2XQ4A

Pentameric ligand gated ion channel glic in complex with tetramethylarsonium (tmas)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
total genus 75
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq4A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq4A01
2YN6A 4IL4A 2UZ6A 5HEJA 5IUXA 4ALXA 3WTHA 3JAFA 5FJVA 5CFBA 3IGQA 1OEDB 2BG9A 1UV6A 5HEOA 4LMLA 1UX2A 5L47A 4QACA 2Y58A 5LXBA 4HQPA 4AFGA 3RI5A 4LMKA 2LM2A 4ILCA 2BYRA 1OEDE 2XQ5A 2XNUA 3RHWA 2BYQA 2C9TA 4TWHA 4A98A 5AFKA 4DBMA 3WTIA 3UQ7A 3UU4A 3TLWA 3PMZA 5HEUA 5HEGA 1I9BA 5J0ZA 4UY2A 2XQ3A 2LKHA 2QC1B 2W8GA 1UW6A 4UM3P 2XQ9A 5AFNA 5J5GA 3SIOA 5AFMB 3C84A 2WNLA 4HFBA 2XYTA 2Y7YA 3RIAA 5AFHA 4HFIA 4TWDA 4HFEA 3UU3A 2XZ5A 4UXUA 2WN9A 2XQAA 5L4HA 5SYOA 3WTJA 4ILBA 4TNWA 2XQ6A 3EI0A 3JADA 4IL9A 2YOEA 2BR8A 2LLYA 4BQTA 3EAMA 4COFA 4QH4A 2LKGA 2XQ4A 3P4WA 3TLTA 5HCJA 4XK9A 4TNVA 4HFCA 2BYSA 3U8NA 4AFTA 3PEOA 5KE4A 4Z90A 5TVCA 4QABA 3WTLA 4ILAA 2M6BA 5J5FA 3RQWA 2XQ7A 4A97A 3UU6A 3U8MA 3U8JA 3JAEA 2Y56A 5HCMA 4NZBA 4FRRA 2WZYA 4D01A 2Y57A 1OEDC 5JMEA 3ZKRA 5KZUA 5AFLA 2BJ0A 3TLUA 3T4MA 2M6IA 2X00A 5AFMA 5J5IA 5BP0A 3WTMA 4F8HA 3WTNA 2YKSA 3GUAA 2MAWA 5BRXA 2KSRA 2XNVA 4UM3S 2W8FA 2XQ8A 3SQ6A 2BYNA 2XYSA 5J5HA 3TLSA 2Y54A 4X5TA 3UU8A 4PIRA 3SH1A 3EHZA 4XHEA 5AFJA 4HFHA 5LG3A 3UU5A 2BG9E 4ZZCA 2PGZA 2XZ6A 4QH5A 5HEHA 2ZJUA 3WIPA 3UQ4A 2WNCA 4NPPA 4UM1A 4UM3A 4QAAA 2BR7A 2VL0A 3SQ9A 3U8KA 4WV9A 4QH1A 2X00D 3C79A 4AFHA 4ZJTA 2BG9C 5L4EA 3TLVA 5CO5A 4ZK4A 4TWFA 2BYPA 1OEDA 3LSVA 3ZDGA 4HFDA 4ZK1A 2BG9B 3UUBA 4B5DA 2ZJVA 2PH9A 4EZ1A 5BW2A 4LMJA 2WNJA 3WTOA 3ZDHA 3RIFA 4ZJSA 3RQUA 4Z91A 4ZZBA 3U8LA 2XNTA 2YMEA 3P50A 4BFQA 2YMDA 5AINA 4IREA 4ZR6A 3WTKA 4ZRUA
chains in the Genus database with same CATH superfamily
2ODVA 2LSGA 5FXWA 2NW8A 5C8YE 4ZI3D 5L3CB 2YU1A 1QUUA 3KVAA 2KMFA 5IHYA 4MALA 2H7VC 5HEUA 3V5UA 5GONE 4DV5T 4UY2A 4JI2T 1Y01A 3LBXA 2IIUA 4BAYB 1WLXA 4EYUA 5LMUT 3NRYA 1J1JA 4B3ST 4EOZB 2BR8A 3J9X1 1S35A 4H9QC 4AXPA 2UXCT 4DO0A 1UGOA 3WTLA 4LFAT 4ISTA 3OYZA 3QC9A 3RH3A 3FHNA 4ZXLA 5JMEA 3DJBA 3RGLA 2BJ0A 4YHHT 1D1AA 2C0SA 2UUAT 3FZFB 2H3RA 3ZN0B 3WTMA 2YKSA 4B6XA 2WDVA 2IUBA 1WR6A 4X1YE 4ZZCA 5JDGA 3LK3B 4ISSA 2JQ9A 3SQ9A 4QH1A 5FL1A 3N9NA 2X9WA 3TLVA 3NBXX 4JEUB 2CA5A 1HCIA 1FMWA 1MNEA 3ZYMA 4EZ1A 3I9WA 2WNJA 2Y6XA 2BZBA 3PU3A 2JQKA 3AA6B 1LVKA 3IEEA 5H6RB 3N2OA 3A5XA 4K0UA 2YEVC 3PUWF 4N78D 5EK3A 4PJNA 2DNXA 5C2TA 2WB5A 4HFVA 4CXYA 4HEAA 2BG9A 3AEEA 3AE6A 2PBIA 3HKDE 2G0UA 1UCUA 3WTIA 1QSDA 3QNUA 3ZMZB 2NTXA 3RRCA 3RX6A 3AEBA 5JR9B 3IA3A 2NWBA 3E0ZA 2JIWA 4YSXA 2WN9A 3EUHA 4ZEYA 3EI0A 2QA7A 4IE5A 2LLYA 2WCAA 3ABVA 4HFCA 5LYJE 5F3JA 2NTYA 4QABA 2VL8A 1YQ4A 2BS3A 4EV6A 4HKAA 2A2FX 2WZYA 1OEDC 4XZCA 3RC8A 2X66A 2WAUA 3TLUA 2V6XA 3VHLA 2QGSA 4WZXA 4H63H 2BYNA 3SH1A 4DIDB 2W63A 2X9YA 2VKHA 5C3JA 5FVKA 3CX8B 2V6YA 4WV9A 3AAAB 4UF0B 2CMRA 2GK9A 5L2LA 4GK5E 5AQQB 5L3FB 4NUUA 1WYBA 1YD8G 2KT9A 2Q9QC 1XDOA 3SS1A 3F57A 5CGMA 3P4SA 4CI2B 4DMVA 2VKJA 5ABHA 5L47A 2E5LT 3DTOA 5EK4A 3N2GE 2WU2A 4TWHA 3FZMB 5HXCA 2VKDA 2V7JA 3OBVE 4OFZA 3NRXA 2ES0A 4JI6T 1UURA 3SRZA 4DR3T 4GIWA 1KEYA 4FI5A 2XZ5A 4CQIA 5FXXA 3CK6A 3UU3A 4ILBA 2NW7A 1E7PA 5FKYA 5DQWA 3AXJB 4UVAB 4CN6A 5TVCA 3N2KE 5J5FA 4MBQA 4I0UA 3OKQA 3O1HA 4NZBA 2IMLA 3L3PA 2PG8A 2M6IA 2DWKA 5J5IA 1ZOYA 2JQHA 1JNZA 5LBQB 2XQ8A 4AKRB 2XYSA 3TLSA 4HN9A 5L3BB 2I6HA 4KHPT 4WYVA 1HTJF 4YHJA 1IZNB 5LHHB 5JVDE 1GQEA 2XAGB 4B5DA 2D0UA 3KV6A 2UU9T 4ERRA 5ABFA 4MHCA 1KNRA 4YT0A 3BQIA 3D0TA 1MIVA 5F8PA 3JAFA 2W67A 3EABA 3AEFA 4U7IA 5HEOA 4LMLA 2Y58A 3KV4A 2KWIB 4CXWA 4ILCA 2XQ5A 2I59A 3ANWA 2HH7A 4H9OC 3MJXA 3K8PC 3UQ7A 3TLWA 4E7ZA 4O4JE 5J0ZA 2WWUA 3SIOA 2WNLA 3AE5A 1VCSA 2Y7YA 4TNWA 3PUSA 4B3RT 4H9NC 1KNPA 3EAMA 1BR4A 4YXDA 3HA4A 2XAJB 3RIUA 3RPUA 4AFTA 3PUVF 2X51A 5AQLB 1XDPA 4ILAA 1NEKA 4X66T 4AKGA 1IJ5A 4FRRA 2Y57A 3GN5B 5AQFB 4CI3B 2PTFA 2YDSA 2EHOB 2V7IA 2D0TA 5ABEA 5ADXL 3HL6A 3UQ4A 4JI7T 3OYXA 3VRAA 3MA9A 2NP9A 2UXBT 3QB5K 3KBTA 4F6RC 2LOPA 4U74A 2VB6A 4WBOA 3B57A 3F2EA 2WY2A 2E9XA 4PNIA 2K3WA 3UUNA 2KINB 3ONLC 5JR9A 4HWHA 3FB2A 3N9PA 3RI5A 3RYCE 2W2UA 2WU5A 4GKJT 2HPLA 1UK5A 2C9TA 1EZ3A 3AB3B 4QHOA 2EHOA 4UF0A 1VCTA 3CWZB 4BJNA 2LHRA 2E8IA 5AQPB 2LKHA 4YSZA 1M7KA 2CWOA 3RF1A 4YJ2E 4TN7B 2N9DA 3K3OA 2V7LA 4EAHA 1QLBA 2XASB 4PK6A 4GK0E 1YKHB 3B5MA 2K48A 4AQGA 4QXCB 5HXSA 3H3MA 2XAHB 3PDYA 5HXHA 4UXNB 3MACA 2MPKA 4H9RC 4PIRA 3AAEB 4HFHA 4HWFA 5LG3A 2DWGA 2V26A 5JDMA 2J1DG 2ZJUA 2CM0A 5AQMB 4DV4T 5LGNB 5L4EA 5LNKA 3RKGA 4HFDA 3UTKA 5BW2A 5DABA 3RIFA 4DR1T 3N5LA 3P50A 2X67A 2ZM0A 4NXMT 1N34T 2W62A 2YN6A 3MZKB 4IL4A 2UZ6A 3ZMUB 2RPAA 1US7B 2L8KA 3IGQA 3P8CD 1UX2A 4DNDA 4HQPA 1CUNA 4KX6A 1LRZA 3A7MA 2CBJA 2DI4A 4HWDA 5FVLA 5JDNA 1B7TA 2WS3A 3RHWA 2BYQA 3CQGB 2AE9A 5JH7E 4NXNT 3PMZA 3ZYLA 4KUMB 4EYYR 5J5GA 5J1GA 5AQJB 4UV8B 2LE8A 3VKHA 4NIQA 1UX4A 4TWDA 3ZPOA 1HS7A 5L4HA 2ACXA 3RRWA 5A1LA 2WBLA 2JMKA 2CXFA 3AE4A 3EDVA 4I43B 2IC6A 3LJCA 5JRCA 1WYCA 3LFMA 3U3IA 4UVCB 3TLTA 5HCJA 3U8NA 2CXDA 3U8MA 4TX5A 3T1YT 3OPCA 3AE8A 1R8IA 5FMNA 4PJLA 2WP9A 2Y54A 2BKNA 1T7SA 5AQHB 2IHR1 3Q9DA 4HGAA 5H6QB 2VL0A 4ZK4A 2UUBT 3L8RA 3ZSSA 5KDMC 3WTOA 3ZDHA 5M4YA 4ZI7E 4UELA 4U72A 3KV5A 4EXTA 2FBWA 4I4TE 1KFYA 1SUMB 3WTHA 4AKHA 3LBXB 2XHEB 4DVDA 1HNWT 4GOUA 2BYRA 3O1JA 1MNDA 4O4HE 4DR4T 1KK7A 3UFEA 2MBGA 4P09A 4H9SE 2AXDS 3ZT7A 2X68A 2FJEA 1MMAA 4PK4A 2WWVA 1HG2A 1H7CA 4WBNE 4A5XA 3GWHA 4COFA 3P4WA 3A8YC 1IAPA 2LRLA 3WAJA 3VKGA 1NENA 2LSYA 4K0KT 3K3NA 3ONXA 4PK5A 5FNVE 3SFEA 1SA0E 1LKXA 2K9AA 1J5ET 4UIGA 1X79A 5DQVA 5LP6E 5AFJA 1HX1B 4PFOA 4I50E 4QH5A 4UM1A 1U4QA 3T8OA 3IBPA 3C4WA 4M1PA 5L3GB 2BG9B 1MIWA 3RYIE 4ZZBA 3OVUA 1D0YA 3GMIA 2E9XB 4BA9A 4B3MT 4PFPA 2PJQA 3HKEE 3LK2B 4O2BE 5HEJA 4TZ4C 5IYZE 1W9RA 2D5UA 2X0HA 2DLRA 4DBMA 2XM2A 3E08A 4XBFB 1IBLT 5AQOB 2W8GA 4J2CA 5AFMB 3ZC1A 2XYTA 2Q9QA 2FJBA 4DV7T 2W00A 4ZS3A 5EZYE 4JI1T 5LGTB 4DV2T 5ABFB 2KXPB 2RA1A 4EEBA 2MOZA 4Z90A 5AFUL 2K5BB 4LFBT 3PU8A 4U33A 2XQ7A 3FZLB 5EK2A 2C5JA 4IHJE 5AQRB 2WMNA 2WDRA 3QUJA 5LCYA 3CKDA 2CBIA 2ODUA 2WMOA 2Q9QB 3CMLA 3AE2A 4X5TA 4XHEA 3O1IA 3CVRA 3L09A 3RYHE 2XZ6A 3VU7H 3AECA 4WW0A 4GYRA 5JDQA 3EVYA 4AFHA 3RYFE 5JDLA 3LDQB 2A9UA 3R84B 4U3CA 2SPCA 3Q5DA 4QXBB 1VOMA 2HHHT 5AQNB 4IREA 4JI5T 3TKLB 5CJ5A 5LG4A 5FY7A 4CN1A 4ALXA 3N9LA 1CHUA 1D0ZA 2XAFB 3ZEFB 3B13A 3QB5A 4JUYA 2K24A 2ZMAA 4IE0A 4ILUA 2DCFA 4A98A 5AFKA 3H3AA 4L0RA 3ZCIA 5JREA 4IIJE 5L3EB 3ZJ1A 3PJAA 2WZHA 5JR9C 2XM1A 2XSAA 4IDZA 1T98A 3I0OA 4BQTA 2XSBA 1BR0A 4IGUA 5AQKB 4KMCA 4JLEA 2P9BA 4QX7B 1WFDA 3ETUA 4A97A 3SFDA 1V9DA 4PAGA 4DR7T 2WZIA 2LHNA 2LM9A 2Y8DA 2W66A 3EDUA 2OLTA 1D0XA 1D1CA 3AE7A 3SQ6A 4QXHB 3UU8A 3ANWB 4X64T 2BG9E 1KNZA 2N1GA 4NPPA 2WM9A 2BG9C 5L3DB 4IE6A 1G8XA 4LF8T 3CQCB 3M3ZB 4UR9A 2XUEA 4QX8B 4ZJSA 2L3LA 3RQUA 3R6NA 4DV3T 3C64A 4X65T 1WR0A 4B3TT 4KBMB 3UFGA 1N33T 5IUXA 1E2AA 4A56A 1XNQT 5LHGB 4AQFA 2C5KT 4H9PC 3P7IA 4HWCA 4MLKA 2CCQA 4IE7A 4DV1T 2Q9QD 5HWXA 3V5SA 3QK6A 2VQET 2ZLYA 3ZN1B 2X0YA 1HG5A 1I9BA 2KNDA 2VURA 3RKOA 2YDQA 5AFNA 1U5PA 2VWAA 1BR1A 4AIUA 4V1Av 3WTJA 3AA7B 1VRBA 3JADA 3AVSA 3JCFA 1HNXT 2BS4A 4P1NA 2BS2A 1XMQT 3WAKA 2LKGA 5J2UE 4XK9A 2X9HA 2VVNA 2M6BA 3IF8B 2J47A 2ZM8A 3CQXC 2H88A 1NWMX 3SOLA 5CA1E 3T1HT 1IBMT 2ZM2A 4UM3S 2X9XA 3ZT6A 4YTMA 1MIYA 3WIPA 1W0AA 4CI1B 2HN1A 3AVRA 5CO5A 1OEDA 3PTRB 5LOVE 4ZI3C 2PH9A 1XMOT 1IJ6A 3ESLA 3U8LA 4U2YA 4BFQA 2W4XA 3QOFA 4EZ4A 2A3DA 2NOXA 4QKNA 3FZKB 4G2AA 4KP3C 2YK0A 3CX6B 2J62A 4DR6T 4UV9B 5FJVA 5CFBA 1OEDB 5JTGA 2CLYB 3ETVA 3ONJA 3UUXB 3P4PA 1OEDE 2WQYA 4ASKA 5KXJA 4ZOLE 4NUVA 4JI8T 2D2SA 3Q2MA 2E5VA 2IC9A 3L39A 3AE1A 4HWIB 3LK42 4KI0F 5JQGE 1MMNA 3PUGA 4HFBA 4YLHA 2V8SV 4HE8A 3F31A 1SHZC 3UUMA 2CXLA 2V5DA 5HXEA 3ZLIA 3AE9A 4DMWA 2XQ4A 2Y48B 2BVMA 2VVSA 2FUPA 3I0QA 4CXXA 1BR2A 3UU6A 1Z8UA 5CB4E 2ZM6T 2XPKA 4OK0A 4AKLA 5HAXA 1AJ3A 5LGUB 3PUZF 3ZCJA 4U7YA 3N9MA 5LXTE 3LG7A 3PUYF 4L9IA 1OWAA 2A72A 3PE0A 3BQLA 4C91A 2LRKA 2B1EA 2LSKA 4IE4A 4TV8E 2KLQA 1T72A 3AA1B 4DUYT 4KHZF 5E0OA 2LSIA 4X1IE 2BDEA 3P4QA 1LVFA 5LJMA 5LB7B 1UV6A 4MFRA 3PUQA 5LHIB 3NVOA 1OXZA 2JJ9A 5LJNA 3CX7B 3N9QA 3JC6C 5KMGP 4E7SA 4AQYT 1N32T 2IW5B 2XQ3A 2QC1B 4UM3P 4JI0T 1X9BA 2XQ9A 3C84A 5AQSB 4IDQA 4O4IE 3AE3A 3AEGA 2MTQA 3RLFF 2M67A 5JDHA 1I94T 2YINA 3PURA 4IL9A 5JRCB 5BR8T 2DL1A 2KZ7B 4QH4A 3KFWX 4JEHB 3C4XA 3ZC0A 3PEOA 3FXDB 3PJAJ 3O4XE 3KV9A 5AQGB 2OV9A 1WCRA 2PFVA 2LEHA 2BBHA 2Y56A 2CPTA 1G73A 2CLYC 1N36T 4BJMA 4DBQA 5AFLA 5BMVE 4QWNB 2L9QA 2MAWA 2YDRA 3KDSE 1O3XA 3Q5EA 5TAOA 2X0LB 3H37A 2JRKA 2ACZA 3HR0A 2VK9A 2WNCA 1MMGA 1I6ZA 1FEWA 2X00D 4P0BA 4DR2T 4TWFA 3AEDA 3UUBA 2LJLA 3AXJA 2C5IT 4Z91A 2EHOC 1J5WA 2YMEA 3C50A 5LMNT 3HKBE 5AQTB 2CHOA 3S4UA 5CA0E 4ZRUA 3HKCE 2EHOD 3C51A 3KBUA 4LFCT 4P0AA 3G06A 5ETWA 4GKKT 3MXZA 1Y64B 2E9XD 2IAKA 4YJ3E 4DV0T 3GA8A 3PV0F 3E22E 2RP4A 4AQFC 5IWAT 2CHNA 4ADZA 4U2ZA 4O8SA 4LF7T 4I55E 1YQ3A 3ZSTA 4EEDA 1HF8A 4EIWA 5J2TE 4YTNA 2BBJA 3CPZA 2HN2A 2CWYA 3ZMTB 5HWYA 1HNZT 2UUCT 2FJDA 1Z0PA 4EB6E 2JPFA 3U8JA 2UXXB 4TV9E 5HCMA 5KZUA 3RIUC 5AFMA 4TUYE 4G63A 4ZI2D 4F8HA 3KINB 5BRXA 2KSRA 4DR5T 2XNVA 2W8FA 3ZT5A 4AISA 3BK9A 3KVBA 3EHZA 4X1KE 4ZI2C 2VQFT 4JI4T 3FBZA 3UU5A 1WRDA 2W61A 1YKEB 4OYKA 4O4LE 2MYSA 1ZKEA 1JNRA 2BVLA 2ZJVA 2CE7A 3C98B 3IHRA 3J7Yq 3WTKA 1ZP0A 3AAIA 5FXZA 5F5WA 3I9YA 1W09A 4ZS2A 2Z6EA 1YW0A 4OHFA 4LF4T 3PUXF 2LM2A 5FP3A 2D9DA 1MMDA 3GN5A 4GYSA 3UU4A 3SWHA 2F4VT 5LBMA 1UW6A 1HX8A 1DU2A 2I0MA 2VKOA 5FY1A 4HFIA 4UXUA 2XQAA 2XQ6A 3AA0B 3NKZA 1D1BA 4LF6T 1XWMA 3ZMSB 4OYJA 4FJOA 2QRXA 4IDPA 1SE7A 2KWHA 5KE4A 4XAXB 3VR9A 4DUZT 2NR4A 3Q5XA 2UXDT 2XTLA 5JDFA 2WDQA 5FY0A 2FJAA 2X00A 5BP0A 1XNRT 2V1DB 2LOSA 3GUAA 3C4ZA 4PW8A 5HYAA 2JMHA 3JC6D 2JQQA 2R6GF 1KF6A 4X20E 3NZQA 2UXNB 3C79A 4ZJTA 1UUSA 2HPJA 2NW9A 3DP7A 3N9OA 2IDOB 5FL0A 2XNTA 3RC3A 4Q25A 4ZR6A 4IT4A 4U31A 2B76A 2BKOA 4QACA 4X62T 5LXBA 4EZHA 4LMKA 3M65A 2V6YB 4Z8XA 2CEAA 1YXRA 3K3QC 1W0BA 2LSJA 2N2NA 3ZMVB 4UVBB 1UX5A 4YFSA 2VASA 4JI3T 4IDOA 3RIAA 5AFHA 1T8BA 1M62A 2CRBA 3BQKA 4L5GA 4PJMA 2QVAA 5DJQC 4AI6A 3VRBA 1NAFA 3HI2A 4IDNA 1FJGT 2XZEA 4WNKA 2QYWA 5AQVB 2BYSA 4JV5T 1ZHCA 3NWIA 3AEAA 2H7OA 2V7KA 3RQWA 3UULA 2WSSV 4D01A 4YY3T 3ZKRA 1ZEEA 1HFAA 3Q5WA 4H63V 4ANJA 2E9XC 5J5HA 4O2AE 1FIOA 2H89A 2LT3A 5HEHA 1HR0T 3LSVA 4ZK1A 2J4GA 3FZHB 3MK7C 2XY8B 2W0GA 3MKDA 4DBRA 2YMDA 5AINA 3WI3A 3ZJ2A 2XQYA 1ZV4X 3NZPA 4DV6T 4YSYA 1FMVA 3K1SA 1XZYA 4C90A 5AQIB 3OJAA 4AFGA 5KX5E 1L0VA 2XJ7A 3O9XA 4LF9T 2XNUA 4PJJA 1IBKT 2BKPA 5HEGA 2DHRA 5ABGA 4HFEA 5SYOA 3FXEB 3PUAA 5LA6E 3I1AA 2YOEA 3ZYKA 4TNVA 5HXRA 4OX9T 4YTPA 5FYMA 4LF5T 4JYAT 4AKIA 2XAQB 5AQUB 3JAEA 2V7MA 4CN4A 3P4RA 4CZZB 3UT5E 3T4MA 5FXVA 3WTNA 4JBWF 3CIRA 3U78A 2E2AA 2OA5A 3FBLA 3VR8A 4ZHQE 2PGZA 4UM3A 4QAAA 2BR7A 3OTOT 3U8KA 2V5CA 2BYPA 3ZDGA 3W15B 4LMJA 3X1DA 4UEMA 4EGWA 2YU2A 1E1HB 4HTEA 1S94A
chains in the Genus database with same CATH topology
2YN6A 4IL4A 2UZ6A 5HEJA 5IUXA 4ALXA 3WTHA 3JAFA 5FJVA 5CFBA 3IGQA 1OEDB 2BG9A 1UV6A 5HEOA 4LMLA 1UX2A 5L47A 4QACA 2Y58A 5LXBA 4HQPA 4AFGA 3RI5A 4LMKA 2LM2A 4ILCA 2BYRA 1OEDE 2XQ5A 2XNUA 3RHWA 2BYQA 2C9TA 4TWHA 4A98A 5AFKA 4DBMA 3WTIA 3UQ7A 3UU4A 3TLWA 3PMZA 5HEUA 5HEGA 1I9BA 5J0ZA 4UY2A 2XQ3A 2LKHA 2QC1B 2W8GA 1UW6A 4UM3P 2XQ9A 5AFNA 5J5GA 3SIOA 5AFMB 3C84A 2WNLA 4HFBA 2XYTA 2Y7YA 3RIAA 5AFHA 4HFIA 4TWDA 4HFEA 3UU3A 2XZ5A 4UXUA 2WN9A 2XQAA 5L4HA 5SYOA 3WTJA 4ILBA 4TNWA 2XQ6A 3EI0A 3JADA 4IL9A 2YOEA 2BR8A 2LLYA 4BQTA 3EAMA 4COFA 4QH4A 2LKGA 2XQ4A 3P4WA 3TLTA 5HCJA 4XK9A 4TNVA 4HFCA 2BYSA 3U8NA 4AFTA 3PEOA 5KE4A 4Z90A 5TVCA 4QABA 3WTLA 4ILAA 2M6BA 5J5FA 3RQWA 2XQ7A 4A97A 3UU6A 3U8MA 3U8JA 3JAEA 2Y56A 5HCMA 4NZBA 4FRRA 2WZYA 4D01A 2Y57A 1OEDC 5JMEA 3ZKRA 5KZUA 5AFLA 2BJ0A 3TLUA 3T4MA 2M6IA 2X00A 5AFMA 5J5IA 5BP0A 3WTMA 4F8HA 3WTNA 2YKSA 3GUAA 2MAWA 5BRXA 2KSRA 2XNVA 4UM3S 2W8FA 2XQ8A 3SQ6A 2BYNA 2XYSA 5J5HA 3TLSA 2Y54A 4X5TA 3UU8A 4PIRA 3SH1A 3EHZA 4XHEA 5AFJA 4HFHA 5LG3A 3UU5A 2BG9E 4ZZCA 2PGZA 2XZ6A 4QH5A 5HEHA 2ZJUA 3WIPA 3UQ4A 2WNCA 4NPPA 4UM1A 4UM3A 4QAAA 2BR7A 2VL0A 3SQ9A 3U8KA 4WV9A 4QH1A 2X00D 3C79A 4AFHA 4ZJTA 2BG9C 5L4EA 3TLVA 5CO5A 4ZK4A 4TWFA 2BYPA 1OEDA 3LSVA 3ZDGA 4HFDA 4ZK1A 2BG9B 3UUBA 4B5DA 2ZJVA 2PH9A 4EZ1A 5BW2A 4LMJA 2WNJA 3WTOA 3ZDHA 3RIFA 4ZJSA 3RQUA 4Z91A 4ZZBA 3U8LA 2XNTA 2YMEA 3P50A 4BFQA 2YMDA 5AINA 4IREA 4ZR6A 3WTKA 4ZRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YN6 A;  4IL4 A;  2UZ6 A;  5HEJ A;  5IUX A;  4ALX A;  3WTH A;  3JAF A;  5FJV A;  5CFB A;  3IGQ A;  1OED B;  2BG9 A;  1UV6 A;  5HEO A;  4LML A;  1UX2 A;  5L47 A;  4QAC A;  2Y58 A;  5LXB A;  4HQP A;  4AFG A;  3RI5 A;  4LMK A;  2LM2 A;  4ILC A;  2BYR A;  1OED E;  2XQ5 A;  2XNU A;  3RHW A;  2BYQ A;  2C9T A;  4TWH A;  4A98 A;  5AFK A;  4DBM A;  3WTI A;  3UQ7 A;  3UU4 A;  3TLW A;  3PMZ A;  5HEU A;  5HEG A;  1I9B A;  5J0Z A;  4UY2 A;  2XQ3 A;  2LKH A;  2QC1 B;  2W8G A;  1UW6 A;  4UM3 P;  2XQ9 A;  5AFN A;  5J5G A;  3SIO A;  5AFM B;  3C84 A;  2WNL A;  4HFB A;  2XYT A;  2Y7Y A;  3RIA A;  5AFH A;  4HFI A;  4TWD A;  4HFE A;  3UU3 A;  2XZ5 A;  4UXU A;  2WN9 A;  2XQA A;  5L4H A;  5SYO A;  3WTJ A;  4ILB A;  4TNW A;  2XQ6 A;  3EI0 A;  3JAD A;  4IL9 A;  2YOE A;  2BR8 A;  2LLY A;  4BQT A;  3EAM A;  4COF A;  4QH4 A;  2LKG A;  2XQ4 A;  3P4W A;  3TLT A;  5HCJ A;  4XK9 A;  4TNV A;  4HFC A;  2BYS A;  3U8N A;  4AFT A;  3PEO A;  5KE4 A;  4Z90 A;  5TVC A;  4QAB A;  3WTL A;  4ILA A;  2M6B A;  5J5F A;  3RQW A;  2XQ7 A;  4A97 A;  3UU6 A;  3U8M A;  3U8J A;  3JAE A;  2Y56 A;  5HCM A;  4NZB A;  4FRR A;  2WZY A;  4D01 A;  2Y57 A;  1OED C;  5JME A;  3ZKR A;  5KZU A;  5AFL A;  2BJ0 A;  3TLU A;  3T4M A;  2M6I A;  2X00 A;  5AFM A;  5J5I A;  5BP0 A;  3WTM A;  4F8H A;  3WTN A;  2YKS A;  3GUA A;  2MAW A;  5BRX A;  2KSR A;  2XNV A;  4UM3 S;  2W8F A;  2XQ8 A;  3SQ6 A;  2BYN A;  2XYS A;  5J5H A;  3TLS A;  2Y54 A;  4X5T A;  3UU8 A;  4PIR A;  3SH1 A;  3EHZ A;  4XHE A;  5AFJ A;  4HFH A;  5LG3 A;  3UU5 A;  2BG9 E;  4ZZC A;  2PGZ A;  2XZ6 A;  4QH5 A;  5HEH A;  2ZJU A;  3WIP A;  3UQ4 A;  2WNC A;  4NPP A;  4UM1 A;  4UM3 A;  4QAA A;  2BR7 A;  2VL0 A;  3SQ9 A;  3U8K A;  4WV9 A;  4QH1 A;  2X00 D;  3C79 A;  4AFH A;  4ZJT A;  2BG9 C;  5L4E A;  3TLV A;  5CO5 A;  4ZK4 A;  4TWF A;  2BYP A;  1OED A;  3LSV A;  3ZDG A;  4HFD A;  4ZK1 A;  2BG9 B;  3UUB A;  4B5D A;  2ZJV A;  2PH9 A;  4EZ1 A;  5BW2 A;  4LMJ A;  2WNJ A;  3WTO A;  3ZDH A;  3RIF A;  4ZJS A;  3RQU A;  4Z91 A;  4ZZB A;  3U8L A;  2XNT A;  2YME A;  3P50 A;  4BFQ A;  2YMD A;  5AIN A;  4IRE A;  4ZR6 A;  3WTK A;  4ZRU A; 
#chains in the Genus database with same CATH topology
 2ODV A;  2LSG A;  5FXW A;  2NW8 A;  5C8Y E;  4ZI3 D;  5L3C B;  2YU1 A;  1QUU A;  3KVA A;  2KMF A;  5IHY A;  4MAL A;  2H7V C;  5HEU A;  3V5U A;  5GON E;  4DV5 T;  4UY2 A;  4JI2 T;  1Y01 A;  3LBX A;  2IIU A;  4BAY B;  1WLX A;  4EYU A;  5LMU T;  3NRY A;  1J1J A;  4B3S T;  4EOZ B;  2BR8 A;  3J9X 1;  1S35 A;  4H9Q C;  4AXP A;  2UXC T;  4DO0 A;  1UGO A;  3WTL A;  4LFA T;  4IST A;  3OYZ A;  3QC9 A;  3RH3 A;  3FHN A;  4ZXL A;  5JME A;  3DJB A;  3RGL A;  2BJ0 A;  4YHH T;  1D1A A;  2C0S A;  2UUA T;  3FZF B;  2H3R A;  3ZN0 B;  3WTM A;  2YKS A;  4B6X A;  2WDV A;  2IUB A;  1WR6 A;  4X1Y E;  4ZZC A;  5JDG A;  3LK3 B;  4ISS A;  2JQ9 A;  3SQ9 A;  4QH1 A;  5FL1 A;  3N9N A;  2X9W A;  3TLV A;  3NBX X;  4JEU B;  2CA5 A;  1HCI A;  1FMW A;  1MNE A;  3ZYM A;  4EZ1 A;  3I9W A;  2WNJ A;  2Y6X A;  2BZB A;  3PU3 A;  2JQK A;  3AA6 B;  1LVK A;  3IEE A;  5H6R B;  3N2O A;  3A5X A;  4K0U A;  2YEV C;  3PUW F;  4N78 D;  5EK3 A;  4PJN A;  2DNX A;  5C2T A;  2WB5 A;  4HFV A;  4CXY A;  4HEA A;  2BG9 A;  3AEE A;  3AE6 A;  2PBI A;  3HKD E;  2G0U A;  1UCU A;  3WTI A;  1QSD A;  3QNU A;  3ZMZ B;  2NTX A;  3RRC A;  3RX6 A;  3AEB A;  5JR9 B;  3IA3 A;  2NWB A;  3E0Z A;  2JIW A;  4YSX A;  2WN9 A;  3EUH A;  4ZEY A;  3EI0 A;  2QA7 A;  4IE5 A;  2LLY A;  2WCA A;  3ABV A;  4HFC A;  5LYJ E;  5F3J A;  2NTY A;  4QAB A;  2VL8 A;  1YQ4 A;  2BS3 A;  4EV6 A;  4HKA A;  2A2F X;  2WZY A;  1OED C;  4XZC A;  3RC8 A;  2X66 A;  2WAU A;  3TLU A;  2V6X A;  3VHL A;  2QGS A;  4WZX A;  4H63 H;  2BYN A;  3SH1 A;  4DID B;  2W63 A;  2X9Y A;  2VKH A;  5C3J A;  5FVK A;  3CX8 B;  2V6Y A;  4WV9 A;  3AAA B;  4UF0 B;  2CMR A;  2GK9 A;  5L2L A;  4GK5 E;  5AQQ B;  5L3F B;  4NUU A;  1WYB A;  1YD8 G;  2KT9 A;  2Q9Q C;  1XDO A;  3SS1 A;  3F57 A;  5CGM A;  3P4S A;  4CI2 B;  4DMV A;  2VKJ A;  5ABH A;  5L47 A;  2E5L T;  3DTO A;  5EK4 A;  3N2G E;  2WU2 A;  4TWH A;  3FZM B;  5HXC A;  2VKD A;  2V7J A;  3OBV E;  4OFZ A;  3NRX A;  2ES0 A;  4JI6 T;  1UUR A;  3SRZ A;  4DR3 T;  4GIW A;  1KEY A;  4FI5 A;  2XZ5 A;  4CQI A;  5FXX A;  3CK6 A;  3UU3 A;  4ILB A;  2NW7 A;  1E7P A;  5FKY A;  5DQW A;  3AXJ B;  4UVA B;  4CN6 A;  5TVC A;  3N2K E;  5J5F A;  4MBQ A;  4I0U A;  3OKQ A;  3O1H A;  4NZB A;  2IML A;  3L3P A;  2PG8 A;  2M6I A;  2DWK A;  5J5I A;  1ZOY A;  2JQH A;  1JNZ A;  5LBQ B;  2XQ8 A;  4AKR B;  2XYS A;  3TLS A;  4HN9 A;  5L3B B;  2I6H A;  4KHP T;  4WYV A;  1HTJ F;  4YHJ A;  1IZN B;  5LHH B;  5JVD E;  1GQE A;  2XAG B;  4B5D A;  2D0U A;  3KV6 A;  2UU9 T;  4ERR A;  5ABF A;  4MHC A;  1KNR A;  4YT0 A;  3BQI A;  3D0T A;  1MIV A;  5F8P A;  3JAF A;  2W67 A;  3EAB A;  3AEF A;  4U7I A;  5HEO A;  4LML A;  2Y58 A;  3KV4 A;  2KWI B;  4CXW A;  4ILC A;  2XQ5 A;  2I59 A;  3ANW A;  2HH7 A;  4H9O C;  3MJX A;  3K8P C;  3UQ7 A;  3TLW A;  4E7Z A;  4O4J E;  5J0Z A;  2WWU A;  3SIO A;  2WNL A;  3AE5 A;  1VCS A;  2Y7Y A;  4TNW A;  3PUS A;  4B3R T;  4H9N C;  1KNP A;  3EAM A;  1BR4 A;  4YXD A;  3HA4 A;  2XAJ B;  3RIU A;  3RPU A;  4AFT A;  3PUV F;  2X51 A;  5AQL B;  1XDP A;  4ILA A;  1NEK A;  4X66 T;  4AKG A;  1IJ5 A;  4FRR A;  2Y57 A;  3GN5 B;  5AQF B;  4CI3 B;  2PTF A;  2YDS A;  2EHO B;  2V7I A;  2D0T A;  5ABE A;  5ADX L;  3HL6 A;  3UQ4 A;  4JI7 T;  3OYX A;  3VRA A;  3MA9 A;  2NP9 A;  2UXB T;  3QB5 K;  3KBT A;  4F6R C;  2LOP A;  4U74 A;  2VB6 A;  4WBO A;  3B57 A;  3F2E A;  2WY2 A;  2E9X A;  4PNI A;  2K3W A;  3UUN A;  2KIN B;  3ONL C;  5JR9 A;  4HWH A;  3FB2 A;  3N9P A;  3RI5 A;  3RYC E;  2W2U A;  2WU5 A;  4GKJ T;  2HPL A;  1UK5 A;  2C9T A;  1EZ3 A;  3AB3 B;  4QHO A;  2EHO A;  4UF0 A;  1VCT A;  3CWZ B;  4BJN A;  2LHR A;  2E8I A;  5AQP B;  2LKH A;  4YSZ A;  1M7K A;  2CWO A;  3RF1 A;  4YJ2 E;  4TN7 B;  2N9D A;  3K3O A;  2V7L A;  4EAH A;  1QLB A;  2XAS B;  4PK6 A;  4GK0 E;  1YKH B;  3B5M A;  2K48 A;  4AQG A;  4QXC B;  5HXS A;  3H3M A;  2XAH B;  3PDY A;  5HXH A;  4UXN B;  3MAC A;  2MPK A;  4H9R C;  4PIR A;  3AAE B;  4HFH A;  4HWF A;  5LG3 A;  2DWG A;  2V26 A;  5JDM A;  2J1D G;  2ZJU A;  2CM0 A;  5AQM B;  4DV4 T;  5LGN B;  5L4E A;  5LNK A;  3RKG A;  4HFD A;  3UTK A;  5BW2 A;  5DAB A;  3RIF A;  4DR1 T;  3N5L A;  3P50 A;  2X67 A;  2ZM0 A;  4NXM T;  1N34 T;  2W62 A;  2YN6 A;  3MZK B;  4IL4 A;  2UZ6 A;  3ZMU B;  2RPA A;  1US7 B;  2L8K A;  3IGQ A;  3P8C D;  1UX2 A;  4DND A;  4HQP A;  1CUN A;  4KX6 A;  1LRZ A;  3A7M A;  2CBJ A;  2DI4 A;  4HWD A;  5FVL A;  5JDN A;  1B7T A;  2WS3 A;  3RHW A;  2BYQ A;  3CQG B;  2AE9 A;  5JH7 E;  4NXN T;  3PMZ A;  3ZYL A;  4KUM B;  4EYY R;  5J5G A;  5J1G A;  5AQJ B;  4UV8 B;  2LE8 A;  3VKH A;  4NIQ A;  1UX4 A;  4TWD A;  3ZPO A;  1HS7 A;  5L4H A;  2ACX A;  3RRW A;  5A1L A;  2WBL A;  2JMK A;  2CXF A;  3AE4 A;  3EDV A;  4I43 B;  2IC6 A;  3LJC A;  5JRC A;  1WYC A;  3LFM A;  3U3I A;  4UVC B;  3TLT A;  5HCJ A;  3U8N A;  2CXD A;  3U8M A;  4TX5 A;  3T1Y T;  3OPC A;  3AE8 A;  1R8I A;  5FMN A;  4PJL A;  2WP9 A;  2Y54 A;  2BKN A;  1T7S A;  5AQH B;  2IHR 1;  3Q9D A;  4HGA A;  5H6Q B;  2VL0 A;  4ZK4 A;  2UUB T;  3L8R A;  3ZSS A;  5KDM C;  3WTO A;  3ZDH A;  5M4Y A;  4ZI7 E;  4UEL A;  4U72 A;  3KV5 A;  4EXT A;  2FBW A;  4I4T E;  1KFY A;  1SUM B;  3WTH A;  4AKH A;  3LBX B;  2XHE B;  4DVD A;  1HNW T;  4GOU A;  2BYR A;  3O1J A;  1MND A;  4O4H E;  4DR4 T;  1KK7 A;  3UFE A;  2MBG A;  4P09 A;  4H9S E;  2AXD S;  3ZT7 A;  2X68 A;  2FJE A;  1MMA A;  4PK4 A;  2WWV A;  1HG2 A;  1H7C A;  4WBN E;  4A5X A;  3GWH A;  4COF A;  3P4W A;  3A8Y C;  1IAP A;  2LRL A;  3WAJ A;  3VKG A;  1NEN A;  2LSY A;  4K0K T;  3K3N A;  3ONX A;  4PK5 A;  5FNV E;  3SFE A;  1SA0 E;  1LKX A;  2K9A A;  1J5E T;  4UIG A;  1X79 A;  5DQV A;  5LP6 E;  5AFJ A;  1HX1 B;  4PFO A;  4I50 E;  4QH5 A;  4UM1 A;  1U4Q A;  3T8O A;  3IBP A;  3C4W A;  4M1P A;  5L3G B;  2BG9 B;  1MIW A;  3RYI E;  4ZZB A;  3OVU A;  1D0Y A;  3GMI A;  2E9X B;  4BA9 A;  4B3M T;  4PFP A;  2PJQ A;  3HKE E;  3LK2 B;  4O2B E;  5HEJ A;  4TZ4 C;  5IYZ E;  1W9R A;  2D5U A;  2X0H A;  2DLR A;  4DBM A;  2XM2 A;  3E08 A;  4XBF B;  1IBL T;  5AQO B;  2W8G A;  4J2C A;  5AFM B;  3ZC1 A;  2XYT A;  2Q9Q A;  2FJB A;  4DV7 T;  2W00 A;  4ZS3 A;  5EZY E;  4JI1 T;  5LGT B;  4DV2 T;  5ABF B;  2KXP B;  2RA1 A;  4EEB A;  2MOZ A;  4Z90 A;  5AFU L;  2K5B B;  4LFB T;  3PU8 A;  4U33 A;  2XQ7 A;  3FZL B;  5EK2 A;  2C5J A;  4IHJ E;  5AQR B;  2WMN A;  2WDR A;  3QUJ A;  5LCY A;  3CKD A;  2CBI A;  2ODU A;  2WMO A;  2Q9Q B;  3CML A;  3AE2 A;  4X5T A;  4XHE A;  3O1I A;  3CVR A;  3L09 A;  3RYH E;  2XZ6 A;  3VU7 H;  3AEC A;  4WW0 A;  4GYR A;  5JDQ A;  3EVY A;  4AFH A;  3RYF E;  5JDL A;  3LDQ B;  2A9U A;  3R84 B;  4U3C A;  2SPC A;  3Q5D A;  4QXB B;  1VOM A;  2HHH T;  5AQN B;  4IRE A;  4JI5 T;  3TKL B;  5CJ5 A;  5LG4 A;  5FY7 A;  4CN1 A;  4ALX A;  3N9L A;  1CHU A;  1D0Z A;  2XAF B;  3ZEF B;  3B13 A;  3QB5 A;  4JUY A;  2K24 A;  2ZMA A;  4IE0 A;  4ILU A;  2DCF A;  4A98 A;  5AFK A;  3H3A A;  4L0R A;  3ZCI A;  5JRE A;  4IIJ E;  5L3E B;  3ZJ1 A;  3PJA A;  2WZH A;  5JR9 C;  2XM1 A;  2XSA A;  4IDZ A;  1T98 A;  3I0O A;  4BQT A;  2XSB A;  1BR0 A;  4IGU A;  5AQK B;  4KMC A;  4JLE A;  2P9B A;  4QX7 B;  1WFD A;  3ETU A;  4A97 A;  3SFD A;  1V9D A;  4PAG A;  4DR7 T;  2WZI A;  2LHN A;  2LM9 A;  2Y8D A;  2W66 A;  3EDU A;  2OLT A;  1D0X A;  1D1C A;  3AE7 A;  3SQ6 A;  4QXH B;  3UU8 A;  3ANW B;  4X64 T;  2BG9 E;  1KNZ A;  2N1G A;  4NPP A;  2WM9 A;  2BG9 C;  5L3D B;  4IE6 A;  1G8X A;  4LF8 T;  3CQC B;  3M3Z B;  4UR9 A;  2XUE A;  4QX8 B;  4ZJS A;  2L3L A;  3RQU A;  3R6N A;  4DV3 T;  3C64 A;  4X65 T;  1WR0 A;  4B3T T;  4KBM B;  3UFG A;  1N33 T;  5IUX A;  1E2A A;  4A56 A;  1XNQ T;  5LHG B;  4AQF A;  2C5K T;  4H9P C;  3P7I A;  4HWC A;  4MLK A;  2CCQ A;  4IE7 A;  4DV1 T;  2Q9Q D;  5HWX A;  3V5S A;  3QK6 A;  2VQE T;  2ZLY A;  3ZN1 B;  2X0Y A;  1HG5 A;  1I9B A;  2KND A;  2VUR A;  3RKO A;  2YDQ A;  5AFN A;  1U5P A;  2VWA A;  1BR1 A;  4AIU A;  4V1A v;  3WTJ A;  3AA7 B;  1VRB A;  3JAD A;  3AVS A;  3JCF A;  1HNX T;  2BS4 A;  4P1N A;  2BS2 A;  1XMQ T;  3WAK A;  2LKG A;  5J2U E;  4XK9 A;  2X9H A;  2VVN A;  2M6B A;  3IF8 B;  2J47 A;  2ZM8 A;  3CQX C;  2H88 A;  1NWM X;  3SOL A;  5CA1 E;  3T1H T;  1IBM T;  2ZM2 A;  4UM3 S;  2X9X A;  3ZT6 A;  4YTM A;  1MIY A;  3WIP A;  1W0A A;  4CI1 B;  2HN1 A;  3AVR A;  5CO5 A;  1OED A;  3PTR B;  5LOV E;  4ZI3 C;  2PH9 A;  1XMO T;  1IJ6 A;  3ESL A;  3U8L A;  4U2Y A;  4BFQ A;  2W4X A;  3QOF A;  4EZ4 A;  2A3D A;  2NOX A;  4QKN A;  3FZK B;  4G2A A;  4KP3 C;  2YK0 A;  3CX6 B;  2J62 A;  4DR6 T;  4UV9 B;  5FJV A;  5CFB A;  1OED B;  5JTG A;  2CLY B;  3ETV A;  3ONJ A;  3UUX B;  3P4P A;  1OED E;  2WQY A;  4ASK A;  5KXJ A;  4ZOL E;  4NUV A;  4JI8 T;  2D2S A;  3Q2M A;  2E5V A;  2IC9 A;  3L39 A;  3AE1 A;  4HWI B;  3LK4 2;  4KI0 F;  5JQG E;  1MMN A;  3PUG A;  4HFB A;  4YLH A;  2V8S V;  4HE8 A;  3F31 A;  1SHZ C;  3UUM A;  2CXL A;  2V5D A;  5HXE A;  3ZLI A;  3AE9 A;  4DMW A;  2XQ4 A;  2Y48 B;  2BVM A;  2VVS A;  2FUP A;  3I0Q A;  4CXX A;  1BR2 A;  3UU6 A;  1Z8U A;  5CB4 E;  2ZM6 T;  2XPK A;  4OK0 A;  4AKL A;  5HAX A;  1AJ3 A;  5LGU B;  3PUZ F;  3ZCJ A;  4U7Y A;  3N9M A;  5LXT E;  3LG7 A;  3PUY F;  4L9I A;  1OWA A;  2A72 A;  3PE0 A;  3BQL A;  4C91 A;  2LRK A;  2B1E A;  2LSK A;  4IE4 A;  4TV8 E;  2KLQ A;  1T72 A;  3AA1 B;  4DUY T;  4KHZ F;  5E0O A;  2LSI A;  4X1I E;  2BDE A;  3P4Q A;  1LVF A;  5LJM A;  5LB7 B;  1UV6 A;  4MFR A;  3PUQ A;  5LHI B;  3NVO A;  1OXZ A;  2JJ9 A;  5LJN A;  3CX7 B;  3N9Q A;  3JC6 C;  5KMG P;  4E7S A;  4AQY T;  1N32 T;  2IW5 B;  2XQ3 A;  2QC1 B;  4UM3 P;  4JI0 T;  1X9B A;  2XQ9 A;  3C84 A;  5AQS B;  4IDQ A;  4O4I E;  3AE3 A;  3AEG A;  2MTQ A;  3RLF F;  2M67 A;  5JDH A;  1I94 T;  2YIN A;  3PUR A;  4IL9 A;  5JRC B;  5BR8 T;  2DL1 A;  2KZ7 B;  4QH4 A;  3KFW X;  4JEH B;  3C4X A;  3ZC0 A;  3PEO A;  3FXD B;  3PJA J;  3O4X E;  3KV9 A;  5AQG B;  2OV9 A;  1WCR A;  2PFV A;  2LEH A;  2BBH A;  2Y56 A;  2CPT A;  1G73 A;  2CLY C;  1N36 T;  4BJM A;  4DBQ A;  5AFL A;  5BMV E;  4QWN B;  2L9Q A;  2MAW A;  2YDR A;  3KDS E;  1O3X A;  3Q5E A;  5TAO A;  2X0L B;  3H37 A;  2JRK A;  2ACZ A;  3HR0 A;  2VK9 A;  2WNC A;  1MMG A;  1I6Z A;  1FEW A;  2X00 D;  4P0B A;  4DR2 T;  4TWF A;  3AED A;  3UUB A;  2LJL A;  3AXJ A;  2C5I T;  4Z91 A;  2EHO C;  1J5W A;  2YME A;  3C50 A;  5LMN T;  3HKB E;  5AQT B;  2CHO A;  3S4U A;  5CA0 E;  4ZRU A;  3HKC E;  2EHO D;  3C51 A;  3KBU A;  4LFC T;  4P0A A;  3G06 A;  5ETW A;  4GKK T;  3MXZ A;  1Y64 B;  2E9X D;  2IAK A;  4YJ3 E;  4DV0 T;  3GA8 A;  3PV0 F;  3E22 E;  2RP4 A;  4AQF C;  5IWA T;  2CHN A;  4ADZ A;  4U2Z A;  4O8S A;  4LF7 T;  4I55 E;  1YQ3 A;  3ZST A;  4EED A;  1HF8 A;  4EIW A;  5J2T E;  4YTN A;  2BBJ A;  3CPZ A;  2HN2 A;  2CWY A;  3ZMT B;  5HWY A;  1HNZ T;  2UUC T;  2FJD A;  1Z0P A;  4EB6 E;  2JPF A;  3U8J A;  2UXX B;  4TV9 E;  5HCM A;  5KZU A;  3RIU C;  5AFM A;  4TUY E;  4G63 A;  4ZI2 D;  4F8H A;  3KIN B;  5BRX A;  2KSR A;  4DR5 T;  2XNV A;  2W8F A;  3ZT5 A;  4AIS A;  3BK9 A;  3KVB A;  3EHZ A;  4X1K E;  4ZI2 C;  2VQF T;  4JI4 T;  3FBZ A;  3UU5 A;  1WRD A;  2W61 A;  1YKE B;  4OYK A;  4O4L E;  2MYS A;  1ZKE A;  1JNR A;  2BVL A;  2ZJV A;  2CE7 A;  3C98 B;  3IHR A;  3J7Y q;  3WTK A;  1ZP0 A;  3AAI A;  5FXZ A;  5F5W A;  3I9Y A;  1W09 A;  4ZS2 A;  2Z6E A;  1YW0 A;  4OHF A;  4LF4 T;  3PUX F;  2LM2 A;  5FP3 A;  2D9D A;  1MMD A;  3GN5 A;  4GYS A;  3UU4 A;  3SWH A;  2F4V T;  5LBM A;  1UW6 A;  1HX8 A;  1DU2 A;  2I0M A;  2VKO A;  5FY1 A;  4HFI A;  4UXU A;  2XQA A;  2XQ6 A;  3AA0 B;  3NKZ A;  1D1B A;  4LF6 T;  1XWM A;  3ZMS B;  4OYJ A;  4FJO A;  2QRX A;  4IDP A;  1SE7 A;  2KWH A;  5KE4 A;  4XAX B;  3VR9 A;  4DUZ T;  2NR4 A;  3Q5X A;  2UXD T;  2XTL A;  5JDF A;  2WDQ A;  5FY0 A;  2FJA A;  2X00 A;  5BP0 A;  1XNR T;  2V1D B;  2LOS A;  3GUA A;  3C4Z A;  4PW8 A;  5HYA A;  2JMH A;  3JC6 D;  2JQQ A;  2R6G F;  1KF6 A;  4X20 E;  3NZQ A;  2UXN B;  3C79 A;  4ZJT A;  1UUS A;  2HPJ A;  2NW9 A;  3DP7 A;  3N9O A;  2IDO B;  5FL0 A;  2XNT A;  3RC3 A;  4Q25 A;  4ZR6 A;  4IT4 A;  4U31 A;  2B76 A;  2BKO A;  4QAC A;  4X62 T;  5LXB A;  4EZH A;  4LMK A;  3M65 A;  2V6Y B;  4Z8X A;  2CEA A;  1YXR A;  3K3Q C;  1W0B A;  2LSJ A;  2N2N A;  3ZMV B;  4UVB B;  1UX5 A;  4YFS A;  2VAS A;  4JI3 T;  4IDO A;  3RIA A;  5AFH A;  1T8B A;  1M62 A;  2CRB A;  3BQK A;  4L5G A;  4PJM A;  2QVA A;  5DJQ C;  4AI6 A;  3VRB A;  1NAF A;  3HI2 A;  4IDN A;  1FJG T;  2XZE A;  4WNK A;  2QYW A;  5AQV B;  2BYS A;  4JV5 T;  1ZHC A;  3NWI A;  3AEA A;  2H7O A;  2V7K A;  3RQW A;  3UUL A;  2WSS V;  4D01 A;  4YY3 T;  3ZKR A;  1ZEE A;  1HFA A;  3Q5W A;  4H63 V;  4ANJ A;  2E9X C;  5J5H A;  4O2A E;  1FIO A;  2H89 A;  2LT3 A;  5HEH A;  1HR0 T;  3LSV A;  4ZK1 A;  2J4G A;  3FZH B;  3MK7 C;  2XY8 B;  2W0G A;  3MKD A;  4DBR A;  2YMD A;  5AIN A;  3WI3 A;  3ZJ2 A;  2XQY A;  1ZV4 X;  3NZP A;  4DV6 T;  4YSY A;  1FMV A;  3K1S A;  1XZY A;  4C90 A;  5AQI B;  3OJA A;  4AFG A;  5KX5 E;  1L0V A;  2XJ7 A;  3O9X A;  4LF9 T;  2XNU A;  4PJJ A;  1IBK T;  2BKP A;  5HEG A;  2DHR A;  5ABG A;  4HFE A;  5SYO A;  3FXE B;  3PUA A;  5LA6 E;  3I1A A;  2YOE A;  3ZYK A;  4TNV A;  5HXR A;  4OX9 T;  4YTP A;  5FYM A;  4LF5 T;  4JYA T;  4AKI A;  2XAQ B;  5AQU B;  3JAE A;  2V7M A;  4CN4 A;  3P4R A;  4CZZ B;  3UT5 E;  3T4M A;  5FXV A;  3WTN A;  4JBW F;  3CIR A;  3U78 A;  2E2A A;  2OA5 A;  3FBL A;  3VR8 A;  4ZHQ E;  2PGZ A;  4UM3 A;  4QAA A;  2BR7 A;  3OTO T;  3U8K A;  2V5C A;  2BYP A;  3ZDG A;  3W15 B;  4LMJ A;  3X1D A;  4UEM A;  4EGW A;  2YU2 A;  1E1H B;  4HTE A;  1S94 A; 
#chains in the Genus database with same CATH homology
 2YN6 A;  4IL4 A;  2UZ6 A;  5HEJ A;  5IUX A;  4ALX A;  3WTH A;  3JAF A;  5FJV A;  5CFB A;  3IGQ A;  1OED B;  2BG9 A;  1UV6 A;  5HEO A;  4LML A;  1UX2 A;  5L47 A;  4QAC A;  2Y58 A;  5LXB A;  4HQP A;  4AFG A;  3RI5 A;  4LMK A;  2LM2 A;  4ILC A;  2BYR A;  1OED E;  2XQ5 A;  2XNU A;  3RHW A;  2BYQ A;  2C9T A;  4TWH A;  4A98 A;  5AFK A;  4DBM A;  3WTI A;  3UQ7 A;  3UU4 A;  3TLW A;  3PMZ A;  5HEU A;  5HEG A;  1I9B A;  5J0Z A;  4UY2 A;  2XQ3 A;  2LKH A;  2QC1 B;  2W8G A;  1UW6 A;  4UM3 P;  2XQ9 A;  5AFN A;  5J5G A;  3SIO A;  5AFM B;  3C84 A;  2WNL A;  4HFB A;  2XYT A;  2Y7Y A;  3RIA A;  5AFH A;  4HFI A;  4TWD A;  4HFE A;  3UU3 A;  2XZ5 A;  4UXU A;  2WN9 A;  2XQA A;  5L4H A;  5SYO A;  3WTJ A;  4ILB A;  4TNW A;  2XQ6 A;  3EI0 A;  3JAD A;  4IL9 A;  2YOE A;  2BR8 A;  2LLY A;  4BQT A;  3EAM A;  4COF A;  4QH4 A;  2LKG A;  2XQ4 A;  3P4W A;  3TLT A;  5HCJ A;  4XK9 A;  4TNV A;  4HFC A;  2BYS A;  3U8N A;  4AFT A;  3PEO A;  5KE4 A;  4Z90 A;  5TVC A;  4QAB A;  3WTL A;  4ILA A;  2M6B A;  5J5F A;  3RQW A;  2XQ7 A;  4A97 A;  3UU6 A;  3U8M A;  3U8J A;  3JAE A;  2Y56 A;  5HCM A;  4NZB A;  4FRR A;  2WZY A;  4D01 A;  2Y57 A;  1OED C;  5JME A;  3ZKR A;  5KZU A;  5AFL A;  2BJ0 A;  3TLU A;  3T4M A;  2M6I A;  2X00 A;  5AFM A;  5J5I A;  5BP0 A;  3WTM A;  4F8H A;  3WTN A;  2YKS A;  3GUA A;  2MAW A;  5BRX A;  2KSR A;  2XNV A;  4UM3 S;  2W8F A;  2XQ8 A;  3SQ6 A;  2BYN A;  2XYS A;  5J5H A;  3TLS A;  2Y54 A;  4X5T A;  3UU8 A;  4PIR A;  3SH1 A;  3EHZ A;  4XHE A;  5AFJ A;  4HFH A;  5LG3 A;  3UU5 A;  2BG9 E;  4ZZC A;  2PGZ A;  2XZ6 A;  4QH5 A;  5HEH A;  2ZJU A;  3WIP A;  3UQ4 A;  2WNC A;  4NPP A;  4UM1 A;  4UM3 A;  4QAA A;  2BR7 A;  2VL0 A;  3SQ9 A;  3U8K A;  4WV9 A;  4QH1 A;  2X00 D;  3C79 A;  4AFH A;  4ZJT A;  2BG9 C;  5L4E A;  3TLV A;  5CO5 A;  4ZK4 A;  4TWF A;  2BYP A;  1OED A;  3LSV A;  3ZDG A;  4HFD A;  4ZK1 A;  2BG9 B;  3UUB A;  4B5D A;  2ZJV A;  2PH9 A;  4EZ1 A;  5BW2 A;  4LMJ A;  2WNJ A;  3WTO A;  3ZDH A;  3RIF A;  4ZJS A;  3RQU A;  4Z91 A;  4ZZB A;  3U8L A;  2XNT A;  2YME A;  3P50 A;  4BFQ A;  2YMD A;  5AIN A;  4IRE A;  4ZR6 A;  3WTK A;  4ZRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...