2XQ4A

Pentameric ligand gated ion channel glic in complex with tetramethylarsonium (tmas)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 75
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq4A01
5SYOA 2WN9A 4IREA 3TLTA 2M6BA 4X5TA 4HQPA 3WTNA 3UU4A 3SQ6A 4A98A 2LKGA 2ZJUA 2X00D 4HFIA 3RHWA 5L4HA 3RQUA 2ZJVA 3ZDHA 2XZ6A 2BYRA 5AFJA 4COFA 4IL4A 4ZRUA 3PEOA 4ZJTA 5AFHA 3ZDGA 5BW2A 2BG9E 2XQ8A 4UM3S 4XK9A 2XNVA 3WTMA 4UY2A 2XQ6A 5IUXA 2LKHA 3UQ4A 3U8NA 5HCJA 3ZKRA 4A97A 2MAWA 4HFDA 3JAEA 1OEDA 1OEDB 1UW6A 2XNUA 3JAFA 3SQ9A 2LM2A 1OEDC 4IL9A 3UU3A 5HCMA 1UV6A 3RIAA 3EI0A 5HEGA 3TLWA 2XYSA 2YKSA 3EAMA 5TVCA 4ZR6A 4ZK4A 4DBMA 4QH4A 2XQ3A 2BYQA 3SIOA 3LSVA 4EZ1A 2KSRA 2XQ7A 2WNJA 4D01A 2XQ9A 2XQAA 5LG3A 3UQ7A 3TLUA 3UUBA 2Y7YA 4UXUA 4ILBA 4AFGA 3U8MA 3WTOA 1OEDE 4QACA 2BR8A 3P4WA 3EHZA 2BYNA 4UM3P 5KE4A 2XQ4A 5J5FA 2BR7A 3WIPA 2PGZA 3WTHA 4NPPA 3WTKA 5HEOA 4LMJA 1UX2A 3UU6A 3UU8A 2YMDA 5CFBA 3RI5A 4QABA 4TWHA 4WV9A 5KZUA 4HFEA 4ZJSA 2X00A 3C84A 4TNVA 4UM3A 3SH1A 4ZK1A 4AFHA 4QAAA 3WTJA 4HFBA 2UZ6A 4ZZBA 4FRRA 2BJ0A 3JADA 2WNCA 2W8FA 2C9TA 4B5DA 4TWDA 5AFKA 2XYTA 4HFHA 2PH9A 3IGQA 5FJVA 2BYPA 4ALXA 2WZYA 4NZBA 2VL0A 2BYSA 2W8GA 5BP0A 2BG9B 3PMZA 3C79A 3RIFA 5AFLA 5J5HA 5AFNA 2XZ5A 3GUAA 4PIRA 5L47A 4AFTA 2XQ5A 2QC1B 5JMEA 4ILCA 4QH1A 4HFCA 2Y54A 2M6IA 5BRXA 2Y57A 4QH5A 2LLYA 5J5GA 5AINA 5J0ZA 4TWFA 2WNLA 3P50A 5AFMA 5AFMB 5CO5A 3U8KA 2XNTA 3WTIA 4BFQA 4LMLA 4TNWA 1I9BA 3UU5A 5LXBA 3TLVA 3U8LA 2YMEA 4UM1A 3WTLA 2Y58A 5J5IA 4Z90A 4LMKA 4XHEA 5HEHA 5HEUA 3TLSA 2BG9C 4Z91A 3RQWA 4F8HA 2YOEA 2BG9A 3U8JA 5HEJA 3T4MA 4ZZCA 5L4EA 4BQTA 2YN6A 2Y56A 4ILAA
chains in the Genus database with same CATH superfamily
4IE4A 3K8PC 1J1JA 1LVFA 2WDQA 2XHEB 4P0BA 2RA1A 2ZJVA 1MIWA 3ZDHA 1WYCA 2BYRA 3F57A 3PEOA 4H63V 2X0LB 4B3MT 3C51A 4EXTA 5J2TE 2Z6EA 5CGMA 3KV4A 4HE8A 3I0QA 5FY0A 3JAFA 2A9UA 5JDHA 2XAGB 2CLYB 4JLEA 3MACA 3OTOT 4JEHB 4D01A 5LG3A 2XAHB 3UQ7A 3UUBA 4UXUA 3WTOA 3ZMTB 2BVMA 5LYJE 4GKKT 4JI2T 2NWBA 3RI5A 4CI2B 1DU2A 2XZEA 3N9LA 4DV5T 4FRRA 4M1PA 2ZM0A 2PH9A 3IGQA 4IE5A 2DL1A 1JNRA 4IE7A 3HKEE 4XBFB 1ZV4X 1Y64B 1XDPA 4B3TT 4CN4A 3ZCJA 4QWNB 3P50A 2YDQA 2KLQA 4DV6T 1E2AA 4JI4T 2CRBA 4LMKA 3PUZF 3N9OA 4JYAT 5HEJA 3ZYLA 5L4EA 1ZEEA 1L0VA 3HA4A 4YTNA 5C8YE 2NTYA 4HKAA 4ZI2D 4AQFC 2D9DA 4JV5T 2NW8A 5JQGE 5LP6E 5HYAA 2VKJA 2J4GA 1J5WA 3U8NA 4K0UA 4PK6A 3MJXA 4O4HE 1EZ3A 3E0ZA 4IL9A 2JQHA 2ODVA 3AE8A 2CHOA 3EI0A 1ZP0A 4LF9T 2YKSA 3EAMA 3QNUA 5FKYA 4E7ZA 3E22E 3RLFF 4KHZF 4YSZA 3I9WA 4IHJE 5LHHB 4I50E 3WTKA 2WB5A 3ZMZB 5JRCA 2EHOB 4HWHA 2X00A 1VCTA 2CM0A 3FZHB 5DQVA 1Z8UA 2FJDA 4TX5A 4OK0A 4PW8A 2HPJA 4ZHQE 4PIRA 4ILCA 2IC6A 3ABVA 5BRXA 2WU2A 4QXCB 2I6HA 2FJBA 3RYIE 1MMDA 4TNWA 3AAIA 5J5IA 2CPTA 5HEUA 5KXJA 3VHLA 3AAEB 4IGUA 3ZC0A 2Y56A 4QKNA 3DP7A 2FUPA 2BZBA 4KP3C 3P4SA 4QXHB 2VASA 2IMLA 3A8YC 4AKGA 3TKLB 2DLRA 3RYFE 4AISA 2Q9QD 3MXZA 5LGNB 1LKXA 2DI4A 4DUYT 4ZI3D 4NUVA 4JBWF 1IBLT 5KX5E 2P9BA 4LFCT 4AFGA 3K3NA 3U8MA 2V26A 5AQHB 3ZSTA 4Q25A 4UELA 2IAKA 3UU6A 4H9PC 2UUAT 2YMDA 4UM3A 3A5XA 3FXEB 3JADA 4X62T 2WNCA 3N5LA 3ANWA 4HFHA 3ANWB 4U2YA 3O4XE 3B13A 4CI3B 4PFOA 2VL0A 3PMZA 2ZM6T 3HL6A 3IF8B 2H3RA 2JIWA 2Y48B 3BQIA 3C64A 1HCIA 5AINA 5J0ZA 5C3JA 4NIQA 1X79A 2WNLA 5CB4E 2H7OA 3HKCE 2VK9A 5HEHA 5DQWA 3KV5A 2RPAA 2WN9A 3M3ZB 2M6BA 4DR7T 4HQPA 2LEHA 5AQGB 2K3WA 2CXDA 2XSAA 4YY3T 2D0TA 5BW2A 2XNVA 4H9OC 2A72A 3LJCA 3UQ4A 5L3GB 4ASKA 3H3MA 2VL8A 3AE3A 1YQ3A 2BKNA 2C5JA 3AE2A 2XY8B 3PDYA 4GK0E 4ZR6A 5L3EB 3JC6C 4DBMA 4AQGA 3LK3B 2XQ9A 3UULA 2Y7YA 3OKQA 1B7TA 4QACA 4UM3P 2UU9T 4EZHA 5JR9B 4TN7B 3K3QC 4LF6T 3Q9DA 2PGZA 5L3DB 2V5CA 2V6XA 4TWHA 2PG8A 4AKRB 3HKBE 1M62A 4AKIA 4HGAA 3C4ZA 3F2EA 2W8GA 3UUNA 4G2AA 3CIRA 2Y8DA 3R84B 2DHRA 2XZ5A 3RKGA 2VVNA 4H9QC 2UXXB 1HX8A 4N78D 4LF4T 4X65T 1I6ZA 3N2GE 1T98A 3SFEA 5HWXA 2JQKA 2V8SV 3DTOA 2YOEA 4ZZCA 3PJAJ 3CWZB 2QGSA 3TLTA 4X5TA 3WTNA 4ADZA 4MALA 2J62A 5LJMA 4E7SA 4DUZT 4ZRUA 1VCSA 2H88A 1UURA 2LJLA 5JDMA 3PU8A 2W62A 4JI1T 5AQLB 3WTMA 2LHNA 2WSSV 2LKHA 5BMVE 2XJ7A 4ZOLE 3L8RA 3IA3A 5KDMC 2KMFA 2ACXA 3AEEA 2BYQA 4UVAB 3AB3B 2R6GF 5EK3A 5LHGB 3ZMVB 1SUMB 5FXVA 4EEDA 3AECA 1R8IA 1BR4A 4ZJSA 5LOVE 4GKJT 2LHRA 2W00A 5AFLA 1HTJF 2LSGA 2W61A 1ZHCA 4WYVA 4B6XA 1IJ5A 1KF6A 4EOZB 2IDOB 2NW7A 1S35A 4DV0T 2D0UA 3QUJA 3ZN1B 4Z8XA 2WAUA 2E2AA 2CBIA 2WQYA 1XNRT 4XK9A 1YKHB 3N9PA 4DV3T 4NXNT 5FL0A 1HNZT 4KI0F 2WY2A 4HFDA 3ZLIA 3CX6B 2IHR1 2MPKA 4KX6A 1HG5A 4DMWA 4U33A 1YKEB 5H6QB 1YQ4A 4EZ4A 3CMLA 3HKDE 4OYJA 5LCYA 4JI8T 2XQAA 3JCFA 1D1AA 3V5SA 2WZHA 4YSXA 5KE4A 3AEGA 1D1CA 4J2CA 3UU8A 5C2TA 4QABA 2K24A 4NUUA 5AQVB 4DV7T 2LOSA 3MA9A 3I9YA 3ONJA 5L3BB 3KVAA 2E5VA 4YJ2E 3K1SA 2CHNA 3ONLC 1BR1A 3RIUA 4DMVA 3NZQA 4CXWA 5FVLA 3RIFA 4PAGA 2Q9QA 2Q9QB 2XQ5A 3PJAA 4GYRA 1N33T 4JEUB 2M6IA 5FP3A 3HI2A 2J1DG 3UTKA 5CO5A 2ZMAA 4AXPA 4MBQA 4EB6E 4PNIA 3WTLA 3EVYA 5CJ5A 4EAHA 4DR4T 4KMCA 3ZJ1A 2W67A 4EV6A 4YSYA 3QC9A 3KDSE 1FMWA 4CXXA 3Q2MA 2BKOA 3CX8B 1IAPA 3VRAA 3NVOA 3FBLA 5HXEA 2XQ6A 2UXNB 1MMAA 2V7IA 4A97A 5ETWA 2W0GA 2JMHA 4QXBB 1V9DA 3S4UA 1UV6A 3AE7A 5TVCA 3UFEA 3BK9A 3A7MA 3AEDA 3IBPA 4ILBA 2WMNA 1OEDE 2KWHA 4ZS2A 3RYHE 4HTEA 3ZSSA 3Q5EA 2IIUA 3F31A 1IBMT 2F4VT 4HWIB 4AFHA 2C9TA 5AFKA 5LBMA 2XTLA 4EGWA 3GWHA 2J47A 3PUSA 2BYSA 3ZT6A 2NOXA 4YXDA 3PE0A 3MZKB 2X68A 1UX5A 2A2FX 2JQQA 2EHOA 3KINB 2LLYA 2QVAA 2UXCT 3C50A 3B5MA 5A1LA 1ZKEA 4JUYA 5HWYA 5FY1A 2Y6XA 3C4XA 3LG7A 3TLVA 1LRZA 5AQTB 4F8HA 4HWDA 2BDEA 2JRKA 2PFVA 4BQTA 3G06A 4UVCB 2AXDS 2W2UA 4ISSA 4A5XA 3QK6A 3BQLA 3PTRB 4X1YE 4P1NA 2WWUA 5LG4A 5HXCA 1HNXT 4UY2A 2K48A 2BKPA 4IT4A 3ZKRA 3JAEA 2VQFT 3KBTA 4IIJE 3AXJB 5LXTE 1KNZA 3P8CD 3RIAA 3TLWA 5JH7E 2NR4A 2XQ3A 3FB2A 4IDNA 3AE6A 3KV6A 2IUBA 1KEYA 3EHZA 5J5FA 1JNZA 3U78A 3JC6D 2YDRA 5CFBA 5KZUA 3VR8A 3LDQB 3LFMA 2CWOA 4IDQA 2BJ0A 4B5DA 2BYPA 4ZI2C 4WW0A 3OVUA 2ZM2A 4FJOA 2BG9B 3ZCIA 1HG2A 1VRBA 2XUEA 4I0UA 5AQPB 4AKHA 3GMIA 2CEAA 4BAYB 5J5GA 3KFWX 1ZOYA 1UGOA 4KBMB 4AKLA 5LXBA 4UF0A 4UF0B 4DV2T 4UM1A 2QRXA 4YHHT 1U4QA 3UU4A 4A98A 1WR6A 2KINB 5M4YA 1MMGA 4JI5T 2V6YA 2V6YB 4JI6T 1CHUA 1Y01A 3O1IA 2BG9E 3LK42 3ZMSB 4YFSA 2FJAA 2E9XC 2G0UA 2JMKA 1SHZC 3FBZA 2HN2A 5LB7B 4DR6T 5HCMA 3CQXC 4U74A 5HXSA 1X9BA 2XYSA 2YDSA 4ZK4A 2VKDA 1YD8G 4PJLA 1FJGT 4EZ1A 3LSVA 5LBQB 4ZXLA 5AQJB 4BJNA 2X66A 1YXRA 3AA0B 3GN5A 5F8PA 3GN5B 2HHHT 3PU3A 1N34T 2IC9A 5AQKB 2VKHA 3N2OA 3BQKA 4H9RC 3M65A 3CPZA 4QAAA 4HFBA 5LHIB 4U3CA 2CLYC 2D5UA 2XYTA 3AAAB 2L3LA 4U2ZA 1WCRA 3RIUC 3ESLA 5J5HA 5EK2A 3NZPA 2A3DA 5JR9A 4QH1A 2ES0A 2Q9QC 2X0YA 1WLXA 4QX7B 4B3RT 5JREA 2V7MA 4O2BE 2X67A 4LMLA 4K0KT 1HNWT 4ZI3C 3RC3A 2W4XA 2X9WA 5IWAT 2CXFA 3OPCA 3UT5E 4XHEA 3TLSA 4Z91A 3T4MA 1NAFA 2JQ9A 3AEBA 2YN6A 4MFRA 5LGUB 4LFAT 4YTPA 2XPKA 3SQ6A 3WAJA 1GQEA 3NRXA 2PBIA 2BS4A 3SS1A 5FXXA 2WDVA 2WP9A 4UXNB 3ZEFB 2DNXA 3ETUA 2V1DB 2MTQA 4QX8B 2LRKA 3SRZA 1S94A 2X9HA 2C5IT 3HR0A 3L3PA 3LBXB 1D0ZA 3AE5A 3UU3A 5ABGA 5E0OA 5AQIB 5F5WA 3C4WA 4UV9B 5GONE 3MKDA 2NTXA 3P4WA 2KZ7B 3OYXA 5LJNA 3AE4A 2L8KA 4LMJA 3Q5XA 5HXHA 4HFEA 5JDFA 4TNVA 2UUBT 5FVKA 2BS2A 5FJVA 1AJ3A 5HXRA 2PTFA 3FZKB 3CQGB 5JMEA 2MOZA 2YK0A 4TUYE 4TWFA 1BR0A 2EHOC 3FZLB 3FZFB 3WAKA 2CCQA 5L3FB 4Z90A 3Q5DA 5IYZE 2UUCT 4PJNA 4ILAA 4MLKA 5SYOA 4IREA 5FL1A 1WYBA 4JI7T 4U7IA 4WBOA 2YINA 4BJMA 3KVBA 1T7SA 1QUUA 4NXMT 4IL4A 1KNPA 2ZLYA 2XQ8A 2LSKA 4X64T 5HCJA 2WZIA 4L0RA 1BR2A 3T1YT 4U31A 1XZYA 5FXZA 3QOFA 4TV8E 5J2UE 4ANJA 3AE1A 1Z0PA 3RRWA 4CI1B 3W15B 5AFUL 4H9SE 5H6RB 3PUGA 3WTHA 4WBNE 3CKDA 5LGTB 4O2AE 4F6RC 2JPFA 4QHOA 5FYMA 2DWGA 5AQUB 2X9YA 3ZT7A 2VVSA 3EDUA 3EABA 3NRYA 3KV9A 4NZBA 1FMVA 2CWYA 2I59A 3N9QA 3O1HA 2V7KA 2LM9A 4QH5A 5AFMA 5AFMB 4DR3T 2BBHA 5IHYA 1I9BA 4YHJA 1WR0A 4UIGA 1NENA 4GOUA 1J5ET 4P0AA 3ETVA 4O4JE 4TZ4C 4HFVA 2CXLA 2XZ6A 1W0BA 2C0SA 3ZN0B 1N36T 3R6NA 2XAFB 3NWIA 4PK5A 5AFHA 2K5BB 1UUSA 4DNDA 2E5LT 3B57A 2KNDA 2WU5A 4IE6A 5IUXA 4LF7T 1T72A 4KUMB 1OEDA 2LSIA 1OEDB 1UW6A 2XNUA 4HEAA 3SQ9A 4I43B 3V5UA 5LA6E 1UX4A 5HEGA 2BS3A 2MBGA 1W09A 4FI5A 1D1BA 2C5KT 3AVSA 4PJMA 5TAOA 4CXYA 2BYNA 2V5DA 2NW9A 2BR7A 2OV9A 1OXZA 4L5GA 3ZYMA 1KNRA 4EYYR 3LK2B 4WV9A 2X0HA 5JDQA 3WI3A 5DJQC 5AQOB 1G73A 3WTJA 5AQNB 4GK5E 1XMQT 4HWCA 4XAXB 2WZYA 3ZT5A 1XNQT 1YW0A 3FHNA 4U72A 1IZNB 2XQYA 5JR9C 3CK6A 3CVRA 1XDOA 2X51A 2VURA 1SE7A 3U8KA 2XNTA 4BFQA 4I4TE 2CA5A 2FBWA 1FEWA 4B3ST 3VKGA 3O9XA 3L39A 3P4QA 1MIYA 3ZJ2A 2WM9A 2XAJB 3FXDB 4WZXA 2HN1A 3RHWA 3RPUA 2NP9A 5AFJA 2MYSA 1IJ6A 2VWAA 3EDVA 3RKOA 2XASB 5JVDE 3VU7H 4BA9A 2MAWA 3CX7B 4X20E 5JRCB 2N9DA 2LM2A 2V7JA 3NBXX 4LF8T 4P09A 3NKZA 4EYUA 4G63A 1E1HB 2CE7A 2ODUA 2KSRA 1D0XA 1SA0E 2UXBT 3AA7B 4X1KE 2E9XD 1KK7A 2BBJA 2OLTA 2BR8A 4X66T 3WIPA 1LVKA 5L2LA 4XZCA 5HEOA 3PUXF 3AXJA 4HWFA 4GYSA 2VB6A 3AEFA 1HF8A 5JDLA 3C84A 3RF1A 4ZK1A 4LFBT 3CQCB 2UZ6A 2XM2A 4OYKA 4ZZBA 3DJBA 1W0AA 1XWMA 3KBUA 5F3JA 4ALXA 2QYWA 5KMGP 1QSDA 4EEBA 4H9NC 5AFNA 4OHFA 5LMNT 2Y54A 3OBVE 3QB5K 4AIUA 1CUNA 3N9MA 3WTIA 4DR1T 4OFZA 4DV4T 4O4LE 2Y58A 2WBLA 3AVRA 2BG9A 3U8JA 4HN9A 2JJ9A 4CQIA 4JI0T 2LOPA 2KWIB 2HPLA 2ACZA 5L4HA 4COFA 2DWKA 2SPCA 2PJQA 2LSYA 2I0MA 3ZDGA 1N32T 2CMRA 5ABEA 2XM1A 4UVBB 4H63H 1WRDA 3ZMUB 4C91A 5EK4A 3PUAA 4UEMA 4AQYT 3T1HT 3RYCE 4O8SA 3QB5A 4IDZA 4A56A 4QH4A 4ILUA 5AQFB 4DR2T 2VKOA 3J9X1 3N2KE 4GIWA 3RGLA 3ZYKA 2DCFA 2D2SA 2XQ4A 3P4RA 1W9RA 1HX1B 3AEAA 3I1AA 2W66A 1UX2A 2H89A 4L9IA 3EUHA 3UFGA 2LT3A 4CZZB 1HS7A 2V7LA 3VKHA 5EZYE 3RH3A 5JTGA 3VR9A 5JDGA 1U5PA 4WNKA 5BP0A 1WFDA 4ISTA 5L47A 4YTMA 3N9NA 1MIVA 2XAQB 2LSJA 1D0YA 5FNVE 2L9QA 3T8OA 3IEEA 4C90A 4YLHA 3U8LA 2YMEA 3IHRA 4V1Av 5LNKA 2EHOD 2UXDT 2IW5B 1HR0T 4ZS3A 2X00D 2ZJUA 2X9XA 3AA6B 1FIOA 1O3XA 3RQUA 3OYZA 4AQFA 3PV0F 4ZJTA 2KT9A 5FXWA 5CA0E 4X1IE 1MNDA 3K3OA 3VRBA 2K9AA 5LMUT 3SOLA 2LE8A 2WS3A 1MNEA 3SWHA 3UUXB 2B1EA 1OEDC 3J7Yq 4ZI7E 3SFDA 2OA5A 2W63A 2N2NA 3P4PA 2YU2A 3SIOA 2YU1A 3AA1B 3D0TA 3AE9A 3FZMB 2XQ7A 4UV8B 4DO0A 5J1GA 4UR9A 4KHPT 2WCAA 4MHCA 4U7YA 3X1DA 3LBXA 3U3IA 2WMOA 4IDPA 2WWVA 5AQRB 1KFYA 3H3AA 5AQMB 3L09A 4YJ3E 2N1GA 3ZPOA 5ADXL 4HFCA 5ABHA 1MMNA 2H7VC 4YT0A 1I94T 2M67A 2RP4A 2KXPB 3GA8A 2LRLA 3OJAA 4DV1T 1NWMX 3I0OA 4ERRA 3ONXA 2XSBA 3UU5A 3P7IA 1UK5A 3RQWA 2FJEA 1H7CA 5HAXA 2WDRA 2YEVC 4DR5T 2LKGA 4HFIA 4LF5T 5AQSB 1US7B 4UM3S 5JDNA 3RX6A 4ZEYA 4EIWA 2E8IA 2CBJA 3RRCA 4CN6A 4DIDB 4DBQA 5FMNA 4IDOA 1OWAA 2VQET 4OX9T 3C98B 2WNJA 1QLBA 3TLUA 1HFAA 5DABA 2AE9A 1T8BA 4NPPA 4IE0A 1UCUA 3O1JA 4I55E 5L3CB 2QA7A 5AQQB 3SH1A 2BVLA 3E08A 3ZC1A 3MK7C 2B76A 2W8FA 4TWDA 4AI6A 1VOMA 4PJJA 1M7KA 5BR8T 4O4IE 3C79A 3H37A 4CN1A 3GUAA 4AFTA 2ZM8A 2QC1B 3PUVF 4TV9E 5FY7A 3UUMA 2Y57A 4PK4A 3PUQA 4PFPA 4JI3T 1E7PA 5CA1E 2GK9A 3PURA 4DVDA 1NEKA 2E9XA 1IBKT 1G8XA 2E9XB 3PUWF 3PUYF 4DBRA 2HH7A 3RC8A 1XMOT 2BG9C 3Q5WA 5ABFA 5ABFB
chains in the Genus database with same CATH topology
5SYOA 2WN9A 4IREA 3TLTA 2M6BA 4X5TA 4HQPA 3WTNA 3UU4A 3SQ6A 4A98A 2LKGA 2ZJUA 2X00D 4HFIA 3RHWA 5L4HA 3RQUA 2ZJVA 3ZDHA 2XZ6A 2BYRA 5AFJA 4COFA 4IL4A 4ZRUA 3PEOA 4ZJTA 5AFHA 3ZDGA 5BW2A 2BG9E 2XQ8A 4UM3S 4XK9A 2XNVA 3WTMA 4UY2A 2XQ6A 5IUXA 2LKHA 3UQ4A 3U8NA 5HCJA 3ZKRA 4A97A 2MAWA 4HFDA 3JAEA 1OEDA 1OEDB 1UW6A 2XNUA 3JAFA 3SQ9A 2LM2A 1OEDC 4IL9A 3UU3A 5HCMA 1UV6A 3RIAA 3EI0A 5HEGA 3TLWA 2XYSA 2YKSA 3EAMA 5TVCA 4ZR6A 4ZK4A 4DBMA 4QH4A 2XQ3A 2BYQA 3SIOA 3LSVA 4EZ1A 2KSRA 2XQ7A 2WNJA 4D01A 2XQ9A 2XQAA 5LG3A 3UQ7A 3TLUA 3UUBA 2Y7YA 4UXUA 4ILBA 4AFGA 3U8MA 3WTOA 1OEDE 4QACA 2BR8A 3P4WA 3EHZA 2BYNA 4UM3P 5KE4A 2XQ4A 5J5FA 2BR7A 3WIPA 2PGZA 3WTHA 4NPPA 3WTKA 5HEOA 4LMJA 1UX2A 3UU6A 3UU8A 2YMDA 5CFBA 3RI5A 4QABA 4TWHA 4WV9A 5KZUA 4HFEA 4ZJSA 2X00A 3C84A 4TNVA 4UM3A 3SH1A 4ZK1A 4AFHA 4QAAA 3WTJA 4HFBA 2UZ6A 4ZZBA 4FRRA 2BJ0A 3JADA 2WNCA 2W8FA 2C9TA 4B5DA 4TWDA 5AFKA 2XYTA 4HFHA 2PH9A 3IGQA 5FJVA 2BYPA 4ALXA 2WZYA 4NZBA 2VL0A 2BYSA 2W8GA 5BP0A 2BG9B 3PMZA 3C79A 3RIFA 5AFLA 5J5HA 5AFNA 2XZ5A 3GUAA 4PIRA 5L47A 4AFTA 2XQ5A 2QC1B 5JMEA 4ILCA 4QH1A 4HFCA 2Y54A 2M6IA 5BRXA 2Y57A 4QH5A 2LLYA 5J5GA 5AINA 5J0ZA 4TWFA 2WNLA 3P50A 5AFMA 5AFMB 5CO5A 3U8KA 2XNTA 3WTIA 4BFQA 4LMLA 4TNWA 1I9BA 3UU5A 5LXBA 3TLVA 3U8LA 2YMEA 4UM1A 3WTLA 2Y58A 5J5IA 4Z90A 4LMKA 4XHEA 5HEHA 5HEUA 3TLSA 2BG9C 4Z91A 3RQWA 4F8HA 2YOEA 2BG9A 3U8JA 5HEJA 3T4MA 4ZZCA 5L4EA 4BQTA 2YN6A 2Y56A 4ILAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SYO A;  2WN9 A;  4IRE A;  3TLT A;  2M6B A;  4X5T A;  4HQP A;  3WTN A;  3UU4 A;  3SQ6 A;  4A98 A;  2LKG A;  2ZJU A;  2X00 D;  4HFI A;  3RHW A;  5L4H A;  3RQU A;  2ZJV A;  3ZDH A;  2XZ6 A;  2BYR A;  5AFJ A;  4COF A;  4IL4 A;  4ZRU A;  3PEO A;  4ZJT A;  5AFH A;  3ZDG A;  5BW2 A;  2BG9 E;  2XQ8 A;  4UM3 S;  4XK9 A;  2XNV A;  3WTM A;  4UY2 A;  2XQ6 A;  5IUX A;  2LKH A;  3UQ4 A;  3U8N A;  5HCJ A;  3ZKR A;  4A97 A;  2MAW A;  4HFD A;  3JAE A;  1OED A;  1OED B;  1UW6 A;  2XNU A;  3JAF A;  3SQ9 A;  2LM2 A;  1OED C;  4IL9 A;  3UU3 A;  5HCM A;  1UV6 A;  3RIA A;  3EI0 A;  5HEG A;  3TLW A;  2XYS A;  2YKS A;  3EAM A;  5TVC A;  4ZR6 A;  4ZK4 A;  4DBM A;  4QH4 A;  2XQ3 A;  2BYQ A;  3SIO A;  3LSV A;  4EZ1 A;  2KSR A;  2XQ7 A;  2WNJ A;  4D01 A;  2XQ9 A;  2XQA A;  5LG3 A;  3UQ7 A;  3TLU A;  3UUB A;  2Y7Y A;  4UXU A;  4ILB A;  4AFG A;  3U8M A;  3WTO A;  1OED E;  4QAC A;  2BR8 A;  3P4W A;  3EHZ A;  2BYN A;  4UM3 P;  5KE4 A;  2XQ4 A;  5J5F A;  2BR7 A;  3WIP A;  2PGZ A;  3WTH A;  4NPP A;  3WTK A;  5HEO A;  4LMJ A;  1UX2 A;  3UU6 A;  3UU8 A;  2YMD A;  5CFB A;  3RI5 A;  4QAB A;  4TWH A;  4WV9 A;  5KZU A;  4HFE A;  4ZJS A;  2X00 A;  3C84 A;  4TNV A;  4UM3 A;  3SH1 A;  4ZK1 A;  4AFH A;  4QAA A;  3WTJ A;  4HFB A;  2UZ6 A;  4ZZB A;  4FRR A;  2BJ0 A;  3JAD A;  2WNC A;  2W8F A;  2C9T A;  4B5D A;  4TWD A;  5AFK A;  2XYT A;  4HFH A;  2PH9 A;  3IGQ A;  5FJV A;  2BYP A;  4ALX A;  2WZY A;  4NZB A;  2VL0 A;  2BYS A;  2W8G A;  5BP0 A;  2BG9 B;  3PMZ A;  3C79 A;  3RIF A;  5AFL A;  5J5H A;  5AFN A;  2XZ5 A;  3GUA A;  4PIR A;  5L47 A;  4AFT A;  2XQ5 A;  2QC1 B;  5JME A;  4ILC A;  4QH1 A;  4HFC A;  2Y54 A;  2M6I A;  5BRX A;  2Y57 A;  4QH5 A;  2LLY A;  5J5G A;  5AIN A;  5J0Z A;  4TWF A;  2WNL A;  3P50 A;  5AFM A;  5AFM B;  5CO5 A;  3U8K A;  2XNT A;  3WTI A;  4BFQ A;  4LML A;  4TNW A;  1I9B A;  3UU5 A;  5LXB A;  3TLV A;  3U8L A;  2YME A;  4UM1 A;  3WTL A;  2Y58 A;  5J5I A;  4Z90 A;  4LMK A;  4XHE A;  5HEH A;  5HEU A;  3TLS A;  2BG9 C;  4Z91 A;  3RQW A;  4F8H A;  2YOE A;  2BG9 A;  3U8J A;  5HEJ A;  3T4M A;  4ZZC A;  5L4E A;  4BQT A;  2YN6 A;  2Y56 A;  4ILA A; 
#chains in the Genus database with same CATH topology
 4IE4 A;  3K8P C;  1J1J A;  1LVF A;  2WDQ A;  2XHE B;  4P0B A;  2RA1 A;  2ZJV A;  1MIW A;  3ZDH A;  1WYC A;  2BYR A;  3F57 A;  3PEO A;  4H63 V;  2X0L B;  4B3M T;  3C51 A;  4EXT A;  5J2T E;  2Z6E A;  5CGM A;  3KV4 A;  4HE8 A;  3I0Q A;  5FY0 A;  3JAF A;  2A9U A;  5JDH A;  2XAG B;  2CLY B;  4JLE A;  3MAC A;  3OTO T;  4JEH B;  4D01 A;  5LG3 A;  2XAH B;  3UQ7 A;  3UUB A;  4UXU A;  3WTO A;  3ZMT B;  2BVM A;  5LYJ E;  4GKK T;  4JI2 T;  2NWB A;  3RI5 A;  4CI2 B;  1DU2 A;  2XZE A;  3N9L A;  4DV5 T;  4FRR A;  4M1P A;  2ZM0 A;  2PH9 A;  3IGQ A;  4IE5 A;  2DL1 A;  1JNR A;  4IE7 A;  3HKE E;  4XBF B;  1ZV4 X;  1Y64 B;  1XDP A;  4B3T T;  4CN4 A;  3ZCJ A;  4QWN B;  3P50 A;  2YDQ A;  2KLQ A;  4DV6 T;  1E2A A;  4JI4 T;  2CRB A;  4LMK A;  3PUZ F;  3N9O A;  4JYA T;  5HEJ A;  3ZYL A;  5L4E A;  1ZEE A;  1L0V A;  3HA4 A;  4YTN A;  5C8Y E;  2NTY A;  4HKA A;  4ZI2 D;  4AQF C;  2D9D A;  4JV5 T;  2NW8 A;  5JQG E;  5LP6 E;  5HYA A;  2VKJ A;  2J4G A;  1J5W A;  3U8N A;  4K0U A;  4PK6 A;  3MJX A;  4O4H E;  1EZ3 A;  3E0Z A;  4IL9 A;  2JQH A;  2ODV A;  3AE8 A;  2CHO A;  3EI0 A;  1ZP0 A;  4LF9 T;  2YKS A;  3EAM A;  3QNU A;  5FKY A;  4E7Z A;  3E22 E;  3RLF F;  4KHZ F;  4YSZ A;  3I9W A;  4IHJ E;  5LHH B;  4I50 E;  3WTK A;  2WB5 A;  3ZMZ B;  5JRC A;  2EHO B;  4HWH A;  2X00 A;  1VCT A;  2CM0 A;  3FZH B;  5DQV A;  1Z8U A;  2FJD A;  4TX5 A;  4OK0 A;  4PW8 A;  2HPJ A;  4ZHQ E;  4PIR A;  4ILC A;  2IC6 A;  3ABV A;  5BRX A;  2WU2 A;  4QXC B;  2I6H A;  2FJB A;  3RYI E;  1MMD A;  4TNW A;  3AAI A;  5J5I A;  2CPT A;  5HEU A;  5KXJ A;  3VHL A;  3AAE B;  4IGU A;  3ZC0 A;  2Y56 A;  4QKN A;  3DP7 A;  2FUP A;  2BZB A;  4KP3 C;  3P4S A;  4QXH B;  2VAS A;  2IML A;  3A8Y C;  4AKG A;  3TKL B;  2DLR A;  3RYF E;  4AIS A;  2Q9Q D;  3MXZ A;  5LGN B;  1LKX A;  2DI4 A;  4DUY T;  4ZI3 D;  4NUV A;  4JBW F;  1IBL T;  5KX5 E;  2P9B A;  4LFC T;  4AFG A;  3K3N A;  3U8M A;  2V26 A;  5AQH B;  3ZST A;  4Q25 A;  4UEL A;  2IAK A;  3UU6 A;  4H9P C;  2UUA T;  2YMD A;  4UM3 A;  3A5X A;  3FXE B;  3JAD A;  4X62 T;  2WNC A;  3N5L A;  3ANW A;  4HFH A;  3ANW B;  4U2Y A;  3O4X E;  3B13 A;  4CI3 B;  4PFO A;  2VL0 A;  3PMZ A;  2ZM6 T;  3HL6 A;  3IF8 B;  2H3R A;  2JIW A;  2Y48 B;  3BQI A;  3C64 A;  1HCI A;  5AIN A;  5J0Z A;  5C3J A;  4NIQ A;  1X79 A;  2WNL A;  5CB4 E;  2H7O A;  3HKC E;  2VK9 A;  5HEH A;  5DQW A;  3KV5 A;  2RPA A;  2WN9 A;  3M3Z B;  2M6B A;  4DR7 T;  4HQP A;  2LEH A;  5AQG B;  2K3W A;  2CXD A;  2XSA A;  4YY3 T;  2D0T A;  5BW2 A;  2XNV A;  4H9O C;  2A72 A;  3LJC A;  3UQ4 A;  5L3G B;  4ASK A;  3H3M A;  2VL8 A;  3AE3 A;  1YQ3 A;  2BKN A;  2C5J A;  3AE2 A;  2XY8 B;  3PDY A;  4GK0 E;  4ZR6 A;  5L3E B;  3JC6 C;  4DBM A;  4AQG A;  3LK3 B;  2XQ9 A;  3UUL A;  2Y7Y A;  3OKQ A;  1B7T A;  4QAC A;  4UM3 P;  2UU9 T;  4EZH A;  5JR9 B;  4TN7 B;  3K3Q C;  4LF6 T;  3Q9D A;  2PGZ A;  5L3D B;  2V5C A;  2V6X A;  4TWH A;  2PG8 A;  4AKR B;  3HKB E;  1M62 A;  4AKI A;  4HGA A;  3C4Z A;  3F2E A;  2W8G A;  3UUN A;  4G2A A;  3CIR A;  2Y8D A;  3R84 B;  2DHR A;  2XZ5 A;  3RKG A;  2VVN A;  4H9Q C;  2UXX B;  1HX8 A;  4N78 D;  4LF4 T;  4X65 T;  1I6Z A;  3N2G E;  1T98 A;  3SFE A;  5HWX A;  2JQK A;  2V8S V;  3DTO A;  2YOE A;  4ZZC A;  3PJA J;  3CWZ B;  2QGS A;  3TLT A;  4X5T A;  3WTN A;  4ADZ A;  4MAL A;  2J62 A;  5LJM A;  4E7S A;  4DUZ T;  4ZRU A;  1VCS A;  2H88 A;  1UUR A;  2LJL A;  5JDM A;  3PU8 A;  2W62 A;  4JI1 T;  5AQL B;  3WTM A;  2LHN A;  2WSS V;  2LKH A;  5BMV E;  2XJ7 A;  4ZOL E;  3L8R A;  3IA3 A;  5KDM C;  2KMF A;  2ACX A;  3AEE A;  2BYQ A;  4UVA B;  3AB3 B;  2R6G F;  5EK3 A;  5LHG B;  3ZMV B;  1SUM B;  5FXV A;  4EED A;  3AEC A;  1R8I A;  1BR4 A;  4ZJS A;  5LOV E;  4GKJ T;  2LHR A;  2W00 A;  5AFL A;  1HTJ F;  2LSG A;  2W61 A;  1ZHC A;  4WYV A;  4B6X A;  1IJ5 A;  1KF6 A;  4EOZ B;  2IDO B;  2NW7 A;  1S35 A;  4DV0 T;  2D0U A;  3QUJ A;  3ZN1 B;  4Z8X A;  2WAU A;  2E2A A;  2CBI A;  2WQY A;  1XNR T;  4XK9 A;  1YKH B;  3N9P A;  4DV3 T;  4NXN T;  5FL0 A;  1HNZ T;  4KI0 F;  2WY2 A;  4HFD A;  3ZLI A;  3CX6 B;  2IHR 1;  2MPK A;  4KX6 A;  1HG5 A;  4DMW A;  4U33 A;  1YKE B;  5H6Q B;  1YQ4 A;  4EZ4 A;  3CML A;  3HKD E;  4OYJ A;  5LCY A;  4JI8 T;  2XQA A;  3JCF A;  1D1A A;  3V5S A;  2WZH A;  4YSX A;  5KE4 A;  3AEG A;  1D1C A;  4J2C A;  3UU8 A;  5C2T A;  4QAB A;  2K24 A;  4NUU A;  5AQV B;  4DV7 T;  2LOS A;  3MA9 A;  3I9Y A;  3ONJ A;  5L3B B;  3KVA A;  2E5V A;  4YJ2 E;  3K1S A;  2CHN A;  3ONL C;  1BR1 A;  3RIU A;  4DMV A;  3NZQ A;  4CXW A;  5FVL A;  3RIF A;  4PAG A;  2Q9Q A;  2Q9Q B;  2XQ5 A;  3PJA A;  4GYR A;  1N33 T;  4JEU B;  2M6I A;  5FP3 A;  3HI2 A;  2J1D G;  3UTK A;  5CO5 A;  2ZMA A;  4AXP A;  4MBQ A;  4EB6 E;  4PNI A;  3WTL A;  3EVY A;  5CJ5 A;  4EAH A;  4DR4 T;  4KMC A;  3ZJ1 A;  2W67 A;  4EV6 A;  4YSY A;  3QC9 A;  3KDS E;  1FMW A;  4CXX A;  3Q2M A;  2BKO A;  3CX8 B;  1IAP A;  3VRA A;  3NVO A;  3FBL A;  5HXE A;  2XQ6 A;  2UXN B;  1MMA A;  2V7I A;  4A97 A;  5ETW A;  2W0G A;  2JMH A;  4QXB B;  1V9D A;  3S4U A;  1UV6 A;  3AE7 A;  5TVC A;  3UFE A;  3BK9 A;  3A7M A;  3AED A;  3IBP A;  4ILB A;  2WMN A;  1OED E;  2KWH A;  4ZS2 A;  3RYH E;  4HTE A;  3ZSS A;  3Q5E A;  2IIU A;  3F31 A;  1IBM T;  2F4V T;  4HWI B;  4AFH A;  2C9T A;  5AFK A;  5LBM A;  2XTL A;  4EGW A;  3GWH A;  2J47 A;  3PUS A;  2BYS A;  3ZT6 A;  2NOX A;  4YXD A;  3PE0 A;  3MZK B;  2X68 A;  1UX5 A;  2A2F X;  2JQQ A;  2EHO A;  3KIN B;  2LLY A;  2QVA A;  2UXC T;  3C50 A;  3B5M A;  5A1L A;  1ZKE A;  4JUY A;  5HWY A;  5FY1 A;  2Y6X A;  3C4X A;  3LG7 A;  3TLV A;  1LRZ A;  5AQT B;  4F8H A;  4HWD A;  2BDE A;  2JRK A;  2PFV A;  4BQT A;  3G06 A;  4UVC B;  2AXD S;  2W2U A;  4ISS A;  4A5X A;  3QK6 A;  3BQL A;  3PTR B;  4X1Y E;  4P1N A;  2WWU A;  5LG4 A;  5HXC A;  1HNX T;  4UY2 A;  2K48 A;  2BKP A;  4IT4 A;  3ZKR A;  3JAE A;  2VQF T;  3KBT A;  4IIJ E;  3AXJ B;  5LXT E;  1KNZ A;  3P8C D;  3RIA A;  3TLW A;  5JH7 E;  2NR4 A;  2XQ3 A;  3FB2 A;  4IDN A;  3AE6 A;  3KV6 A;  2IUB A;  1KEY A;  3EHZ A;  5J5F A;  1JNZ A;  3U78 A;  3JC6 D;  2YDR A;  5CFB A;  5KZU A;  3VR8 A;  3LDQ B;  3LFM A;  2CWO A;  4IDQ A;  2BJ0 A;  4B5D A;  2BYP A;  4ZI2 C;  4WW0 A;  3OVU A;  2ZM2 A;  4FJO A;  2BG9 B;  3ZCI A;  1HG2 A;  1VRB A;  2XUE A;  4I0U A;  5AQP B;  4AKH A;  3GMI A;  2CEA A;  4BAY B;  5J5G A;  3KFW X;  1ZOY A;  1UGO A;  4KBM B;  4AKL A;  5LXB A;  4UF0 A;  4UF0 B;  4DV2 T;  4UM1 A;  2QRX A;  4YHH T;  1U4Q A;  3UU4 A;  4A98 A;  1WR6 A;  2KIN B;  5M4Y A;  1MMG A;  4JI5 T;  2V6Y A;  2V6Y B;  4JI6 T;  1CHU A;  1Y01 A;  3O1I A;  2BG9 E;  3LK4 2;  3ZMS B;  4YFS A;  2FJA A;  2E9X C;  2G0U A;  2JMK A;  1SHZ C;  3FBZ A;  2HN2 A;  5LB7 B;  4DR6 T;  5HCM A;  3CQX C;  4U74 A;  5HXS A;  1X9B A;  2XYS A;  2YDS A;  4ZK4 A;  2VKD A;  1YD8 G;  4PJL A;  1FJG T;  4EZ1 A;  3LSV A;  5LBQ B;  4ZXL A;  5AQJ B;  4BJN A;  2X66 A;  1YXR A;  3AA0 B;  3GN5 A;  5F8P A;  3GN5 B;  2HHH T;  3PU3 A;  1N34 T;  2IC9 A;  5AQK B;  2VKH A;  3N2O A;  3BQK A;  4H9R C;  3M65 A;  3CPZ A;  4QAA A;  4HFB A;  5LHI B;  4U3C A;  2CLY C;  2D5U A;  2XYT A;  3AAA B;  2L3L A;  4U2Z A;  1WCR A;  3RIU C;  3ESL A;  5J5H A;  5EK2 A;  3NZP A;  2A3D A;  5JR9 A;  4QH1 A;  2ES0 A;  2Q9Q C;  2X0Y A;  1WLX A;  4QX7 B;  4B3R T;  5JRE A;  2V7M A;  4O2B E;  2X67 A;  4LML A;  4K0K T;  1HNW T;  4ZI3 C;  3RC3 A;  2W4X A;  2X9W A;  5IWA T;  2CXF A;  3OPC A;  3UT5 E;  4XHE A;  3TLS A;  4Z91 A;  3T4M A;  1NAF A;  2JQ9 A;  3AEB A;  2YN6 A;  4MFR A;  5LGU B;  4LFA T;  4YTP A;  2XPK A;  3SQ6 A;  3WAJ A;  1GQE A;  3NRX A;  2PBI A;  2BS4 A;  3SS1 A;  5FXX A;  2WDV A;  2WP9 A;  4UXN B;  3ZEF B;  2DNX A;  3ETU A;  2V1D B;  2MTQ A;  4QX8 B;  2LRK A;  3SRZ A;  1S94 A;  2X9H A;  2C5I T;  3HR0 A;  3L3P A;  3LBX B;  1D0Z A;  3AE5 A;  3UU3 A;  5ABG A;  5E0O A;  5AQI B;  5F5W A;  3C4W A;  4UV9 B;  5GON E;  3MKD A;  2NTX A;  3P4W A;  2KZ7 B;  3OYX A;  5LJN A;  3AE4 A;  2L8K A;  4LMJ A;  3Q5X A;  5HXH A;  4HFE A;  5JDF A;  4TNV A;  2UUB T;  5FVK A;  2BS2 A;  5FJV A;  1AJ3 A;  5HXR A;  2PTF A;  3FZK B;  3CQG B;  5JME A;  2MOZ A;  2YK0 A;  4TUY E;  4TWF A;  1BR0 A;  2EHO C;  3FZL B;  3FZF B;  3WAK A;  2CCQ A;  5L3F B;  4Z90 A;  3Q5D A;  5IYZ E;  2UUC T;  4PJN A;  4ILA A;  4MLK A;  5SYO A;  4IRE A;  5FL1 A;  1WYB A;  4JI7 T;  4U7I A;  4WBO A;  2YIN A;  4BJM A;  3KVB A;  1T7S A;  1QUU A;  4NXM T;  4IL4 A;  1KNP A;  2ZLY A;  2XQ8 A;  2LSK A;  4X64 T;  5HCJ A;  2WZI A;  4L0R A;  1BR2 A;  3T1Y T;  4U31 A;  1XZY A;  5FXZ A;  3QOF A;  4TV8 E;  5J2U E;  4ANJ A;  3AE1 A;  1Z0P A;  3RRW A;  4CI1 B;  3W15 B;  5AFU L;  4H9S E;  5H6R B;  3PUG A;  3WTH A;  4WBN E;  3CKD A;  5LGT B;  4O2A E;  4F6R C;  2JPF A;  4QHO A;  5FYM A;  2DWG A;  5AQU B;  2X9Y A;  3ZT7 A;  2VVS A;  3EDU A;  3EAB A;  3NRY A;  3KV9 A;  4NZB A;  1FMV A;  2CWY A;  2I59 A;  3N9Q A;  3O1H A;  2V7K A;  2LM9 A;  4QH5 A;  5AFM A;  5AFM B;  4DR3 T;  2BBH A;  5IHY A;  1I9B A;  4YHJ A;  1WR0 A;  4UIG A;  1NEN A;  4GOU A;  1J5E T;  4P0A A;  3ETV A;  4O4J E;  4TZ4 C;  4HFV A;  2CXL A;  2XZ6 A;  1W0B A;  2C0S A;  3ZN0 B;  1N36 T;  3R6N A;  2XAF B;  3NWI A;  4PK5 A;  5AFH A;  2K5B B;  1UUS A;  4DND A;  2E5L T;  3B57 A;  2KND A;  2WU5 A;  4IE6 A;  5IUX A;  4LF7 T;  1T72 A;  4KUM B;  1OED A;  2LSI A;  1OED B;  1UW6 A;  2XNU A;  4HEA A;  3SQ9 A;  4I43 B;  3V5U A;  5LA6 E;  1UX4 A;  5HEG A;  2BS3 A;  2MBG A;  1W09 A;  4FI5 A;  1D1B A;  2C5K T;  3AVS A;  4PJM A;  5TAO A;  4CXY A;  2BYN A;  2V5D A;  2NW9 A;  2BR7 A;  2OV9 A;  1OXZ A;  4L5G A;  3ZYM A;  1KNR A;  4EYY R;  3LK2 B;  4WV9 A;  2X0H A;  5JDQ A;  3WI3 A;  5DJQ C;  5AQO B;  1G73 A;  3WTJ A;  5AQN B;  4GK5 E;  1XMQ T;  4HWC A;  4XAX B;  2WZY A;  3ZT5 A;  1XNQ T;  1YW0 A;  3FHN A;  4U72 A;  1IZN B;  2XQY A;  5JR9 C;  3CK6 A;  3CVR A;  1XDO A;  2X51 A;  2VUR A;  1SE7 A;  3U8K A;  2XNT A;  4BFQ A;  4I4T E;  2CA5 A;  2FBW A;  1FEW A;  4B3S T;  3VKG A;  3O9X A;  3L39 A;  3P4Q A;  1MIY A;  3ZJ2 A;  2WM9 A;  2XAJ B;  3FXD B;  4WZX A;  2HN1 A;  3RHW A;  3RPU A;  2NP9 A;  5AFJ A;  2MYS A;  1IJ6 A;  2VWA A;  3EDV A;  3RKO A;  2XAS B;  5JVD E;  3VU7 H;  4BA9 A;  2MAW A;  3CX7 B;  4X20 E;  5JRC B;  2N9D A;  2LM2 A;  2V7J A;  3NBX X;  4LF8 T;  4P09 A;  3NKZ A;  4EYU A;  4G63 A;  1E1H B;  2CE7 A;  2ODU A;  2KSR A;  1D0X A;  1SA0 E;  2UXB T;  3AA7 B;  4X1K E;  2E9X D;  1KK7 A;  2BBJ A;  2OLT A;  2BR8 A;  4X66 T;  3WIP A;  1LVK A;  5L2L A;  4XZC A;  5HEO A;  3PUX F;  3AXJ A;  4HWF A;  4GYS A;  2VB6 A;  3AEF A;  1HF8 A;  5JDL A;  3C84 A;  3RF1 A;  4ZK1 A;  4LFB T;  3CQC B;  2UZ6 A;  2XM2 A;  4OYK A;  4ZZB A;  3DJB A;  1W0A A;  1XWM A;  3KBU A;  5F3J A;  4ALX A;  2QYW A;  5KMG P;  1QSD A;  4EEB A;  4H9N C;  5AFN A;  4OHF A;  5LMN T;  2Y54 A;  3OBV E;  3QB5 K;  4AIU A;  1CUN A;  3N9M A;  3WTI A;  4DR1 T;  4OFZ A;  4DV4 T;  4O4L E;  2Y58 A;  2WBL A;  3AVR A;  2BG9 A;  3U8J A;  4HN9 A;  2JJ9 A;  4CQI A;  4JI0 T;  2LOP A;  2KWI B;  2HPL A;  2ACZ A;  5L4H A;  4COF A;  2DWK A;  2SPC A;  2PJQ A;  2LSY A;  2I0M A;  3ZDG A;  1N32 T;  2CMR A;  5ABE A;  2XM1 A;  4UVB B;  4H63 H;  1WRD A;  3ZMU B;  4C91 A;  5EK4 A;  3PUA A;  4UEM A;  4AQY T;  3T1H T;  3RYC E;  4O8S A;  3QB5 A;  4IDZ A;  4A56 A;  4QH4 A;  4ILU A;  5AQF B;  4DR2 T;  2VKO A;  3J9X 1;  3N2K E;  4GIW A;  3RGL A;  3ZYK A;  2DCF A;  2D2S A;  2XQ4 A;  3P4R A;  1W9R A;  1HX1 B;  3AEA A;  3I1A A;  2W66 A;  1UX2 A;  2H89 A;  4L9I A;  3EUH A;  3UFG A;  2LT3 A;  4CZZ B;  1HS7 A;  2V7L A;  3VKH A;  5EZY E;  3RH3 A;  5JTG A;  3VR9 A;  5JDG A;  1U5P A;  4WNK A;  5BP0 A;  1WFD A;  4IST A;  5L47 A;  4YTM A;  3N9N A;  1MIV A;  2XAQ B;  2LSJ A;  1D0Y A;  5FNV E;  2L9Q A;  3T8O A;  3IEE A;  4C90 A;  4YLH A;  3U8L A;  2YME A;  3IHR A;  4V1A v;  5LNK A;  2EHO D;  2UXD T;  2IW5 B;  1HR0 T;  4ZS3 A;  2X00 D;  2ZJU A;  2X9X A;  3AA6 B;  1FIO A;  1O3X A;  3RQU A;  3OYZ A;  4AQF A;  3PV0 F;  4ZJT A;  2KT9 A;  5FXW A;  5CA0 E;  4X1I E;  1MND A;  3K3O A;  3VRB A;  2K9A A;  5LMU T;  3SOL A;  2LE8 A;  2WS3 A;  1MNE A;  3SWH A;  3UUX B;  2B1E A;  1OED C;  3J7Y q;  4ZI7 E;  3SFD A;  2OA5 A;  2W63 A;  2N2N A;  3P4P A;  2YU2 A;  3SIO A;  2YU1 A;  3AA1 B;  3D0T A;  3AE9 A;  3FZM B;  2XQ7 A;  4UV8 B;  4DO0 A;  5J1G A;  4UR9 A;  4KHP T;  2WCA A;  4MHC A;  4U7Y A;  3X1D A;  3LBX A;  3U3I A;  2WMO A;  4IDP A;  2WWV A;  5AQR B;  1KFY A;  3H3A A;  5AQM B;  3L09 A;  4YJ3 E;  2N1G A;  3ZPO A;  5ADX L;  4HFC A;  5ABH A;  1MMN A;  2H7V C;  4YT0 A;  1I94 T;  2M67 A;  2RP4 A;  2KXP B;  3GA8 A;  2LRL A;  3OJA A;  4DV1 T;  1NWM X;  3I0O A;  4ERR A;  3ONX A;  2XSB A;  3UU5 A;  3P7I A;  1UK5 A;  3RQW A;  2FJE A;  1H7C A;  5HAX A;  2WDR A;  2YEV C;  4DR5 T;  2LKG A;  4HFI A;  4LF5 T;  5AQS B;  1US7 B;  4UM3 S;  5JDN A;  3RX6 A;  4ZEY A;  4EIW A;  2E8I A;  2CBJ A;  3RRC A;  4CN6 A;  4DID B;  4DBQ A;  5FMN A;  4IDO A;  1OWA A;  2VQE T;  4OX9 T;  3C98 B;  2WNJ A;  1QLB A;  3TLU A;  1HFA A;  5DAB A;  2AE9 A;  1T8B A;  4NPP A;  4IE0 A;  1UCU A;  3O1J A;  4I55 E;  5L3C B;  2QA7 A;  5AQQ B;  3SH1 A;  2BVL A;  3E08 A;  3ZC1 A;  3MK7 C;  2B76 A;  2W8F A;  4TWD A;  4AI6 A;  1VOM A;  4PJJ A;  1M7K A;  5BR8 T;  4O4I E;  3C79 A;  3H37 A;  4CN1 A;  3GUA A;  4AFT A;  2ZM8 A;  2QC1 B;  3PUV F;  4TV9 E;  5FY7 A;  3UUM A;  2Y57 A;  4PK4 A;  3PUQ A;  4PFP A;  4JI3 T;  1E7P A;  5CA1 E;  2GK9 A;  3PUR A;  4DVD A;  1NEK A;  2E9X A;  1IBK T;  1G8X A;  2E9X B;  3PUW F;  3PUY F;  4DBR A;  2HH7 A;  3RC8 A;  1XMO T;  2BG9 C;  3Q5W A;  5ABF A;  5ABF B; 
#chains in the Genus database with same CATH homology
 5SYO A;  2WN9 A;  4IRE A;  3TLT A;  2M6B A;  4X5T A;  4HQP A;  3WTN A;  3UU4 A;  3SQ6 A;  4A98 A;  2LKG A;  2ZJU A;  2X00 D;  4HFI A;  3RHW A;  5L4H A;  3RQU A;  2ZJV A;  3ZDH A;  2XZ6 A;  2BYR A;  5AFJ A;  4COF A;  4IL4 A;  4ZRU A;  3PEO A;  4ZJT A;  5AFH A;  3ZDG A;  5BW2 A;  2BG9 E;  2XQ8 A;  4UM3 S;  4XK9 A;  2XNV A;  3WTM A;  4UY2 A;  2XQ6 A;  5IUX A;  2LKH A;  3UQ4 A;  3U8N A;  5HCJ A;  3ZKR A;  4A97 A;  2MAW A;  4HFD A;  3JAE A;  1OED A;  1OED B;  1UW6 A;  2XNU A;  3JAF A;  3SQ9 A;  2LM2 A;  1OED C;  4IL9 A;  3UU3 A;  5HCM A;  1UV6 A;  3RIA A;  3EI0 A;  5HEG A;  3TLW A;  2XYS A;  2YKS A;  3EAM A;  5TVC A;  4ZR6 A;  4ZK4 A;  4DBM A;  4QH4 A;  2XQ3 A;  2BYQ A;  3SIO A;  3LSV A;  4EZ1 A;  2KSR A;  2XQ7 A;  2WNJ A;  4D01 A;  2XQ9 A;  2XQA A;  5LG3 A;  3UQ7 A;  3TLU A;  3UUB A;  2Y7Y A;  4UXU A;  4ILB A;  4AFG A;  3U8M A;  3WTO A;  1OED E;  4QAC A;  2BR8 A;  3P4W A;  3EHZ A;  2BYN A;  4UM3 P;  5KE4 A;  2XQ4 A;  5J5F A;  2BR7 A;  3WIP A;  2PGZ A;  3WTH A;  4NPP A;  3WTK A;  5HEO A;  4LMJ A;  1UX2 A;  3UU6 A;  3UU8 A;  2YMD A;  5CFB A;  3RI5 A;  4QAB A;  4TWH A;  4WV9 A;  5KZU A;  4HFE A;  4ZJS A;  2X00 A;  3C84 A;  4TNV A;  4UM3 A;  3SH1 A;  4ZK1 A;  4AFH A;  4QAA A;  3WTJ A;  4HFB A;  2UZ6 A;  4ZZB A;  4FRR A;  2BJ0 A;  3JAD A;  2WNC A;  2W8F A;  2C9T A;  4B5D A;  4TWD A;  5AFK A;  2XYT A;  4HFH A;  2PH9 A;  3IGQ A;  5FJV A;  2BYP A;  4ALX A;  2WZY A;  4NZB A;  2VL0 A;  2BYS A;  2W8G A;  5BP0 A;  2BG9 B;  3PMZ A;  3C79 A;  3RIF A;  5AFL A;  5J5H A;  5AFN A;  2XZ5 A;  3GUA A;  4PIR A;  5L47 A;  4AFT A;  2XQ5 A;  2QC1 B;  5JME A;  4ILC A;  4QH1 A;  4HFC A;  2Y54 A;  2M6I A;  5BRX A;  2Y57 A;  4QH5 A;  2LLY A;  5J5G A;  5AIN A;  5J0Z A;  4TWF A;  2WNL A;  3P50 A;  5AFM A;  5AFM B;  5CO5 A;  3U8K A;  2XNT A;  3WTI A;  4BFQ A;  4LML A;  4TNW A;  1I9B A;  3UU5 A;  5LXB A;  3TLV A;  3U8L A;  2YME A;  4UM1 A;  3WTL A;  2Y58 A;  5J5I A;  4Z90 A;  4LMK A;  4XHE A;  5HEH A;  5HEU A;  3TLS A;  2BG9 C;  4Z91 A;  3RQW A;  4F8H A;  2YOE A;  2BG9 A;  3U8J A;  5HEJ A;  3T4M A;  4ZZC A;  5L4E A;  4BQT A;  2YN6 A;  2Y56 A;  4ILA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...