2ZJVA

Crystal structure of lymnaea stagnalis acetylcholine binding protein (ls-achbp) complexed with clothianidin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
208
structure length
208
Chain Sequence
AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Acetylcholine-binding protein
publication title Crystal structures of Lymnaea stagnalis AChBP in complex with neonicotinoid insecticides imidacloprid and clothianidin
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 51
structure length 208
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2zjvA00
3UU8A 3EHZA 4XK9A 5AFJA 5TVCA 3TLSA 3WTOA 4AFHA 4ZR6A 4IL4A 2XNVA 3UU6A 2PGZA 5AFNA 5JMEA 2BYNA 3JAEA 4IL9A 4BFQA 2XZ5A 2YMDA 3WTIA 2QC1B 4A98A 5IUXA 5HEOA 2X00D 3PMZA 3WTJA 4LMLA 3RIFA 5FJVA 4ZK1A 3UQ4A 2XYSA 4QH1A 3EAMA 5HCMA 4ILAA 5BP0A 4ZJSA 4HFCA 2Y58A 2BYRA 4HFHA 5AFHA 3U8KA 3ZDGA 2PH9A 4UY2A 2X00A 2Y57A 3WTHA 4LMJA 4X5TA 4HFDA 1UX2A 4AFGA 4BQTA 3WTLA 2BR8A 2XQ7A 2XZ6A 5J5IA 4TNWA 4ZZBA 5KZUA 2WZYA 3T4MA 4AFTA 5AINA 1I9BA 2XYTA 4HQPA 5BRXA 4QABA 3GUAA 4UM3S 4F8HA 4QH5A 3UU3A 2BG9B 2WNLA 2XQ6A 4LMKA 2XQ4A 4FRRA 4ZJTA 5HEGA 4Z90A 5HEJA 3WTKA 3WTNA 4QH4A 3ZDHA 5AFKA 5CO5A 3TLVA 2ZJUA 3TLUA 2YKSA 4Z91A 2W8FA 3RI5A 5AFMB 5J0ZA 3SIOA 3P4WA 2W8GA 2WNJA 5HCJA 3RHWA 4B5DA 2XNUA 3EI0A 4ALXA 3RQUA 3WTMA 3C79A 2WNCA 4A97A 3UUBA 2BYSA 4DBMA 5L47A 3LSVA 2WN9A 5CFBA 2UZ6A 2XQ5A 4NPPA 4ZK4A 2ZJVA 4UM3A 3P50A 4QACA 2BG9E 5LXBA 2BG9C 3UQ7A 3WIPA 5L4HA 3UU5A 4NZBA 5SYOA 2Y54A 3TLWA 4COFA 5L4EA 2BJ0A 4UXUA 3ZKRA 5J5FA 2BYPA 2Y7YA 4ILBA 4XHEA 2BR7A 2YOEA 1UW6A 2XNTA 3C84A 2BYQA 2VL0A 4HFIA 5HEHA 2XQ3A 3RIAA 1UV6A 3SQ9A 3U8LA 4HFBA 3U8JA 3U8NA 5AFMA 3IGQA 3JADA 2XQ8A 3PEOA 4QAAA 4ZZCA 4TWDA 3TLTA 5LG3A 4ILCA 2XQ9A 2YN6A 4UM1A 5KE4A 5J5GA 4HFEA 4IREA 4TWHA 3RQWA 2YMEA 4UM3P 5HEUA 2Y56A 4TNVA 5AFLA 3SQ6A 2BG9A 3JAFA 3UU4A 2XQAA 4PIRA 4WV9A 2C9TA 5J5HA 3U8MA 4TWFA 5BW2A 4D01A 4EZ1A 3SH1A 4ZRUA
chains in the Genus database with same CATH superfamily
3UU8A 3EHZA 4XK9A 5AFJA 5TVCA 3TLSA 3WTOA 4AFHA 4ZR6A 4IL4A 2XNVA 3UU6A 2PGZA 5AFNA 5JMEA 2BYNA 3JAEA 4IL9A 4BFQA 2XZ5A 2YMDA 3WTIA 2QC1B 4A98A 5IUXA 5HEOA 2X00D 3PMZA 3WTJA 4LMLA 3RIFA 5FJVA 4ZK1A 3UQ4A 2XYSA 4QH1A 3EAMA 5HCMA 4ILAA 5BP0A 4ZJSA 4HFCA 2Y58A 2BYRA 4HFHA 5AFHA 3U8KA 3ZDGA 2PH9A 4UY2A 2X00A 2Y57A 3WTHA 4LMJA 4X5TA 4HFDA 1UX2A 4AFGA 4BQTA 3WTLA 2BR8A 2XQ7A 2XZ6A 5J5IA 4TNWA 4ZZBA 5KZUA 2WZYA 3T4MA 4AFTA 5AINA 1I9BA 2XYTA 4HQPA 5BRXA 4QABA 3GUAA 4UM3S 4F8HA 4QH5A 3UU3A 2BG9B 2WNLA 2XQ6A 4LMKA 2XQ4A 4FRRA 4ZJTA 5HEGA 4Z90A 5HEJA 3WTKA 3WTNA 4QH4A 3ZDHA 5AFKA 5CO5A 3TLVA 2ZJUA 3TLUA 2YKSA 4Z91A 2W8FA 3RI5A 5AFMB 5J0ZA 3SIOA 3P4WA 2W8GA 2WNJA 5HCJA 3RHWA 4B5DA 2XNUA 3EI0A 4ALXA 3RQUA 3WTMA 3C79A 2WNCA 4A97A 3UUBA 2BYSA 4DBMA 5L47A 3LSVA 2WN9A 5CFBA 2UZ6A 2XQ5A 4NPPA 4ZK4A 2ZJVA 4UM3A 3P50A 4QACA 2BG9E 5LXBA 2BG9C 3UQ7A 3WIPA 5L4HA 3UU5A 4NZBA 5SYOA 2Y54A 3TLWA 4COFA 5L4EA 2BJ0A 4UXUA 3ZKRA 5J5FA 2BYPA 2Y7YA 4ILBA 4XHEA 2BR7A 2YOEA 1UW6A 2XNTA 3C84A 2BYQA 2VL0A 4HFIA 5HEHA 2XQ3A 3RIAA 1UV6A 3SQ9A 3U8LA 4HFBA 3U8JA 3U8NA 5AFMA 3IGQA 3JADA 2XQ8A 3PEOA 4QAAA 4ZZCA 4TWDA 3TLTA 5LG3A 4ILCA 2XQ9A 2YN6A 4UM1A 5KE4A 5J5GA 4HFEA 4IREA 4TWHA 3RQWA 2YMEA 4UM3P 5HEUA 2Y56A 4TNVA 5AFLA 3SQ6A 2BG9A 3JAFA 3UU4A 2XQAA 4PIRA 4WV9A 2C9TA 5J5HA 3U8MA 4TWFA 5BW2A 4D01A 4EZ1A 3SH1A 4ZRUA
chains in the Genus database with same CATH topology
3UU8A 3EHZA 4XK9A 5AFJA 5TVCA 3TLSA 3WTOA 4AFHA 4ZR6A 4IL4A 2XNVA 3UU6A 2PGZA 5AFNA 5JMEA 2BYNA 3JAEA 4IL9A 4BFQA 2XZ5A 2YMDA 3WTIA 2QC1B 4A98A 5IUXA 5HEOA 2X00D 3PMZA 3WTJA 4LMLA 3RIFA 5FJVA 4ZK1A 3UQ4A 2XYSA 4QH1A 3EAMA 5HCMA 4ILAA 5BP0A 4ZJSA 4HFCA 2Y58A 2BYRA 4HFHA 5AFHA 3U8KA 3ZDGA 2PH9A 4UY2A 2X00A 2Y57A 3WTHA 4LMJA 4X5TA 4HFDA 1UX2A 4AFGA 4BQTA 3WTLA 2BR8A 2XQ7A 2XZ6A 5J5IA 4TNWA 4ZZBA 5KZUA 2WZYA 3T4MA 4AFTA 5AINA 1I9BA 2XYTA 4HQPA 5BRXA 4QABA 3GUAA 4UM3S 4F8HA 4QH5A 3UU3A 2BG9B 2WNLA 2XQ6A 4LMKA 2XQ4A 4FRRA 4ZJTA 5HEGA 4Z90A 5HEJA 3WTKA 3WTNA 4QH4A 3ZDHA 5AFKA 5CO5A 3TLVA 2ZJUA 3TLUA 2YKSA 4Z91A 2W8FA 3RI5A 5AFMB 5J0ZA 3SIOA 3P4WA 2W8GA 2WNJA 5HCJA 3RHWA 4B5DA 2XNUA 3EI0A 4ALXA 3RQUA 3WTMA 3C79A 2WNCA 4A97A 3UUBA 2BYSA 4DBMA 5L47A 3LSVA 2WN9A 5CFBA 2UZ6A 2XQ5A 4NPPA 4ZK4A 2ZJVA 4UM3A 3P50A 4QACA 2BG9E 5LXBA 2BG9C 3UQ7A 3WIPA 5L4HA 3UU5A 4NZBA 5SYOA 2Y54A 3TLWA 4COFA 5L4EA 2BJ0A 4UXUA 3ZKRA 5J5FA 2BYPA 2Y7YA 4ILBA 4XHEA 2BR7A 2YOEA 1UW6A 2XNTA 3C84A 2BYQA 2VL0A 4HFIA 5HEHA 2XQ3A 3RIAA 1UV6A 3SQ9A 3U8LA 4HFBA 3U8JA 3U8NA 5AFMA 3IGQA 3JADA 2XQ8A 3PEOA 4QAAA 4ZZCA 4TWDA 3TLTA 5LG3A 4ILCA 2XQ9A 2YN6A 4UM1A 5KE4A 5J5GA 4HFEA 4IREA 4TWHA 3RQWA 2YMEA 4UM3P 5HEUA 2Y56A 4TNVA 5AFLA 3SQ6A 2BG9A 3JAFA 3UU4A 2XQAA 4PIRA 4WV9A 2C9TA 5J5HA 3U8MA 4TWFA 5BW2A 4D01A 4EZ1A 3SH1A 4ZRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU8 A;  3EHZ A;  4XK9 A;  5AFJ A;  5TVC A;  3TLS A;  3WTO A;  4AFH A;  4ZR6 A;  4IL4 A;  2XNV A;  3UU6 A;  2PGZ A;  5AFN A;  5JME A;  2BYN A;  3JAE A;  4IL9 A;  4BFQ A;  2XZ5 A;  2YMD A;  3WTI A;  2QC1 B;  4A98 A;  5IUX A;  5HEO A;  2X00 D;  3PMZ A;  3WTJ A;  4LML A;  3RIF A;  5FJV A;  4ZK1 A;  3UQ4 A;  2XYS A;  4QH1 A;  3EAM A;  5HCM A;  4ILA A;  5BP0 A;  4ZJS A;  4HFC A;  2Y58 A;  2BYR A;  4HFH A;  5AFH A;  3U8K A;  3ZDG A;  2PH9 A;  4UY2 A;  2X00 A;  2Y57 A;  3WTH A;  4LMJ A;  4X5T A;  4HFD A;  1UX2 A;  4AFG A;  4BQT A;  3WTL A;  2BR8 A;  2XQ7 A;  2XZ6 A;  5J5I A;  4TNW A;  4ZZB A;  5KZU A;  2WZY A;  3T4M A;  4AFT A;  5AIN A;  1I9B A;  2XYT A;  4HQP A;  5BRX A;  4QAB A;  3GUA A;  4UM3 S;  4F8H A;  4QH5 A;  3UU3 A;  2BG9 B;  2WNL A;  2XQ6 A;  4LMK A;  2XQ4 A;  4FRR A;  4ZJT A;  5HEG A;  4Z90 A;  5HEJ A;  3WTK A;  3WTN A;  4QH4 A;  3ZDH A;  5AFK A;  5CO5 A;  3TLV A;  2ZJU A;  3TLU A;  2YKS A;  4Z91 A;  2W8F A;  3RI5 A;  5AFM B;  5J0Z A;  3SIO A;  3P4W A;  2W8G A;  2WNJ A;  5HCJ A;  3RHW A;  4B5D A;  2XNU A;  3EI0 A;  4ALX A;  3RQU A;  3WTM A;  3C79 A;  2WNC A;  4A97 A;  3UUB A;  2BYS A;  4DBM A;  5L47 A;  3LSV A;  2WN9 A;  5CFB A;  2UZ6 A;  2XQ5 A;  4NPP A;  4ZK4 A;  2ZJV A;  4UM3 A;  3P50 A;  4QAC A;  2BG9 E;  5LXB A;  2BG9 C;  3UQ7 A;  3WIP A;  5L4H A;  3UU5 A;  4NZB A;  5SYO A;  2Y54 A;  3TLW A;  4COF A;  5L4E A;  2BJ0 A;  4UXU A;  3ZKR A;  5J5F A;  2BYP A;  2Y7Y A;  4ILB A;  4XHE A;  2BR7 A;  2YOE A;  1UW6 A;  2XNT A;  3C84 A;  2BYQ A;  2VL0 A;  4HFI A;  5HEH A;  2XQ3 A;  3RIA A;  1UV6 A;  3SQ9 A;  3U8L A;  4HFB A;  3U8J A;  3U8N A;  5AFM A;  3IGQ A;  3JAD A;  2XQ8 A;  3PEO A;  4QAA A;  4ZZC A;  4TWD A;  3TLT A;  5LG3 A;  4ILC A;  2XQ9 A;  2YN6 A;  4UM1 A;  5KE4 A;  5J5G A;  4HFE A;  4IRE A;  4TWH A;  3RQW A;  2YME A;  4UM3 P;  5HEU A;  2Y56 A;  4TNV A;  5AFL A;  3SQ6 A;  2BG9 A;  3JAF A;  3UU4 A;  2XQA A;  4PIR A;  4WV9 A;  2C9T A;  5J5H A;  3U8M A;  4TWF A;  5BW2 A;  4D01 A;  4EZ1 A;  3SH1 A;  4ZRU A; 
#chains in the Genus database with same CATH topology
 3UU8 A;  3EHZ A;  4XK9 A;  5AFJ A;  5TVC A;  3TLS A;  3WTO A;  4AFH A;  4ZR6 A;  4IL4 A;  2XNV A;  3UU6 A;  2PGZ A;  5AFN A;  5JME A;  2BYN A;  3JAE A;  4IL9 A;  4BFQ A;  2XZ5 A;  2YMD A;  3WTI A;  2QC1 B;  4A98 A;  5IUX A;  5HEO A;  2X00 D;  3PMZ A;  3WTJ A;  4LML A;  3RIF A;  5FJV A;  4ZK1 A;  3UQ4 A;  2XYS A;  4QH1 A;  3EAM A;  5HCM A;  4ILA A;  5BP0 A;  4ZJS A;  4HFC A;  2Y58 A;  2BYR A;  4HFH A;  5AFH A;  3U8K A;  3ZDG A;  2PH9 A;  4UY2 A;  2X00 A;  2Y57 A;  3WTH A;  4LMJ A;  4X5T A;  4HFD A;  1UX2 A;  4AFG A;  4BQT A;  3WTL A;  2BR8 A;  2XQ7 A;  2XZ6 A;  5J5I A;  4TNW A;  4ZZB A;  5KZU A;  2WZY A;  3T4M A;  4AFT A;  5AIN A;  1I9B A;  2XYT A;  4HQP A;  5BRX A;  4QAB A;  3GUA A;  4UM3 S;  4F8H A;  4QH5 A;  3UU3 A;  2BG9 B;  2WNL A;  2XQ6 A;  4LMK A;  2XQ4 A;  4FRR A;  4ZJT A;  5HEG A;  4Z90 A;  5HEJ A;  3WTK A;  3WTN A;  4QH4 A;  3ZDH A;  5AFK A;  5CO5 A;  3TLV A;  2ZJU A;  3TLU A;  2YKS A;  4Z91 A;  2W8F A;  3RI5 A;  5AFM B;  5J0Z A;  3SIO A;  3P4W A;  2W8G A;  2WNJ A;  5HCJ A;  3RHW A;  4B5D A;  2XNU A;  3EI0 A;  4ALX A;  3RQU A;  3WTM A;  3C79 A;  2WNC A;  4A97 A;  3UUB A;  2BYS A;  4DBM A;  5L47 A;  3LSV A;  2WN9 A;  5CFB A;  2UZ6 A;  2XQ5 A;  4NPP A;  4ZK4 A;  2ZJV A;  4UM3 A;  3P50 A;  4QAC A;  2BG9 E;  5LXB A;  2BG9 C;  3UQ7 A;  3WIP A;  5L4H A;  3UU5 A;  4NZB A;  5SYO A;  2Y54 A;  3TLW A;  4COF A;  5L4E A;  2BJ0 A;  4UXU A;  3ZKR A;  5J5F A;  2BYP A;  2Y7Y A;  4ILB A;  4XHE A;  2BR7 A;  2YOE A;  1UW6 A;  2XNT A;  3C84 A;  2BYQ A;  2VL0 A;  4HFI A;  5HEH A;  2XQ3 A;  3RIA A;  1UV6 A;  3SQ9 A;  3U8L A;  4HFB A;  3U8J A;  3U8N A;  5AFM A;  3IGQ A;  3JAD A;  2XQ8 A;  3PEO A;  4QAA A;  4ZZC A;  4TWD A;  3TLT A;  5LG3 A;  4ILC A;  2XQ9 A;  2YN6 A;  4UM1 A;  5KE4 A;  5J5G A;  4HFE A;  4IRE A;  4TWH A;  3RQW A;  2YME A;  4UM3 P;  5HEU A;  2Y56 A;  4TNV A;  5AFL A;  3SQ6 A;  2BG9 A;  3JAF A;  3UU4 A;  2XQA A;  4PIR A;  4WV9 A;  2C9T A;  5J5H A;  3U8M A;  4TWF A;  5BW2 A;  4D01 A;  4EZ1 A;  3SH1 A;  4ZRU A; 
#chains in the Genus database with same CATH homology
 3UU8 A;  3EHZ A;  4XK9 A;  5AFJ A;  5TVC A;  3TLS A;  3WTO A;  4AFH A;  4ZR6 A;  4IL4 A;  2XNV A;  3UU6 A;  2PGZ A;  5AFN A;  5JME A;  2BYN A;  3JAE A;  4IL9 A;  4BFQ A;  2XZ5 A;  2YMD A;  3WTI A;  2QC1 B;  4A98 A;  5IUX A;  5HEO A;  2X00 D;  3PMZ A;  3WTJ A;  4LML A;  3RIF A;  5FJV A;  4ZK1 A;  3UQ4 A;  2XYS A;  4QH1 A;  3EAM A;  5HCM A;  4ILA A;  5BP0 A;  4ZJS A;  4HFC A;  2Y58 A;  2BYR A;  4HFH A;  5AFH A;  3U8K A;  3ZDG A;  2PH9 A;  4UY2 A;  2X00 A;  2Y57 A;  3WTH A;  4LMJ A;  4X5T A;  4HFD A;  1UX2 A;  4AFG A;  4BQT A;  3WTL A;  2BR8 A;  2XQ7 A;  2XZ6 A;  5J5I A;  4TNW A;  4ZZB A;  5KZU A;  2WZY A;  3T4M A;  4AFT A;  5AIN A;  1I9B A;  2XYT A;  4HQP A;  5BRX A;  4QAB A;  3GUA A;  4UM3 S;  4F8H A;  4QH5 A;  3UU3 A;  2BG9 B;  2WNL A;  2XQ6 A;  4LMK A;  2XQ4 A;  4FRR A;  4ZJT A;  5HEG A;  4Z90 A;  5HEJ A;  3WTK A;  3WTN A;  4QH4 A;  3ZDH A;  5AFK A;  5CO5 A;  3TLV A;  2ZJU A;  3TLU A;  2YKS A;  4Z91 A;  2W8F A;  3RI5 A;  5AFM B;  5J0Z A;  3SIO A;  3P4W A;  2W8G A;  2WNJ A;  5HCJ A;  3RHW A;  4B5D A;  2XNU A;  3EI0 A;  4ALX A;  3RQU A;  3WTM A;  3C79 A;  2WNC A;  4A97 A;  3UUB A;  2BYS A;  4DBM A;  5L47 A;  3LSV A;  2WN9 A;  5CFB A;  2UZ6 A;  2XQ5 A;  4NPP A;  4ZK4 A;  2ZJV A;  4UM3 A;  3P50 A;  4QAC A;  2BG9 E;  5LXB A;  2BG9 C;  3UQ7 A;  3WIP A;  5L4H A;  3UU5 A;  4NZB A;  5SYO A;  2Y54 A;  3TLW A;  4COF A;  5L4E A;  2BJ0 A;  4UXU A;  3ZKR A;  5J5F A;  2BYP A;  2Y7Y A;  4ILB A;  4XHE A;  2BR7 A;  2YOE A;  1UW6 A;  2XNT A;  3C84 A;  2BYQ A;  2VL0 A;  4HFI A;  5HEH A;  2XQ3 A;  3RIA A;  1UV6 A;  3SQ9 A;  3U8L A;  4HFB A;  3U8J A;  3U8N A;  5AFM A;  3IGQ A;  3JAD A;  2XQ8 A;  3PEO A;  4QAA A;  4ZZC A;  4TWD A;  3TLT A;  5LG3 A;  4ILC A;  2XQ9 A;  2YN6 A;  4UM1 A;  5KE4 A;  5J5G A;  4HFE A;  4IRE A;  4TWH A;  3RQW A;  2YME A;  4UM3 P;  5HEU A;  2Y56 A;  4TNV A;  5AFL A;  3SQ6 A;  2BG9 A;  3JAF A;  3UU4 A;  2XQA A;  4PIR A;  4WV9 A;  2C9T A;  5J5H A;  3U8M A;  4TWF A;  5BW2 A;  4D01 A;  4EZ1 A;  3SH1 A;  4ZRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...