2ZJVA

Crystal structure of lymnaea stagnalis acetylcholine binding protein (ls-achbp) complexed with clothianidin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
208
structure length
208
Chain Sequence
AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Crystal structures of Lymnaea stagnalis AChBP in complex with neonicotinoid insecticides imidacloprid and clothianidin
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 51
structure length 208
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2zjvA00
2ZJVA 3JADA 3WTIA 2W8FA 5AINA 2WNJA 5J5FA 4LMLA 2C9TA 5BRXA 4QH5A 2VL0A 3EHZA 5HEGA 3RQWA 3UQ7A 1UW6A 5BW2A 2BJ0A 4HFDA 4COFA 4F8HA 3WTLA 2XZ6A 5AFJA 4FRRA 4XHEA 5J0ZA 5HEHA 4QABA 4HFCA 1UX2A 4AFGA 3WTKA 3WTHA 2XNVA 5KE4A 4ZRUA 5CFBA 2XNUA 4QACA 4LMKA 3U8KA 5BP0A 5FJVA 3C84A 5AFHA 2YKSA 3TLUA 5J5IA 2XZ5A 3UU4A 2XNTA 4IL9A 3TLSA 2X00A 3RIAA 4ZJTA 4IREA 4Z90A 5HEOA 4BQTA 2XQ6A 2BR8A 2X00D 3SH1A 3PEOA 5L47A 3UU3A 3IGQA 2PGZA 2XYSA 2Y57A 4IL4A 4TNVA 4ZR6A 3RIFA 4HFBA 5AFLA 4LMJA 4QH1A 4EZ1A 5AFNA 1I9BA 4UM1A 2XQ3A 5J5GA 3RHWA 3UUBA 5HEJA 4QAAA 2ZJUA 4ZK4A 2BYQA 3EI0A 3PMZA 4TWFA 3WTJA 3RI5A 3UU5A 3P4WA 2YMEA 3WTNA 5L4EA 4NZBA 4A97A 3JAEA 2YN6A 4UY2A 2XQ9A 3TLVA 4ALXA 2Y58A 2Y54A 4NPPA 2BG9C 3U8NA 4TNWA 4TWDA 4AFHA 3U8JA 5CO5A 2BYSA 3JAFA 2XYTA 3UQ4A 5AFMA 3GUAA 2Y56A 3LSVA 3SIOA 5L4HA 4A98A 3C79A 4HFEA 2WNCA 4QH4A 4HFIA 3TLWA 5SYOA 4HFHA 4ILBA 5KZUA 2BYRA 2Y7YA 2BYNA 3EAMA 2QC1B 2WN9A 4Z91A 2YMDA 2UZ6A 5HEUA 4HQPA 4ZZCA 4UM3P 5HCJA 3TLTA 4DBMA 2WNLA 2XQ8A 4ILAA 5JMEA 5IUXA 2XQ4A 4X5TA 3U8LA 3UU6A 4B5DA 5TVCA 3ZDHA 4BFQA 3UU8A 5HCMA 2BR7A 3WIPA 4ZJSA 3WTOA 2XQ5A 4ILCA 2W8GA 5LG3A 2BYPA 4AFTA 3U8MA 4UM3A 4TWHA 3ZDGA 5AFMB 3RQUA 2BG9A 4D01A 3T4MA 4WV9A 5J5HA 4UM3S 3ZKRA 5AFKA 2PH9A 4ZK1A 2BG9E 5LXBA 1UV6A 3P50A 3SQ9A 2XQAA 3SQ6A 4XK9A 2BG9B 2XQ7A 4PIRA 4UXUA 3WTMA 2WZYA 4ZZBA 2YOEA
chains in the Genus database with same CATH superfamily
2ZJVA 3JADA 3WTIA 2W8FA 5AINA 2WNJA 5J5FA 4LMLA 2C9TA 5BRXA 4QH5A 2VL0A 3EHZA 5HEGA 3RQWA 3UQ7A 1UW6A 5BW2A 2BJ0A 4HFDA 4COFA 4F8HA 3WTLA 2XZ6A 5AFJA 4FRRA 4XHEA 5J0ZA 5HEHA 4QABA 4HFCA 1UX2A 4AFGA 3WTKA 3WTHA 2XNVA 5KE4A 4ZRUA 5CFBA 2XNUA 4QACA 4LMKA 3U8KA 5BP0A 5FJVA 3C84A 5AFHA 2YKSA 3TLUA 5J5IA 2XZ5A 3UU4A 2XNTA 4IL9A 3TLSA 2X00A 3RIAA 4ZJTA 4IREA 4Z90A 5HEOA 4BQTA 2XQ6A 2BR8A 2X00D 3SH1A 3PEOA 5L47A 3UU3A 3IGQA 2PGZA 2XYSA 2Y57A 4IL4A 4TNVA 4ZR6A 3RIFA 4HFBA 5AFLA 4LMJA 4QH1A 4EZ1A 5AFNA 1I9BA 4UM1A 2XQ3A 5J5GA 3RHWA 3UUBA 5HEJA 4QAAA 2ZJUA 4ZK4A 2BYQA 3EI0A 3PMZA 4TWFA 3WTJA 3RI5A 3UU5A 3P4WA 2YMEA 3WTNA 5L4EA 4NZBA 4A97A 3JAEA 2YN6A 4UY2A 2XQ9A 3TLVA 4ALXA 2Y58A 2Y54A 4NPPA 2BG9C 3U8NA 4TNWA 4TWDA 4AFHA 3U8JA 5CO5A 2BYSA 3JAFA 2XYTA 3UQ4A 5AFMA 3GUAA 2Y56A 3LSVA 3SIOA 5L4HA 4A98A 3C79A 4HFEA 2WNCA 4QH4A 4HFIA 3TLWA 5SYOA 4HFHA 4ILBA 5KZUA 2BYRA 2Y7YA 2BYNA 3EAMA 2QC1B 2WN9A 4Z91A 2YMDA 2UZ6A 5HEUA 4HQPA 4ZZCA 4UM3P 5HCJA 3TLTA 4DBMA 2WNLA 2XQ8A 4ILAA 5JMEA 5IUXA 2XQ4A 4X5TA 3U8LA 3UU6A 4B5DA 5TVCA 3ZDHA 4BFQA 3UU8A 5HCMA 2BR7A 3WIPA 4ZJSA 3WTOA 2XQ5A 4ILCA 2W8GA 5LG3A 2BYPA 4AFTA 3U8MA 4UM3A 4TWHA 3ZDGA 5AFMB 3RQUA 2BG9A 4D01A 3T4MA 4WV9A 5J5HA 4UM3S 3ZKRA 5AFKA 2PH9A 4ZK1A 2BG9E 5LXBA 1UV6A 3P50A 3SQ9A 2XQAA 3SQ6A 4XK9A 2BG9B 2XQ7A 4PIRA 4UXUA 3WTMA 2WZYA 4ZZBA 2YOEA
chains in the Genus database with same CATH topology
2ZJVA 3JADA 3WTIA 2W8FA 5AINA 2WNJA 5J5FA 4LMLA 2C9TA 5BRXA 4QH5A 2VL0A 3EHZA 5HEGA 3RQWA 3UQ7A 1UW6A 5BW2A 2BJ0A 4HFDA 4COFA 4F8HA 3WTLA 2XZ6A 5AFJA 4FRRA 4XHEA 5J0ZA 5HEHA 4QABA 4HFCA 1UX2A 4AFGA 3WTKA 3WTHA 2XNVA 5KE4A 4ZRUA 5CFBA 2XNUA 4QACA 4LMKA 3U8KA 5BP0A 5FJVA 3C84A 5AFHA 2YKSA 3TLUA 5J5IA 2XZ5A 3UU4A 2XNTA 4IL9A 3TLSA 2X00A 3RIAA 4ZJTA 4IREA 4Z90A 5HEOA 4BQTA 2XQ6A 2BR8A 2X00D 3SH1A 3PEOA 5L47A 3UU3A 3IGQA 2PGZA 2XYSA 2Y57A 4IL4A 4TNVA 4ZR6A 3RIFA 4HFBA 5AFLA 4LMJA 4QH1A 4EZ1A 5AFNA 1I9BA 4UM1A 2XQ3A 5J5GA 3RHWA 3UUBA 5HEJA 4QAAA 2ZJUA 4ZK4A 2BYQA 3EI0A 3PMZA 4TWFA 3WTJA 3RI5A 3UU5A 3P4WA 2YMEA 3WTNA 5L4EA 4NZBA 4A97A 3JAEA 2YN6A 4UY2A 2XQ9A 3TLVA 4ALXA 2Y58A 2Y54A 4NPPA 2BG9C 3U8NA 4TNWA 4TWDA 4AFHA 3U8JA 5CO5A 2BYSA 3JAFA 2XYTA 3UQ4A 5AFMA 3GUAA 2Y56A 3LSVA 3SIOA 5L4HA 4A98A 3C79A 4HFEA 2WNCA 4QH4A 4HFIA 3TLWA 5SYOA 4HFHA 4ILBA 5KZUA 2BYRA 2Y7YA 2BYNA 3EAMA 2QC1B 2WN9A 4Z91A 2YMDA 2UZ6A 5HEUA 4HQPA 4ZZCA 4UM3P 5HCJA 3TLTA 4DBMA 2WNLA 2XQ8A 4ILAA 5JMEA 5IUXA 2XQ4A 4X5TA 3U8LA 3UU6A 4B5DA 5TVCA 3ZDHA 4BFQA 3UU8A 5HCMA 2BR7A 3WIPA 4ZJSA 3WTOA 2XQ5A 4ILCA 2W8GA 5LG3A 2BYPA 4AFTA 3U8MA 4UM3A 4TWHA 3ZDGA 5AFMB 3RQUA 2BG9A 4D01A 3T4MA 4WV9A 5J5HA 4UM3S 3ZKRA 5AFKA 2PH9A 4ZK1A 2BG9E 5LXBA 1UV6A 3P50A 3SQ9A 2XQAA 3SQ6A 4XK9A 2BG9B 2XQ7A 4PIRA 4UXUA 3WTMA 2WZYA 4ZZBA 2YOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJV A;  3JAD A;  3WTI A;  2W8F A;  5AIN A;  2WNJ A;  5J5F A;  4LML A;  2C9T A;  5BRX A;  4QH5 A;  2VL0 A;  3EHZ A;  5HEG A;  3RQW A;  3UQ7 A;  1UW6 A;  5BW2 A;  2BJ0 A;  4HFD A;  4COF A;  4F8H A;  3WTL A;  2XZ6 A;  5AFJ A;  4FRR A;  4XHE A;  5J0Z A;  5HEH A;  4QAB A;  4HFC A;  1UX2 A;  4AFG A;  3WTK A;  3WTH A;  2XNV A;  5KE4 A;  4ZRU A;  5CFB A;  2XNU A;  4QAC A;  4LMK A;  3U8K A;  5BP0 A;  5FJV A;  3C84 A;  5AFH A;  2YKS A;  3TLU A;  5J5I A;  2XZ5 A;  3UU4 A;  2XNT A;  4IL9 A;  3TLS A;  2X00 A;  3RIA A;  4ZJT A;  4IRE A;  4Z90 A;  5HEO A;  4BQT A;  2XQ6 A;  2BR8 A;  2X00 D;  3SH1 A;  3PEO A;  5L47 A;  3UU3 A;  3IGQ A;  2PGZ A;  2XYS A;  2Y57 A;  4IL4 A;  4TNV A;  4ZR6 A;  3RIF A;  4HFB A;  5AFL A;  4LMJ A;  4QH1 A;  4EZ1 A;  5AFN A;  1I9B A;  4UM1 A;  2XQ3 A;  5J5G A;  3RHW A;  3UUB A;  5HEJ A;  4QAA A;  2ZJU A;  4ZK4 A;  2BYQ A;  3EI0 A;  3PMZ A;  4TWF A;  3WTJ A;  3RI5 A;  3UU5 A;  3P4W A;  2YME A;  3WTN A;  5L4E A;  4NZB A;  4A97 A;  3JAE A;  2YN6 A;  4UY2 A;  2XQ9 A;  3TLV A;  4ALX A;  2Y58 A;  2Y54 A;  4NPP A;  2BG9 C;  3U8N A;  4TNW A;  4TWD A;  4AFH A;  3U8J A;  5CO5 A;  2BYS A;  3JAF A;  2XYT A;  3UQ4 A;  5AFM A;  3GUA A;  2Y56 A;  3LSV A;  3SIO A;  5L4H A;  4A98 A;  3C79 A;  4HFE A;  2WNC A;  4QH4 A;  4HFI A;  3TLW A;  5SYO A;  4HFH A;  4ILB A;  5KZU A;  2BYR A;  2Y7Y A;  2BYN A;  3EAM A;  2QC1 B;  2WN9 A;  4Z91 A;  2YMD A;  2UZ6 A;  5HEU A;  4HQP A;  4ZZC A;  4UM3 P;  5HCJ A;  3TLT A;  4DBM A;  2WNL A;  2XQ8 A;  4ILA A;  5JME A;  5IUX A;  2XQ4 A;  4X5T A;  3U8L A;  3UU6 A;  4B5D A;  5TVC A;  3ZDH A;  4BFQ A;  3UU8 A;  5HCM A;  2BR7 A;  3WIP A;  4ZJS A;  3WTO A;  2XQ5 A;  4ILC A;  2W8G A;  5LG3 A;  2BYP A;  4AFT A;  3U8M A;  4UM3 A;  4TWH A;  3ZDG A;  5AFM B;  3RQU A;  2BG9 A;  4D01 A;  3T4M A;  4WV9 A;  5J5H A;  4UM3 S;  3ZKR A;  5AFK A;  2PH9 A;  4ZK1 A;  2BG9 E;  5LXB A;  1UV6 A;  3P50 A;  3SQ9 A;  2XQA A;  3SQ6 A;  4XK9 A;  2BG9 B;  2XQ7 A;  4PIR A;  4UXU A;  3WTM A;  2WZY A;  4ZZB A;  2YOE A; 
#chains in the Genus database with same CATH topology
 2ZJV A;  3JAD A;  3WTI A;  2W8F A;  5AIN A;  2WNJ A;  5J5F A;  4LML A;  2C9T A;  5BRX A;  4QH5 A;  2VL0 A;  3EHZ A;  5HEG A;  3RQW A;  3UQ7 A;  1UW6 A;  5BW2 A;  2BJ0 A;  4HFD A;  4COF A;  4F8H A;  3WTL A;  2XZ6 A;  5AFJ A;  4FRR A;  4XHE A;  5J0Z A;  5HEH A;  4QAB A;  4HFC A;  1UX2 A;  4AFG A;  3WTK A;  3WTH A;  2XNV A;  5KE4 A;  4ZRU A;  5CFB A;  2XNU A;  4QAC A;  4LMK A;  3U8K A;  5BP0 A;  5FJV A;  3C84 A;  5AFH A;  2YKS A;  3TLU A;  5J5I A;  2XZ5 A;  3UU4 A;  2XNT A;  4IL9 A;  3TLS A;  2X00 A;  3RIA A;  4ZJT A;  4IRE A;  4Z90 A;  5HEO A;  4BQT A;  2XQ6 A;  2BR8 A;  2X00 D;  3SH1 A;  3PEO A;  5L47 A;  3UU3 A;  3IGQ A;  2PGZ A;  2XYS A;  2Y57 A;  4IL4 A;  4TNV A;  4ZR6 A;  3RIF A;  4HFB A;  5AFL A;  4LMJ A;  4QH1 A;  4EZ1 A;  5AFN A;  1I9B A;  4UM1 A;  2XQ3 A;  5J5G A;  3RHW A;  3UUB A;  5HEJ A;  4QAA A;  2ZJU A;  4ZK4 A;  2BYQ A;  3EI0 A;  3PMZ A;  4TWF A;  3WTJ A;  3RI5 A;  3UU5 A;  3P4W A;  2YME A;  3WTN A;  5L4E A;  4NZB A;  4A97 A;  3JAE A;  2YN6 A;  4UY2 A;  2XQ9 A;  3TLV A;  4ALX A;  2Y58 A;  2Y54 A;  4NPP A;  2BG9 C;  3U8N A;  4TNW A;  4TWD A;  4AFH A;  3U8J A;  5CO5 A;  2BYS A;  3JAF A;  2XYT A;  3UQ4 A;  5AFM A;  3GUA A;  2Y56 A;  3LSV A;  3SIO A;  5L4H A;  4A98 A;  3C79 A;  4HFE A;  2WNC A;  4QH4 A;  4HFI A;  3TLW A;  5SYO A;  4HFH A;  4ILB A;  5KZU A;  2BYR A;  2Y7Y A;  2BYN A;  3EAM A;  2QC1 B;  2WN9 A;  4Z91 A;  2YMD A;  2UZ6 A;  5HEU A;  4HQP A;  4ZZC A;  4UM3 P;  5HCJ A;  3TLT A;  4DBM A;  2WNL A;  2XQ8 A;  4ILA A;  5JME A;  5IUX A;  2XQ4 A;  4X5T A;  3U8L A;  3UU6 A;  4B5D A;  5TVC A;  3ZDH A;  4BFQ A;  3UU8 A;  5HCM A;  2BR7 A;  3WIP A;  4ZJS A;  3WTO A;  2XQ5 A;  4ILC A;  2W8G A;  5LG3 A;  2BYP A;  4AFT A;  3U8M A;  4UM3 A;  4TWH A;  3ZDG A;  5AFM B;  3RQU A;  2BG9 A;  4D01 A;  3T4M A;  4WV9 A;  5J5H A;  4UM3 S;  3ZKR A;  5AFK A;  2PH9 A;  4ZK1 A;  2BG9 E;  5LXB A;  1UV6 A;  3P50 A;  3SQ9 A;  2XQA A;  3SQ6 A;  4XK9 A;  2BG9 B;  2XQ7 A;  4PIR A;  4UXU A;  3WTM A;  2WZY A;  4ZZB A;  2YOE A; 
#chains in the Genus database with same CATH homology
 2ZJV A;  3JAD A;  3WTI A;  2W8F A;  5AIN A;  2WNJ A;  5J5F A;  4LML A;  2C9T A;  5BRX A;  4QH5 A;  2VL0 A;  3EHZ A;  5HEG A;  3RQW A;  3UQ7 A;  1UW6 A;  5BW2 A;  2BJ0 A;  4HFD A;  4COF A;  4F8H A;  3WTL A;  2XZ6 A;  5AFJ A;  4FRR A;  4XHE A;  5J0Z A;  5HEH A;  4QAB A;  4HFC A;  1UX2 A;  4AFG A;  3WTK A;  3WTH A;  2XNV A;  5KE4 A;  4ZRU A;  5CFB A;  2XNU A;  4QAC A;  4LMK A;  3U8K A;  5BP0 A;  5FJV A;  3C84 A;  5AFH A;  2YKS A;  3TLU A;  5J5I A;  2XZ5 A;  3UU4 A;  2XNT A;  4IL9 A;  3TLS A;  2X00 A;  3RIA A;  4ZJT A;  4IRE A;  4Z90 A;  5HEO A;  4BQT A;  2XQ6 A;  2BR8 A;  2X00 D;  3SH1 A;  3PEO A;  5L47 A;  3UU3 A;  3IGQ A;  2PGZ A;  2XYS A;  2Y57 A;  4IL4 A;  4TNV A;  4ZR6 A;  3RIF A;  4HFB A;  5AFL A;  4LMJ A;  4QH1 A;  4EZ1 A;  5AFN A;  1I9B A;  4UM1 A;  2XQ3 A;  5J5G A;  3RHW A;  3UUB A;  5HEJ A;  4QAA A;  2ZJU A;  4ZK4 A;  2BYQ A;  3EI0 A;  3PMZ A;  4TWF A;  3WTJ A;  3RI5 A;  3UU5 A;  3P4W A;  2YME A;  3WTN A;  5L4E A;  4NZB A;  4A97 A;  3JAE A;  2YN6 A;  4UY2 A;  2XQ9 A;  3TLV A;  4ALX A;  2Y58 A;  2Y54 A;  4NPP A;  2BG9 C;  3U8N A;  4TNW A;  4TWD A;  4AFH A;  3U8J A;  5CO5 A;  2BYS A;  3JAF A;  2XYT A;  3UQ4 A;  5AFM A;  3GUA A;  2Y56 A;  3LSV A;  3SIO A;  5L4H A;  4A98 A;  3C79 A;  4HFE A;  2WNC A;  4QH4 A;  4HFI A;  3TLW A;  5SYO A;  4HFH A;  4ILB A;  5KZU A;  2BYR A;  2Y7Y A;  2BYN A;  3EAM A;  2QC1 B;  2WN9 A;  4Z91 A;  2YMD A;  2UZ6 A;  5HEU A;  4HQP A;  4ZZC A;  4UM3 P;  5HCJ A;  3TLT A;  4DBM A;  2WNL A;  2XQ8 A;  4ILA A;  5JME A;  5IUX A;  2XQ4 A;  4X5T A;  3U8L A;  3UU6 A;  4B5D A;  5TVC A;  3ZDH A;  4BFQ A;  3UU8 A;  5HCM A;  2BR7 A;  3WIP A;  4ZJS A;  3WTO A;  2XQ5 A;  4ILC A;  2W8G A;  5LG3 A;  2BYP A;  4AFT A;  3U8M A;  4UM3 A;  4TWH A;  3ZDG A;  5AFM B;  3RQU A;  2BG9 A;  4D01 A;  3T4M A;  4WV9 A;  5J5H A;  4UM3 S;  3ZKR A;  5AFK A;  2PH9 A;  4ZK1 A;  2BG9 E;  5LXB A;  1UV6 A;  3P50 A;  3SQ9 A;  2XQA A;  3SQ6 A;  4XK9 A;  2BG9 B;  2XQ7 A;  4PIR A;  4UXU A;  3WTM A;  2WZY A;  4ZZB A;  2YOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...