 3AA7B 3SFDA 3EHZA 3RIFA 1VCTA 2IW5B 3F2EA 1JNRA 4MALA 3QK6A 3UUBA 3CMLA 4YHHT 4DV6T 1WYCA 4JI2T 1NAFA 2LSKA 5J5FA 3N9QA 3PUGA 1D1BA 4DR1T 2QC1B 4DBQA 2YMDA 2HPJA 1KNRA 3HKCE 3SOLA 3AEBA 4PFOA 2W61A 3AECA 3TLWA 4DNDA 4U31A 4BJMA 4LFCT 1S94A 4ZRUA 3EAMA 3U3IA 2F4VT 2JMHA 1ZHCA 4U7YA 2VASA 1BR0A 5AQGB 3PUQA 4AKLA 3ZKRA 3VHLA 2V7IA 3ZYMA 3LDQB 3RX6A 2CLYB 2BBHA 2FJDA 3A8YC 5AQIB 4DMVA 3UU8A 5JREA 4GIWA 4H9QC 1GQEA 3NZPA 1J1JA 4IIJE 3TKLB 3PMZA 4WBNE 3ZT6A 2M67A 3P50A 1UK5A 4H9NC 2ODUA 4U74A 3AEGA 4P0AA 5LYJE 4HWIB 1OXZA 5F3JA 4YSZA 2L3LA 5LXTE 4ZZCA 3C64A 3N9OA 3CK6A 5J5HA 5ADXL 3U78A 1NWMX 3WTJA 2MAWA 4PIRA 4C91A 2UXDT 1LVKA 3P4WA 2XNTA 4OHFA 3S4UA 2W67A 3WTIA 4L5GA 2HN2A 4DMWA 2A9UA 3MXZA 4ZI3C 2C5JA 4OX9T 3VRAA 3CQCB 3CWZB 2WMNA 2XAQB 2XQYA 3E22E 2NW9A 5HXHA 5TAOA 1J5ET 2LRLA 5LA6E 3C98B 1LVFA 4ILAA 2V7LA 3P4PA 1D0YA 3B57A 3UUNA 2JQQA 2X9XA 5IHYA 2B76A 1HNZT 3PUAA 3ZEFB 3F57A 2JRKA 2W8GA 3UQ4A 5J0ZA 4ILBA 4DV4T 1ZOYA 5L4EA 1U4QA 4JI6T 2W4XA 1XMQT 2OLTA 2VL0A 3O1HA 2YDRA 3QC9A 3SQ9A 1IBMT 2AE9A 2XM2A 4CI2B 4UM1A 3EABA 2YMEA 3FZFB 3E0ZA 1T72A 1JNZA 3CVRA 5KXJA 5H6QB 1VCSA 2A2FX 5L3EB 1KK7A 4JI7T 2VURA 4YJ3E 5J2UE 5AQHB 2E9XB 3KDSE 5HCMA 2BDEA 5JR9C 3ZT7A 1HFAA 2VB6A 4L0RA 3PU8A 2XAJB 4AFGA 2BG9A 4NZBA 3K3QC 5AFUL 4LMJA 4X5TA 5JTGA 5FP3A 1WLXA 4HWHA 2AXDS 2WBLA 1AJ3A 4AQFA 4MLKA 5EK4A 4YSYA 3OBVE 3HKDE 3AE3A 4WW0A 4JUYA 2ZM0A 4J2CA 2JQHA 5HWYA 5LBMA 1ZV4X 3C84A 3ANWA 2KSRA 4YHJA 1Y64B 2G0UA 3I0QA 2FJAA 4EV6A 3KVAA 2K24A 3R6NA 5BP0A 4PJLA 5J5GA 5HEHA 4TV8E 3WTLA 2XUEA 5BRXA 3Q9DA 2CA5A 4K0UA 3WTKA 2WCAA 5CGMA 3K1SA 2WWVA 3DTOA 2UXBT 2D0TA 2I0MA 3PUZF 2NTYA 3RYFE 2H7OA 5LMUT 2V26A 2XQ8A 4LF8T 3H3AA 2SPCA 4AKHA 2RPAA 2N1GA 3AAIA 4KHZF 3GMIA 3Q5EA 3SQ6A 2V5DA 5HEOA 2BBJA 5LHGB 4HN9A 4K0KT 3U8JA 2X9YA 4OFZA 1QSDA 3RPUA 4U2YA 3OVUA 2XM1A 4X1KE 4M1PA 4G2AA 5AQNB 2XPKA 2LM9A 5ETWA 3FBZA 3Q5WA 4H63H 2C9TA 4COFA 3KFWX 3P4SA 1YQ4A 3QOFA 2DNXA 2V8SV 4MFRA 5JRCB 1Z8UA 1FIOA 1B7TA 2Q9QC 4JLEA 5CA1E 4ANJA 2WM9A 3ZMTB 5L3DB 5CJ5A 3FZMB 4BJNA 3N9PA 5LJMA 4B3TT 4QABA 3AXJA 2E9XD 1YW0A 2CPTA 2BG9C 2VQFT 5L4HA 5L2LA 3EDVA 4ZJSA 4HEAA 2VWAA 4I0UA 4NPPA 2V5CA 4U2ZA 3RH3A 4UV9B 2DI4A 4LF4T 3GA8A 2UZ6A 4PK5A 4UY2A 4BQTA 5JDLA 3C4XA 5AQLB 4I55E 5AQOB 2V7MA 4Q25A 2WS3A 5FXXA 4LF9T 4QXBB 5AQUB 2ZMAA 5JDQA 3GN5A 2XQ7A 4Z90A 2NTXA 3AVRA 4CN4A 4IE4A 4B5DA 1WRDA 4EGWA 4YFSA 3T1HT 3JC6D 4ZS3A 4NIQA 2CE7A 2KZ7B 2CM0A 2MPKA 2L8KA 4O4LE 1OEDC 3ZC1A 3LFMA 4BFQA 3TLUA 3RYIE 3O4XE 1W0BA 4H9RC 2CRBA 3J9X1 1SUMB 5AQVB 2M6BA 3I9YA 3CPZA 4WBOA 5HAXA 2JJ9A 3PTRB 4FJOA 4A56A 1XNQT 4NUUA 2IAKA 4TZ4C 4UV8B 4GOUA 5EK2A 2WWUA 3P4RA 4JI1T 4KX6A 4UVBB 1XDOA 1HNXT 1XNRT 3P7IA 5TVCA 4DBRA 2E2AA 4NUVA 3RLFF 4QHOA 3QUJA 4YLHA 3RIUA 4DV2T 2Y58A 5HXRA 4U72A 3FZHB 4CXXA 2H89A 5FXVA 1I9BA 3KV9A 5CB4E 2CXFA 2ZJUA 3QB5A 4QH5A 4GYSA 2YKSA 2Y56A 1BR4A 2X67A 3CX7B 2FBWA 4ILUA 4P0BA 5FVLA 2BS2A 3KINB 4YTPA 4XK9A 1N32T 4CQIA 1BR1A 3AEFA 5DQWA 4UF0A 4QX8B 2UXNB 4H9SE 4DR2T 2KINB 5FKYA 2J62A 3GWHA 3P4QA 2R6GF 5C2TA 5JDHA 4MBQA 5AQMB 3UQ7A 1IBKT 5FYMA 2YDQA 2WU5A 2H88A 2WZYA 2QYWA 3AXJB 5AQPB 4DBMA 5AINA 3MKDA 2Y8DA 3H37A 3T8OA 4EYYR 4HFIA 4DV7T 2XQAA 4DV1T 3C4WA 3PUYF 2CEAA 4KBMB 3UU3A 2ACXA 4DV5T 1UX2A 5JR9A 3FZKB 2DLRA 3AAAB 3NWIA 2XYSA 3RQWA 3ONJA 5DJQC 2BR7A 1N34T 4AQYT 2L9QA 1YKEB 4JI3T 4ZS2A 5C8YE 2QVAA 4IDOA 2ZM6T 2CWOA 3O9XA 3P8CD 3I1AA 1ZEEA 3RQUA 1E1HB 4X64T 2PH9A 4I50E 1UUSA 2GK9A 2LM2A 5A1LA 3Q5DA 2XNUA 4U33A 1MIVA 4UEMA 1D0XA 3RRWA 3IF8B 3NRXA 4QH1A 2ZJVA 2RP4A 2PFVA 2LRKA 2VKOA 3FZLB 2ZM2A 4XBFB 2UXCT 4JI0T 3RGLA 1UGOA 3B13A 5L47A 4B3ST 2N9DA 5IUXA 2WP9A 3RIUC 3R84B 3JAEA 4BA9A 4AKRB 2HHHT 3VKGA 3PUVF 2DWKA 1H7CA 5ABFA 3SS1A 2XQ3A 3TLTA 3AE2A 3KBTA 4FI5A 3IGQA 2H7VC 2BYQA 3ZCJA 2X0LB 2ZM8A 5JQGE 2D9DA 3SH1A 3UU6A 4OK0A 1M7KA 3Q2MA 5HYAA 4ZEYA 2NR4A 4DO0A 4IE5A 4X1IE 2VQET 2XAHB 1IBLT 1KEYA 4IE6A 4X1YE 4O4IE 3C79A 3B5MA 1VOMA 4EYUA 2IDOB 2DHRA 3CQGB 3RYHE 3DJBA 4IREA 2RA1A 4IDZA 3M3ZB 3WTHA 1WCRA 1X9BA 2V6YA 2E5LT 2YU1A 4PFPA 2Q9QA 3O1JA 1T8BA 1MMNA 2P9BA 4QH4A 2CMRA 1HS7A 1MNDA 1HG2A 3PUXF 3FBLA 4HWCA 4OYKA 1E7PA 1OWAA 4ZHQE 4QAAA 1DU2A 2C5KT 2K9AA 3L3PA 3J7Yq 1KF6A 3EVYA 4X66T 2LJLA 2LHRA 3HL6A 4HFHA 4H63V 2NW7A 2I6HA 3UU5A 5AFJA 2XZEA 2NWBA 5FXZA 2W0GA 4TWHA 2X66A 5LCYA 5LHHB 4EEDA 2UU9T 3QNUA 3V5SA 3JADA 1FJGT 4X62T 4AI6A 4UVCB 2WZHA 3AA0B 1UX5A 3KBUA 4JV5T 3ZMZB 2X51A 5C3JA 2VKHA 1T98A 4FRRA 3AE6A 4KP3C 3T4MA 2W63A 5AFHA 2UUBT 4IDNA 1LRZA 2WMOA 2BKOA 3RC8A 1OEDA 5HEJA 1HG5A 2B1EA 3CIRA 2PBIA 4ZR6A 2M6IA 2W66A 3CX8B 2BYPA 4KI0F 2BS3A 2LOPA 1FMWA 5FY0A 4JYAT 3AE8A 5ABFB 5LMNT 4JI4T 2XNVA 3BQIA 4EXTA 1YQ3A 1T7SA 4AFHA 4ZI3D 2IIUA 5AQQB 4ZI2C 3PEOA 2CWYA 4O2AE 2EHOC 3N9NA 4IL9A 4P09A 1EZ3A 1MMGA 3JAFA 2BYRA 4JEHB 3NRYA 2W62A 2IMLA 2IUBA 2BS4A 4AISA 1W9RA 2LKHA 2JMKA 3ZYKA 1MMAA 2W00A 3PURA 2XQ4A 3C50A 4ZZBA 1UW6A 1IAPA 3UFEA 2WY2A 5LBQB 4UM3S 2K3WA 4JEUB 1WYBA 3ETVA 1D0ZA 4MHCA 4O4HE 4LFAT 3ZN0B 1KFYA 2V6YB 2J4GA 2KLQA 2LKGA 2ODVA 2QGSA 4QX7B 2Q9QB 5HEUA 3BQLA 1HX8A 2WAUA 5JMEA 2MYSA 4DV0T 4AKIA 3W15B 4ZK4A 3X1DA 4UXUA 1MMDA 4EB6E 3V5UA 3SWHA 3K3OA 4ZXLA 2BG9B 4Z8XA 2X0HA 3MK7C 4IGUA 4AIUA 4U3CA 2CXLA 2XASB 5FL1A 1UCUA 3EDUA 3K8PC 3RKOA 3NZQA 1W0AA 5AQJB 3AVSA 2MOZA 2V7JA 4YY3T 2DWGA 2JIWA 3OJAA 5GONE 3ANWB 4EAHA 3ZMUB 1E2AA 2WDQA 2LHNA 3FXDB 4ZJTA 5AFNA 2LT3A 3E08A 4TWDA 4PJNA 3A5XA 4KMCA 4DR7T 2ES0A 1X79A 5AQSB 5KX5E 2BKPA 3AEEA 2LSGA 4I4TE 4CN1A 4XHEA 3N9LA 3C4ZA 2CXDA 3U8MA 4WNKA 2DL1A 5CFBA 4F8HA 1QUUA 5AFMA 3FB2A 2I59A 3G06A 4UR9A 3WTMA 1OEDB 2IC9A 3LBXA 4XZCA 2LSJA 4P1NA 3UU4A 1WFDA 3ZYLA 1SHZC 3ZCIA 3K3NA 1XZYA 3OKQA 2UUCT 2KWHA 2HN1A 2Y54A 3LK3B 3ETUA 5LGTB 5KZUA 4KHPT 5JH7E 3FXEB 4NXNT 3AE4A 1MIWA 4LFBT 4ISSA 2LEHA 4ALXA 5LOVE 4PJMA 4V1Av 2WB5A 2LLYA 2X00A 4GKJT 3UUXB 4HFBA 5JDGA 5H6RB 2K5BB 2W2UA 3DP7A 3ZMVB 3SRZA 5AFLA 4DVDA 1XDPA 1XMOT 4E7SA 5L3GB 3OPCA 3UUMA 3OTOT 2XAFB 5M4YA 4G63A 5LXBA 1YXRA 4H9PC 1J5WA 5FJVA 2YN6A 4DR4T 4N78D 4DR3T 4CI1B 2YEVC 1UV6A 2BG9E 2C0SA 1IJ6A 4QXCB 4TN7B 2WQYA 3MACA 2Q9QD 2XY8B 2LSIA 3HKBE 3IBPA 3ZDHA 4EOZB 2YOEA 3NKZA 1I6ZA 4PAGA 2Y7YA 3AE1A 5JDNA 4YJ2E 2IHR1 2N2NA 3RYCE 1FMVA 2E9XA 2YINA 4IE7A 5J5IA 4CI3B 4Z91A 4C90A 3VR9A 2J1DG 4LMKA 1CHUA 1G8XA 4DV3T 3EI0A 3IA3A 2D2SA 5AQRB 4LMLA 2UUAT 3N9MA 2KNDA 4HKAA 2LOSA 2XQ5A 1BR2A 2WDVA 2XQ9A 2CLYC 3ZMSB 2YU2A 3UTKA 1OEDE 5F8PA 2WNJA 4HFEA 4ILCA 4O8SA 4JI8T 3GN5B 3QB5K 2X9WA 3HI2A 3RC3A 3SIOA 3AB3B 5SYOA 3C51A 3TLVA 2XSBA 5HWXA 4QXHB 4A97A 4D01A 4UM3A 2V1DB 2BJ0A 1CUNA 3ZN1B 5HXEA 3UULA 2DCFA 1QLBA 4TNVA 4WYVA 4BAYB 5AQTB 2CCQA 4TNWA 3ZC0A 3M65A 4UELA 5BW2A 1HNWT 3O1IA 1UX4A 5AFMB 5LGNB 3HKEE 2WNLA 5LJNA 3LBXB 1N36T 1M62A 5IYZE 5DABA 3BQKA 1N33T 4ISTA 3N2KE 3OYZA 2XAGB 2X9HA 4IL4A 2NOXA 3N5LA 3AA6B 4EZ1A 3PU3A 2OV9A 4TX5A 3KV6A 2PGZA 3UT5E 4YXDA 3HA4A 5LNKA 3H3MA 5BMVE 3D0TA 4PW8A 4HE8A 5LP6E 3ABVA 5JDFA 2KT9A 4HFDA 4HFCA 4PK4A 2BR8A 2XQ6A 3PE0A 2WU2A 2Y6XA 5LHIB 2EHOA 5CA0E 4DUYT 4DR6T 4AFTA 3AEAA 1V9DA 5EZYE 1MIYA 4UF0B 1R8IA 4HTEA 4YT0A 4GK0E 2ZLYA 4B3MT 4LF6T 3RKGA 3T1YT 3ZDGA 1U5PA 4AQGA 3IHRA 2XJ7A 2FJEA 2IC6A 5FL0A 5JRCA 3RHWA 4IDQA 2VVSA 4B6XA 3AE7A 2E9XC 4DUZT 4HWDA 1UURA 2MBGA 5FVKA 4EZ4A 3ZSSA 3L09A 5ABGA 2BYNA 2JQ9A 3GUAA 2PG8A 3EUHA 5HCJA 4HFVA 2ACZA 2UXXB 3I0OA 3ONLC 3L39A 5BR8T 5L3FB 4HWFA 5JR9B 4EZHA 2FJBA 2KXPB 3ONXA 4ADZA 2QA7A 4PJJA 3JCFA 2BKNA 2W8FA 1YKHB 4KUMB 4X20E 4IDPA 4H9OC 3WTOA 2FUPA 1MNEA 2LE8A 4F6RC 1SE7A 1WR6A 3CX6B 1HF8A 2V6XA 4O2BE 3WIPA 3BK9A 4L9IA 2V7KA 4IE0A 1XWMA 3F31A 5KMGP 3VKHA 4PK6A 3JC6C 3PUWF 4YTNA 4XAXB 2D5UA 3PUSA 2CHNA 2YDSA 2XZ6A 3L8RA 4X65T 2J47A 5LGUB 1D1AA 3I9WA 4AXPA 2XHEB 3AEDA 1Z0PA 4TWFA 2HH7A 3SFEA 5HXCA 3CKDA 3PJAA 5LG4A 3PJAJ 3UFGA 4UVAB 4ZI7E 3A7MA 2X0YA 3N2OA 2KWIB 4WV9A 3ZLIA 1D1CA 4JBWF 1LKXA 1I94T 4CN6A 2MTQA 2X00D 5JVDE 4CXWA 4UXNB 4GK5E 2XZ5A 2BVLA 4A5XA 2HPLA 1IJ5A 1FEWA 1G73A 1W09A 5FXWA 2Z6EA 1NEKA 3Q5XA 2XSAA 4DR5T 4GYRA 2EHOB 5FY1A 2XTLA 2KMFA 4IT4A 2WN9A 3MZKB 2Y48B 2WNCA 5HXSA 5AFKA 3WI3A 4ZOLE 2X68A 5KE4A 2BZBA 5AQKB 3AE9A 4EEBA 3PDYA 2E8IA 3CQXC 3VU7H 2XYTA 1HTJF 4QKNA 2PTFA 4TUYE 3VR8A 4CXYA 3MJXA 5KDMC 3N2GE 3PV0F 2H3RA 5ABHA 1S35A 3AE5A 2NW8A 5CO5A 5LB7B 3ZJ2A 4TV9E 4JI5T 1YD8G 3RI5A 5IWAT 5LG3A 2VL8A 5FY7A 5J1GA 2WDRA 3LSVA 4LF5T 3WTNA 1KNPA 4QWNB 4ASKA 5AQFB 4I43B 2VK9A 2BVMA 4HGAA 2VKJA 4AQFC 3TLSA 2NP9A 4YTMA 3ESLA 3AA1B 5DQVA 2A3DA 3U8KA 1IZNB 3FHNA 3ZSTA 2YK0A 1SA0E 4ERRA
chains in the Genus database with same CATH topology
2XQ8A 4EZ1A 5AFMA 3WTOA 2PGZA 3WTMA 1OEDB 4FRRA 4ZK1A 5J5IA 4A98A 4Z91A 2LKGA 3UU4A 1I9BA 2UZ6A 5HCMA 4UY2A 3T4MA 4BQTA 5HEUA 2WN9A 3C79A 3RQUA 2ZJUA 4LMKA 5AFHA 3WIPA 4ZZCA 4QH5A 2PH9A 2WNCA 2YKSA 2Y54A 3U8LA 5AFKA 2Y56A 4HFDA 3EI0A 3EHZA 3RIFA 5J5HA 5KE4A 4IREA 4HFCA 4HQPA 2BR8A 5JMEA 5KZUA 2XQ6A 3SQ6A 4ZK4A 2MAWA 2LM2A 2XYTA 5HEOA 4PIRA 4UXUA 4XK9A 3WTJA 3WTHA 3P4WA 1OEDA 4LMLA 5HEJA 2XNTA 4AFGA 2BG9A 3U8JA 2XNUA 4NZBA 4ALXA 4QACA 3UUBA 3WTIA 4AFTA 2LLYA 2BG9B 4ZR6A 2X00A 2XQ5A 4LMJA 4X5TA 2M6IA 2Y57A 4HFBA 2XQ9A 4QH1A 2BYPA 2ZJVA 2BYSA 2XZ6A 1OEDE 2XQ7A 4Z90A 5J5FA 2WNJA 4HFEA 4ILCA 4QH4A 5AFLA 5CO5A 4B5DA 3SIOA 2QC1B 3UQ7A 2C9TA 4COFA 2XNVA 3ZDGA 4TWFA 2YMDA 5SYOA 3RI5A 3TLVA 4AFHA 4ILAA 4A97A 5LG3A 5L47A 4UM3P 4D01A 4UM3A 3RHWA 2BJ0A 2WZYA 3PEOA 5LXBA 1OEDC 5IUXA 3C84A 2KSRA 4BFQA 4QAAA 5AINA 3TLUA 3TLWA 4DBMA 3LSVA 5FJVA 3JAEA 4TNVA 4IL9A 2YN6A 3WTNA 4ZRUA 3EAMA 2W8GA 1UV6A 4ZJTA 2BG9E 5BP0A 3UQ4A 4TNWA 2M6BA 3U8NA 5AFNA 4HFIA 3JAFA 5J5GA 2BYRA 2XQ3A 3TLTA 5BW2A 2BYNA 5HEHA 2XQAA 5J0ZA 4HFHA 3GUAA 4WV9A 3UU3A 3WTLA 4TWDA 5HCJA 4ILBA 3IGQA 5BRXA 3UU5A 5AFJA 4QABA 2BYQA 3ZKRA 1UX2A 2LKHA 5L4EA 5AFMB 3WTKA 3TLSA 4TWHA 2X00D 2WNLA 2VL0A 3ZDHA 3JADA 2YOEA 2BG9C 2XZ5A 3SQ9A 2XQ4A 5HEGA 5TVCA 4ZZBA 1UW6A 5L4HA 3UU6A 4XHEA 3SH1A 4UM1A 3UU8A 2YMEA 4UM3S 3U8KA 2XYSA 3RQWA 3U8MA 2Y7YA 4ZJSA 2BR7A 3PMZA 2W8FA 3P50A 4IL4A 4NPPA 3RIAA 5CFBA 4F8HA 2Y58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ8 A;  4EZ1 A;  5AFM A;  3WTO A;  2PGZ A;  3WTM A;  1OED B;  4FRR A;  4ZK1 A;  5J5I A;  4A98 A;  4Z91 A;  2LKG A;  3UU4 A;  1I9B A;  2UZ6 A;  5HCM A;  4UY2 A;  3T4M A;  4BQT A;  5HEU A;  2WN9 A;  3C79 A;  3RQU A;  2ZJU A;  4LMK A;  5AFH A;  3WIP A;  4ZZC A;  4QH5 A;  2PH9 A;  2WNC A;  2YKS A;  2Y54 A;  3U8L A;  5AFK A;  2Y56 A;  4HFD A;  3EI0 A;  3EHZ A;  3RIF A;  5J5H A;  5KE4 A;  4IRE A;  4HFC A;  4HQP A;  2BR8 A;  5JME A;  5KZU A;  2XQ6 A;  3SQ6 A;  4ZK4 A;  2MAW A;  2LM2 A;  2XYT A;  5HEO A;  4PIR A;  4UXU A;  4XK9 A;  3WTJ A;  3WTH A;  3P4W A;  1OED A;  4LML A;  5HEJ A;  2XNT A;  4AFG A;  2BG9 A;  3U8J A;  2XNU A;  4NZB A;  4ALX A;  4QAC A;  3UUB A;  3WTI A;  4AFT A;  2LLY A;  2BG9 B;  4ZR6 A;  2X00 A;  2XQ5 A;  4LMJ A;  4X5T A;  2M6I A;  2Y57 A;  4HFB A;  2XQ9 A;  4QH1 A;  2BYP A;  2ZJV A;  2BYS A;  2XZ6 A;  1OED E;  2XQ7 A;  4Z90 A;  5J5F A;  2WNJ A;  4HFE A;  4ILC A;  4QH4 A;  5AFL A;  5CO5 A;  4B5D A;  3SIO A;  2QC1 B;  3UQ7 A;  2C9T A;  4COF A;  2XNV A;  3ZDG A;  4TWF A;  2YMD A;  5SYO A;  3RI5 A;  3TLV A;  4AFH A;  4ILA A;  4A97 A;  5LG3 A;  5L47 A;  4UM3 P;  4D01 A;  4UM3 A;  3RHW A;  2BJ0 A;  2WZY A;  3PEO A;  5LXB A;  1OED C;  5IUX A;  3C84 A;  2KSR A;  4BFQ A;  4QAA A;  5AIN A;  3TLU A;  3TLW A;  4DBM A;  3LSV A;  5FJV A;  3JAE A;  4TNV A;  4IL9 A;  2YN6 A;  3WTN A;  4ZRU A;  3EAM A;  2W8G A;  1UV6 A;  4ZJT A;  2BG9 E;  5BP0 A;  3UQ4 A;  4TNW A;  2M6B A;  3U8N A;  5AFN A;  4HFI A;  3JAF A;  5J5G A;  2BYR A;  2XQ3 A;  3TLT A;  5BW2 A;  2BYN A;  5HEH A;  2XQA A;  5J0Z A;  4HFH A;  3GUA A;  4WV9 A;  3UU3 A;  3WTL A;  4TWD A;  5HCJ A;  4ILB A;  3IGQ A;  5BRX A;  3UU5 A;  5AFJ A;  4QAB A;  2BYQ A;  3ZKR A;  1UX2 A;  2LKH A;  5L4E A;  5AFM B;  3WTK A;  3TLS A;  4TWH A;  2X00 D;  2WNL A;  2VL0 A;  3ZDH A;  3JAD A;  2YOE A;  2BG9 C;  2XZ5 A;  3SQ9 A;  2XQ4 A;  5HEG A;  5TVC A;  4ZZB A;  1UW6 A;  5L4H A;  3UU6 A;  4XHE A;  3SH1 A;  4UM1 A;  3UU8 A;  2YME A;  4UM3 S;  3U8K A;  2XYS A;  3RQW A;  3U8M A;  2Y7Y A;  4ZJS A;  2BR7 A;  3PMZ A;  2W8F A;  3P50 A;  4IL4 A;  4NPP A;  3RIA A;  5CFB A;  4F8H A;  2Y58 A; 
#chains in the Genus database with same CATH topology
 1ZP0 A;  4ZK1 A;  5F5W A;  3NVO A;  4B3R T;  2CHO A;  3IEE A;  5L3C B;  5FNV E;  1HR0 T;  2LSY A;  1L0V A;  2CBJ A;  3LK2 B;  4HQP A;  4E7Z A;  4OYJ A;  3ZJ1 A;  4LF7 T;  3AAE B;  2A72 A;  3WAK A;  3MA9 A;  4CZZ B;  4QAC A;  3KVB A;  3ZT5 A;  1O3X A;  2Y57 A;  1HX1 B;  4DID B;  1NEN A;  2VKD A;  2BYS A;  4WZX A;  1ZKE A;  3LJC A;  4AKG A;  1HCI A;  1US7 B;  3VRB A;  3KV4 A;  4UM3 P;  3ZPO A;  4NXM T;  5JDM A;  2E5V A;  2CBI A;  5L3B B;  2OA5 A;  3U8N A;  3KV5 A;  2JPF A;  3WAJ A;  4ZI2 D;  1VRB A;  2WZI A;  3NBX X;  2QRX A;  2EHO D;  3RF1 A;  4UIG A;  4U7I A;  4YSX A;  4GKK T;  4PNI A;  5HEG A;  4EIW A;  2K48 A;  4O4J E;  5E0O A;  3LK4 2;  3RIA A;  5FMN A;  2JQK A;  2D0U A;  2VVN A;  5J2T E;  4A98 A;  2PJQ A;  4IHJ E;  1KNZ A;  1Y01 A;  3RRC A;  2C5I T;  3OYX A;  5EK3 A;  5ABE A;  3HR0 A;  1WR0 A;  2WSS V;  3LG7 A;  3U8L A;  3AA7 B;  3SFD A;  3EHZ A;  3RIF A;  1VCT A;  2IW5 B;  3F2E A;  1JNR A;  4MAL A;  3QK6 A;  3UUB A;  3CML A;  4YHH T;  4DV6 T;  1WYC A;  4JI2 T;  1NAF A;  2LSK A;  5J5F A;  3N9Q A;  3PUG A;  1D1B A;  4DR1 T;  2QC1 B;  4DBQ A;  2YMD A;  2HPJ A;  1KNR A;  3HKC E;  3SOL A;  3AEB A;  4PFO A;  2W61 A;  3AEC A;  3TLW A;  4DND A;  4U31 A;  4BJM A;  4LFC T;  1S94 A;  4ZRU A;  3EAM A;  3U3I A;  2F4V T;  2JMH A;  1ZHC A;  4U7Y A;  2VAS A;  1BR0 A;  5AQG B;  3PUQ A;  4AKL A;  3ZKR A;  3VHL A;  2V7I A;  3ZYM A;  3LDQ B;  3RX6 A;  2CLY B;  2BBH A;  2FJD A;  3A8Y C;  5AQI B;  4DMV A;  3UU8 A;  5JRE A;  4GIW A;  4H9Q C;  1GQE A;  3NZP A;  1J1J A;  4IIJ E;  3TKL B;  3PMZ A;  4WBN E;  3ZT6 A;  2M67 A;  3P50 A;  1UK5 A;  4H9N C;  2ODU A;  4U74 A;  3AEG A;  4P0A A;  5LYJ E;  4HWI B;  1OXZ A;  5F3J A;  4YSZ A;  2L3L A;  5LXT E;  4ZZC A;  3C64 A;  3N9O A;  3CK6 A;  5J5H A;  5ADX L;  3U78 A;  1NWM X;  3WTJ A;  2MAW A;  4PIR A;  4C91 A;  2UXD T;  1LVK A;  3P4W A;  2XNT A;  4OHF A;  3S4U A;  2W67 A;  3WTI A;  4L5G A;  2HN2 A;  4DMW A;  2A9U A;  3MXZ A;  4ZI3 C;  2C5J A;  4OX9 T;  3VRA A;  3CQC B;  3CWZ B;  2WMN A;  2XAQ B;  2XQY A;  3E22 E;  2NW9 A;  5HXH A;  5TAO A;  1J5E T;  2LRL A;  5LA6 E;  3C98 B;  1LVF A;  4ILA A;  2V7L A;  3P4P A;  1D0Y A;  3B57 A;  3UUN A;  2JQQ A;  2X9X A;  5IHY A;  2B76 A;  1HNZ T;  3PUA A;  3ZEF B;  3F57 A;  2JRK A;  2W8G A;  3UQ4 A;  5J0Z A;  4ILB A;  4DV4 T;  1ZOY A;  5L4E A;  1U4Q A;  4JI6 T;  2W4X A;  1XMQ T;  2OLT A;  2VL0 A;  3O1H A;  2YDR A;  3QC9 A;  3SQ9 A;  1IBM T;  2AE9 A;  2XM2 A;  4CI2 B;  4UM1 A;  3EAB A;  2YME A;  3FZF B;  3E0Z A;  1T72 A;  1JNZ A;  3CVR A;  5KXJ A;  5H6Q B;  1VCS A;  2A2F X;  5L3E B;  1KK7 A;  4JI7 T;  2VUR A;  4YJ3 E;  5J2U E;  5AQH B;  2E9X B;  3KDS E;  5HCM A;  2BDE A;  5JR9 C;  3ZT7 A;  1HFA A;  2VB6 A;  4L0R A;  3PU8 A;  2XAJ B;  4AFG A;  2BG9 A;  4NZB A;  3K3Q C;  5AFU L;  4LMJ A;  4X5T A;  5JTG A;  5FP3 A;  1WLX A;  4HWH A;  2AXD S;  2WBL A;  1AJ3 A;  4AQF A;  4MLK A;  5EK4 A;  4YSY A;  3OBV E;  3HKD E;  3AE3 A;  4WW0 A;  4JUY A;  2ZM0 A;  4J2C A;  2JQH A;  5HWY A;  5LBM A;  1ZV4 X;  3C84 A;  3ANW A;  2KSR A;  4YHJ A;  1Y64 B;  2G0U A;  3I0Q A;  2FJA A;  4EV6 A;  3KVA A;  2K24 A;  3R6N A;  5BP0 A;  4PJL A;  5J5G A;  5HEH A;  4TV8 E;  3WTL A;  2XUE A;  5BRX A;  3Q9D A;  2CA5 A;  4K0U A;  3WTK A;  2WCA A;  5CGM A;  3K1S A;  2WWV A;  3DTO A;  2UXB T;  2D0T A;  2I0M A;  3PUZ F;  2NTY A;  3RYF E;  2H7O A;  5LMU T;  2V26 A;  2XQ8 A;  4LF8 T;  3H3A A;  2SPC A;  4AKH A;  2RPA A;  2N1G A;  3AAI A;  4KHZ F;  3GMI A;  3Q5E A;  3SQ6 A;  2V5D A;  5HEO A;  2BBJ A;  5LHG B;  4HN9 A;  4K0K T;  3U8J A;  2X9Y A;  4OFZ A;  1QSD A;  3RPU A;  4U2Y A;  3OVU A;  2XM1 A;  4X1K E;  4M1P A;  4G2A A;  5AQN B;  2XPK A;  2LM9 A;  5ETW A;  3FBZ A;  3Q5W A;  4H63 H;  2C9T A;  4COF A;  3KFW X;  3P4S A;  1YQ4 A;  3QOF A;  2DNX A;  2V8S V;  4MFR A;  5JRC B;  1Z8U A;  1FIO A;  1B7T A;  2Q9Q C;  4JLE A;  5CA1 E;  4ANJ A;  2WM9 A;  3ZMT B;  5L3D B;  5CJ5 A;  3FZM B;  4BJN A;  3N9P A;  5LJM A;  4B3T T;  4QAB A;  3AXJ A;  2E9X D;  1YW0 A;  2CPT A;  2BG9 C;  2VQF T;  5L4H A;  5L2L A;  3EDV A;  4ZJS A;  4HEA A;  2VWA A;  4I0U A;  4NPP A;  2V5C A;  4U2Z A;  3RH3 A;  4UV9 B;  2DI4 A;  4LF4 T;  3GA8 A;  2UZ6 A;  4PK5 A;  4UY2 A;  4BQT A;  5JDL A;  3C4X A;  5AQL B;  4I55 E;  5AQO B;  2V7M A;  4Q25 A;  2WS3 A;  5FXX A;  4LF9 T;  4QXB B;  5AQU B;  2ZMA A;  5JDQ A;  3GN5 A;  2XQ7 A;  4Z90 A;  2NTX A;  3AVR A;  4CN4 A;  4IE4 A;  4B5D A;  1WRD A;  4EGW A;  4YFS A;  3T1H T;  3JC6 D;  4ZS3 A;  4NIQ A;  2CE7 A;  2KZ7 B;  2CM0 A;  2MPK A;  2L8K A;  4O4L E;  1OED C;  3ZC1 A;  3LFM A;  4BFQ A;  3TLU A;  3RYI E;  3O4X E;  1W0B A;  4H9R C;  2CRB A;  3J9X 1;  1SUM B;  5AQV B;  2M6B A;  3I9Y A;  3CPZ A;  4WBO A;  5HAX A;  2JJ9 A;  3PTR B;  4FJO A;  4A56 A;  1XNQ T;  4NUU A;  2IAK A;  4TZ4 C;  4UV8 B;  4GOU A;  5EK2 A;  2WWU A;  3P4R A;  4JI1 T;  4KX6 A;  4UVB B;  1XDO A;  1HNX T;  1XNR T;  3P7I A;  5TVC A;  4DBR A;  2E2A A;  4NUV A;  3RLF F;  4QHO A;  3QUJ A;  4YLH A;  3RIU A;  4DV2 T;  2Y58 A;  5HXR A;  4U72 A;  3FZH B;  4CXX A;  2H89 A;  5FXV A;  1I9B A;  3KV9 A;  5CB4 E;  2CXF A;  2ZJU A;  3QB5 A;  4QH5 A;  4GYS A;  2YKS A;  2Y56 A;  1BR4 A;  2X67 A;  3CX7 B;  2FBW A;  4ILU A;  4P0B A;  5FVL A;  2BS2 A;  3KIN B;  4YTP A;  4XK9 A;  1N32 T;  4CQI A;  1BR1 A;  3AEF A;  5DQW A;  4UF0 A;  4QX8 B;  2UXN B;  4H9S E;  4DR2 T;  2KIN B;  5FKY A;  2J62 A;  3GWH A;  3P4Q A;  2R6G F;  5C2T A;  5JDH A;  4MBQ A;  5AQM B;  3UQ7 A;  1IBK T;  5FYM A;  2YDQ A;  2WU5 A;  2H88 A;  2WZY A;  2QYW A;  3AXJ B;  5AQP B;  4DBM A;  5AIN A;  3MKD A;  2Y8D A;  3H37 A;  3T8O A;  4EYY R;  4HFI A;  4DV7 T;  2XQA A;  4DV1 T;  3C4W A;  3PUY F;  2CEA A;  4KBM B;  3UU3 A;  2ACX A;  4DV5 T;  1UX2 A;  5JR9 A;  3FZK B;  2DLR A;  3AAA B;  3NWI A;  2XYS A;  3RQW A;  3ONJ A;  5DJQ C;  2BR7 A;  1N34 T;  4AQY T;  2L9Q A;  1YKE B;  4JI3 T;  4ZS2 A;  5C8Y E;  2QVA A;  4IDO A;  2ZM6 T;  2CWO A;  3O9X A;  3P8C D;  3I1A A;  1ZEE A;  3RQU A;  1E1H B;  4X64 T;  2PH9 A;  4I50 E;  1UUS A;  2GK9 A;  2LM2 A;  5A1L A;  3Q5D A;  2XNU A;  4U33 A;  1MIV A;  4UEM A;  1D0X A;  3RRW A;  3IF8 B;  3NRX A;  4QH1 A;  2ZJV A;  2RP4 A;  2PFV A;  2LRK A;  2VKO A;  3FZL B;  2ZM2 A;  4XBF B;  2UXC T;  4JI0 T;  3RGL A;  1UGO A;  3B13 A;  5L47 A;  4B3S T;  2N9D A;  5IUX A;  2WP9 A;  3RIU C;  3R84 B;  3JAE A;  4BA9 A;  4AKR B;  2HHH T;  3VKG A;  3PUV F;  2DWK A;  1H7C A;  5ABF A;  3SS1 A;  2XQ3 A;  3TLT A;  3AE2 A;  3KBT A;  4FI5 A;  3IGQ A;  2H7V C;  2BYQ A;  3ZCJ A;  2X0L B;  2ZM8 A;  5JQG E;  2D9D A;  3SH1 A;  3UU6 A;  4OK0 A;  1M7K A;  3Q2M A;  5HYA A;  4ZEY A;  2NR4 A;  4DO0 A;  4IE5 A;  4X1I E;  2VQE T;  2XAH B;  1IBL T;  1KEY A;  4IE6 A;  4X1Y E;  4O4I E;  3C79 A;  3B5M A;  1VOM A;  4EYU A;  2IDO B;  2DHR A;  3CQG B;  3RYH E;  3DJB A;  4IRE A;  2RA1 A;  4IDZ A;  3M3Z B;  3WTH A;  1WCR A;  1X9B A;  2V6Y A;  2E5L T;  2YU1 A;  4PFP A;  2Q9Q A;  3O1J A;  1T8B A;  1MMN A;  2P9B A;  4QH4 A;  2CMR A;  1HS7 A;  1MND A;  1HG2 A;  3PUX F;  3FBL A;  4HWC A;  4OYK A;  1E7P A;  1OWA A;  4ZHQ E;  4QAA A;  1DU2 A;  2C5K T;  2K9A A;  3L3P A;  3J7Y q;  1KF6 A;  3EVY A;  4X66 T;  2LJL A;  2LHR A;  3HL6 A;  4HFH A;  4H63 V;  2NW7 A;  2I6H A;  3UU5 A;  5AFJ A;  2XZE A;  2NWB A;  5FXZ A;  2W0G A;  4TWH A;  2X66 A;  5LCY A;  5LHH B;  4EED A;  2UU9 T;  3QNU A;  3V5S A;  3JAD A;  1FJG T;  4X62 T;  4AI6 A;  4UVC B;  2WZH A;  3AA0 B;  1UX5 A;  3KBU A;  4JV5 T;  3ZMZ B;  2X51 A;  5C3J A;  2VKH A;  1T98 A;  4FRR A;  3AE6 A;  4KP3 C;  3T4M A;  2W63 A;  5AFH A;  2UUB T;  4IDN A;  1LRZ A;  2WMO A;  2BKO A;  3RC8 A;  1OED A;  5HEJ A;  1HG5 A;  2B1E A;  3CIR A;  2PBI A;  4ZR6 A;  2M6I A;  2W66 A;  3CX8 B;  2BYP A;  4KI0 F;  2BS3 A;  2LOP A;  1FMW A;  5FY0 A;  4JYA T;  3AE8 A;  5ABF B;  5LMN T;  4JI4 T;  2XNV A;  3BQI A;  4EXT A;  1YQ3 A;  1T7S A;  4AFH A;  4ZI3 D;  2IIU A;  5AQQ B;  4ZI2 C;  3PEO A;  2CWY A;  4O2A E;  2EHO C;  3N9N A;  4IL9 A;  4P09 A;  1EZ3 A;  1MMG A;  3JAF A;  2BYR A;  4JEH B;  3NRY A;  2W62 A;  2IML A;  2IUB A;  2BS4 A;  4AIS A;  1W9R A;  2LKH A;  2JMK A;  3ZYK A;  1MMA A;  2W00 A;  3PUR A;  2XQ4 A;  3C50 A;  4ZZB A;  1UW6 A;  1IAP A;  3UFE A;  2WY2 A;  5LBQ B;  4UM3 S;  2K3W A;  4JEU B;  1WYB A;  3ETV A;  1D0Z A;  4MHC A;  4O4H E;  4LFA T;  3ZN0 B;  1KFY A;  2V6Y B;  2J4G A;  2KLQ A;  2LKG A;  2ODV A;  2QGS A;  4QX7 B;  2Q9Q B;  5HEU A;  3BQL A;  1HX8 A;  2WAU A;  5JME A;  2MYS A;  4DV0 T;  4AKI A;  3W15 B;  4ZK4 A;  3X1D A;  4UXU A;  1MMD A;  4EB6 E;  3V5U A;  3SWH A;  3K3O A;  4ZXL A;  2BG9 B;  4Z8X A;  2X0H A;  3MK7 C;  4IGU A;  4AIU A;  4U3C A;  2CXL A;  2XAS B;  5FL1 A;  1UCU A;  3EDU A;  3K8P C;  3RKO A;  3NZQ A;  1W0A A;  5AQJ B;  3AVS A;  2MOZ A;  2V7J A;  4YY3 T;  2DWG A;  2JIW A;  3OJA A;  5GON E;  3ANW B;  4EAH A;  3ZMU B;  1E2A A;  2WDQ A;  2LHN A;  3FXD B;  4ZJT A;  5AFN A;  2LT3 A;  3E08 A;  4TWD A;  4PJN A;  3A5X A;  4KMC A;  4DR7 T;  2ES0 A;  1X79 A;  5AQS B;  5KX5 E;  2BKP A;  3AEE A;  2LSG A;  4I4T E;  4CN1 A;  4XHE A;  3N9L A;  3C4Z A;  2CXD A;  3U8M A;  4WNK A;  2DL1 A;  5CFB A;  4F8H A;  1QUU A;  5AFM A;  3FB2 A;  2I59 A;  3G06 A;  4UR9 A;  3WTM A;  1OED B;  2IC9 A;  3LBX A;  4XZC A;  2LSJ A;  4P1N A;  3UU4 A;  1WFD A;  3ZYL A;  1SHZ C;  3ZCI A;  3K3N A;  1XZY A;  3OKQ A;  2UUC T;  2KWH A;  2HN1 A;  2Y54 A;  3LK3 B;  3ETU A;  5LGT B;  5KZU A;  4KHP T;  5JH7 E;  3FXE B;  4NXN T;  3AE4 A;  1MIW A;  4LFB T;  4ISS A;  2LEH A;  4ALX A;  5LOV E;  4PJM A;  4V1A v;  2WB5 A;  2LLY A;  2X00 A;  4GKJ T;  3UUX B;  4HFB A;  5JDG A;  5H6R B;  2K5B B;  2W2U A;  3DP7 A;  3ZMV B;  3SRZ A;  5AFL A;  4DVD A;  1XDP A;  1XMO T;  4E7S A;  5L3G B;  3OPC A;  3UUM A;  3OTO T;  2XAF B;  5M4Y A;  4G63 A;  5LXB A;  1YXR A;  4H9P C;  1J5W A;  5FJV A;  2YN6 A;  4DR4 T;  4N78 D;  4DR3 T;  4CI1 B;  2YEV C;  1UV6 A;  2BG9 E;  2C0S A;  1IJ6 A;  4QXC B;  4TN7 B;  2WQY A;  3MAC A;  2Q9Q D;  2XY8 B;  2LSI A;  3HKB E;  3IBP A;  3ZDH A;  4EOZ B;  2YOE A;  3NKZ A;  1I6Z A;  4PAG A;  2Y7Y A;  3AE1 A;  5JDN A;  4YJ2 E;  2IHR 1;  2N2N A;  3RYC E;  1FMV A;  2E9X A;  2YIN A;  4IE7 A;  5J5I A;  4CI3 B;  4Z91 A;  4C90 A;  3VR9 A;  2J1D G;  4LMK A;  1CHU A;  1G8X A;  4DV3 T;  3EI0 A;  3IA3 A;  2D2S A;  5AQR B;  4LML A;  2UUA T;  3N9M A;  2KND A;  4HKA A;  2LOS A;  2XQ5 A;  1BR2 A;  2WDV A;  2XQ9 A;  2CLY C;  3ZMS B;  2YU2 A;  3UTK A;  1OED E;  5F8P A;  2WNJ A;  4HFE A;  4ILC A;  4O8S A;  4JI8 T;  3GN5 B;  3QB5 K;  2X9W A;  3HI2 A;  3RC3 A;  3SIO A;  3AB3 B;  5SYO A;  3C51 A;  3TLV A;  2XSB A;  5HWX A;  4QXH B;  4A97 A;  4D01 A;  4UM3 A;  2V1D B;  2BJ0 A;  1CUN A;  3ZN1 B;  5HXE A;  3UUL A;  2DCF A;  1QLB A;  4TNV A;  4WYV A;  4BAY B;  5AQT B;  2CCQ A;  4TNW A;  3ZC0 A;  3M65 A;  4UEL A;  5BW2 A;  1HNW T;  3O1I A;  1UX4 A;  5AFM B;  5LGN B;  3HKE E;  2WNL A;  5LJN A;  3LBX B;  1N36 T;  1M62 A;  5IYZ E;  5DAB A;  3BQK A;  1N33 T;  4IST A;  3N2K E;  3OYZ A;  2XAG B;  2X9H A;  4IL4 A;  2NOX A;  3N5L A;  3AA6 B;  4EZ1 A;  3PU3 A;  2OV9 A;  4TX5 A;  3KV6 A;  2PGZ A;  3UT5 E;  4YXD A;  3HA4 A;  5LNK A;  3H3M A;  5BMV E;  3D0T A;  4PW8 A;  4HE8 A;  5LP6 E;  3ABV A;  5JDF A;  2KT9 A;  4HFD A;  4HFC A;  4PK4 A;  2BR8 A;  2XQ6 A;  3PE0 A;  2WU2 A;  2Y6X A;  5LHI B;  2EHO A;  5CA0 E;  4DUY T;  4DR6 T;  4AFT A;  3AEA A;  1V9D A;  5EZY E;  1MIY A;  4UF0 B;  1R8I A;  4HTE A;  4YT0 A;  4GK0 E;  2ZLY A;  4B3M T;  4LF6 T;  3RKG A;  3T1Y T;  3ZDG A;  1U5P A;  4AQG A;  3IHR A;  2XJ7 A;  2FJE A;  2IC6 A;  5FL0 A;  5JRC A;  3RHW A;  4IDQ A;  2VVS A;  4B6X A;  3AE7 A;  2E9X C;  4DUZ T;  4HWD A;  1UUR A;  2MBG A;  5FVK A;  4EZ4 A;  3ZSS A;  3L09 A;  5ABG A;  2BYN A;  2JQ9 A;  3GUA A;  2PG8 A;  3EUH A;  5HCJ A;  4HFV A;  2ACZ A;  2UXX B;  3I0O A;  3ONL C;  3L39 A;  5BR8 T;  5L3F B;  4HWF A;  5JR9 B;  4EZH A;  2FJB A;  2KXP B;  3ONX A;  4ADZ A;  2QA7 A;  4PJJ A;  3JCF A;  2BKN A;  2W8F A;  1YKH B;  4KUM B;  4X20 E;  4IDP A;  4H9O C;  3WTO A;  2FUP A;  1MNE A;  2LE8 A;  4F6R C;  1SE7 A;  1WR6 A;  3CX6 B;  1HF8 A;  2V6X A;  4O2B E;  3WIP A;  3BK9 A;  4L9I A;  2V7K A;  4IE0 A;  1XWM A;  3F31 A;  5KMG P;  3VKH A;  4PK6 A;  3JC6 C;  3PUW F;  4YTN A;  4XAX B;  2D5U A;  3PUS A;  2CHN A;  2YDS A;  2XZ6 A;  3L8R A;  4X65 T;  2J47 A;  5LGU B;  1D1A A;  3I9W A;  4AXP A;  2XHE B;  3AED A;  1Z0P A;  4TWF A;  2HH7 A;  3SFE A;  5HXC A;  3CKD A;  3PJA A;  5LG4 A;  3PJA J;  3UFG A;  4UVA B;  4ZI7 E;  3A7M A;  2X0Y A;  3N2O A;  2KWI B;  4WV9 A;  3ZLI A;  1D1C A;  4JBW F;  1LKX A;  1I94 T;  4CN6 A;  2MTQ A;  2X00 D;  5JVD E;  4CXW A;  4UXN B;  4GK5 E;  2XZ5 A;  2BVL A;  4A5X A;  2HPL A;  1IJ5 A;  1FEW A;  1G73 A;  1W09 A;  5FXW A;  2Z6E A;  1NEK A;  3Q5X A;  2XSA A;  4DR5 T;  4GYR A;  2EHO B;  5FY1 A;  2XTL A;  2KMF A;  4IT4 A;  2WN9 A;  3MZK B;  2Y48 B;  2WNC A;  5HXS A;  5AFK A;  3WI3 A;  4ZOL E;  2X68 A;  5KE4 A;  2BZB A;  5AQK B;  3AE9 A;  4EEB A;  3PDY A;  2E8I A;  3CQX C;  3VU7 H;  2XYT A;  1HTJ F;  4QKN A;  2PTF A;  4TUY E;  3VR8 A;  4CXY A;  3MJX A;  5KDM C;  3N2G E;  3PV0 F;  2H3R A;  5ABH A;  1S35 A;  3AE5 A;  2NW8 A;  5CO5 A;  5LB7 B;  3ZJ2 A;  4TV9 E;  4JI5 T;  1YD8 G;  3RI5 A;  5IWA T;  5LG3 A;  2VL8 A;  5FY7 A;  5J1G A;  2WDR A;  3LSV A;  4LF5 T;  3WTN A;  1KNP A;  4QWN B;  4ASK A;  5AQF B;  4I43 B;  2VK9 A;  2BVM A;  4HGA A;  2VKJ A;  4AQF C;  3TLS A;  2NP9 A;  4YTM A;  3ESL A;  3AA1 B;  5DQV A;  2A3D A;  3U8K A;  1IZN B;  3FHN A;  3ZST A;  2YK0 A;  1SA0 E;  4ERR A; 
#chains in the Genus database with same CATH homology
 2XQ8 A;  4EZ1 A;  5AFM A;  3WTO A;  2PGZ A;  3WTM A;  1OED B;  4FRR A;  4ZK1 A;  5J5I A;  4A98 A;  4Z91 A;  2LKG A;  3UU4 A;  1I9B A;  2UZ6 A;  5HCM A;  4UY2 A;  3T4M A;  4BQT A;  5HEU A;  2WN9 A;  3C79 A;  3RQU A;  2ZJU A;  4LMK A;  5AFH A;  3WIP A;  4ZZC A;  4QH5 A;  2PH9 A;  2WNC A;  2YKS A;  2Y54 A;  3U8L A;  5AFK A;  2Y56 A;  4HFD A;  3EI0 A;  3EHZ A;  3RIF A;  5J5H A;  5KE4 A;  4IRE A;  4HFC A;  4HQP A;  2BR8 A;  5JME A;  5KZU A;  2XQ6 A;  3SQ6 A;  4ZK4 A;  2MAW A;  2LM2 A;  2XYT A;  5HEO A;  4PIR A;  4UXU A;  4XK9 A;  3WTJ A;  3WTH A;  3P4W A;  1OED A;  4LML A;  5HEJ A;  2XNT A;  4AFG A;  2BG9 A;  3U8J A;  2XNU A;  4NZB A;  4ALX A;  4QAC A;  3UUB A;  3WTI A;  4AFT A;  2LLY A;  2BG9 B;  4ZR6 A;  2X00 A;  2XQ5 A;  4LMJ A;  4X5T A;  2M6I A;  2Y57 A;  4HFB A;  2XQ9 A;  4QH1 A;  2BYP A;  2ZJV A;  2BYS A;  2XZ6 A;  1OED E;  2XQ7 A;  4Z90 A;  5J5F A;  2WNJ A;  4HFE A;  4ILC A;  4QH4 A;  5AFL A;  5CO5 A;  4B5D A;  3SIO A;  2QC1 B;  3UQ7 A;  2C9T A;  4COF A;  2XNV A;  3ZDG A;  4TWF A;  2YMD A;  5SYO A;  3RI5 A;  3TLV A;  4AFH A;  4ILA A;  4A97 A;  5LG3 A;  5L47 A;  4UM3 P;  4D01 A;  4UM3 A;  3RHW A;  2BJ0 A;  2WZY A;  3PEO A;  5LXB A;  1OED C;  5IUX A;  3C84 A;  2KSR A;  4BFQ A;  4QAA A;  5AIN A;  3TLU A;  3TLW A;  4DBM A;  3LSV A;  5FJV A;  3JAE A;  4TNV A;  4IL9 A;  2YN6 A;  3WTN A;  4ZRU A;  3EAM A;  2W8G A;  1UV6 A;  4ZJT A;  2BG9 E;  5BP0 A;  3UQ4 A;  4TNW A;  2M6B A;  3U8N A;  5AFN A;  4HFI A;  3JAF A;  5J5G A;  2BYR A;  2XQ3 A;  3TLT A;  5BW2 A;  2BYN A;  5HEH A;  2XQA A;  5J0Z A;  4HFH A;  3GUA A;  4WV9 A;  3UU3 A;  3WTL A;  4TWD A;  5HCJ A;  4ILB A;  3IGQ A;  5BRX A;  3UU5 A;  5AFJ A;  4QAB A;  2BYQ A;  3ZKR A;  1UX2 A;  2LKH A;  5L4E A;  5AFM B;  3WTK A;  3TLS A;  4TWH A;  2X00 D;  2WNL A;  2VL0 A;  3ZDH A;  3JAD A;  2YOE A;  2BG9 C;  2XZ5 A;  3SQ9 A;  2XQ4 A;  5HEG A;  5TVC A;  4ZZB A;  1UW6 A;  5L4H A;  3UU6 A;  4XHE A;  3SH1 A;  4UM1 A;  3UU8 A;  2YME A;  4UM3 S;  3U8K A;  2XYS A;  3RQW A;  3U8M A;  2Y7Y A;  4ZJS A;  2BR7 A;  3PMZ A;  2W8F A;  3P50 A;  4IL4 A;  4NPP A;  3RIA A;  5CFB A;  4F8H A;  2Y58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...